F440450

General Info

Members Datasets Scaffolds Average Seq Length
423 207 846 55

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100062549|Ga0070683_1000625494
Length 63
Sequence VRNEKGSVPVRYWILWWTLIAIADFVFYVLLTPIWIGLRVVAWLAEFRARRRKSGGSGRFARG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.86
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 10.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100062549 3300005329 Bacteria 3461
2 Ga0070658_10018785 3300005327 Bacteria 5537
3 Ga0070658_10043711 3300005327 Bacteria 3619
4 Ga0070658_10189980 3300005327 Bacteria 1731
5 Ga0070658_10405955 3300005327 Bacteria 1170
6 Ga0070658_11044637 3300005327 Bacteria 711
7 Ga0070683_101362802 3300005329 Bacteria 682
8 Ga0070680_100025693 3300005336 Bacteria 4708
9 Ga0070680_100202363 3300005336 Bacteria 1675
10 Ga0070680_100240542 3300005336 Bacteria 1530
11 Ga0070682_100084371 3300005337 Bacteria 2064
12 Ga0070682_100179984 3300005337 Bacteria 1476
13 Ga0070682_100969261 3300005337 Bacteria 704
14 Ga0070660_100002970 3300005339 Bacteria 11669
15 Ga0070660_100026497 3300005339 Bacteria 4316
16 Ga0070660_100049188 3300005339 Bacteria 3241
17 Ga0070660_100798805 3300005339 Bacteria 793
18 Ga0070660_101498388 3300005339 Bacteria 574
19 Ga0070661_100111189 3300005344 Bacteria 2046
20 Ga0070661_100152079 3300005344 Bacteria 1750
21 Ga0070661_100965771 3300005344 Bacteria 706
22 Ga0070659_100826402 3300005366 Bacteria 807
23 Ga0070659_101636590 3300005366 Unclassified 575
24 Ga0070709_10164819 3300005434 Bacteria 1544
25 Ga0070709_10729899 3300005434 Bacteria 773
26 Ga0070709_10967780 3300005434 Bacteria 676
27 Ga0070714_100018200 3300005435 Bacteria 5702
28 Ga0070714_100063589 3300005435 Bacteria 3174
29 Ga0070714_100091138 3300005435 Bacteria 2670
30 Ga0070714_100121260 3300005435 Bacteria 2326
31 Ga0070714_101806732 3300005435 Bacteria 597
32 Ga0070714_102405051 3300005435 Bacteria 512
33 Ga0070713_100088924 3300005436 Bacteria 2652
34 Ga0070713_101227350 3300005436 Bacteria 726
35 Ga0070713_102194977 3300005436 Unclassified 535
36 Ga0070711_101669052 3300005439 Bacteria 558
37 Ga0070694_100397183 3300005444 Bacteria 1079
38 Ga0070708_100249305 3300005445 Bacteria 1668
39 Ga0070708_100339476 3300005445 Bacteria 1416
40 Ga0070681_10049180 3300005458 Bacteria 4212
41 Ga0070681_10136638 3300005458 Bacteria 2382
42 Ga0070681_10270662 3300005458 Bacteria 1610
43 Ga0070681_10290324 3300005458 Bacteria 1545
44 Ga0070681_10298221 3300005458 Unclassified 1522
45 Ga0070681_11040683 3300005458 Unclassified 739
46 Ga0070707_100223499 3300005468 Bacteria 1834
47 Ga0070707_100513020 3300005468 Bacteria 1161
48 Ga0070698_100048670 3300005471 Bacteria 4332
49 Ga0070698_100722501 3300005471 Bacteria 939
50 Ga0070699_100079857 3300005518 Unclassified 2850
51 Ga0070699_100422149 3300005518 Bacteria 1207
52 Ga0070679_100085797 3300005530 Bacteria 3135
53 Ga0070679_100170711 3300005530 Bacteria 2148
54 Ga0070679_100463961 3300005530 Bacteria 1211
55 Ga0070679_100632564 3300005530 Unclassified 1013
56 Ga0070684_100035656 3300005535 Bacteria 4259
57 Ga0070684_100063523 3300005535 Bacteria 3237
58 Ga0070684_101470935 3300005535 Bacteria 642
59 Ga0070697_100202876 3300005536 Bacteria 1686
60 Ga0068853_100858344 3300005539 Bacteria 871
61 Ga0068853_100960682 3300005539 Bacteria 822
62 Ga0070695_100246276 3300005545 Bacteria 1299
63 Ga0070696_100552392 3300005546 Bacteria 923
64 Ga0070696_100795489 3300005546 Bacteria 778
65 Ga0070693_100891087 3300005547 Unclassified 666
66 Ga0070704_101029994 3300005549 Bacteria 745
67 Ga0068855_100037023 3300005563 Bacteria 5805
68 Ga0068855_102312058 3300005563 Unclassified 538
69 Ga0070664_101218977 3300005564 Bacteria 710
70 Ga0068854_100256677 3300005578 Bacteria 1398
71 Ga0068856_100492285 3300005614 Bacteria 1247
72 Ga0070702_101066325 3300005615 Bacteria 644
73 Ga0068852_100297929 3300005616 Bacteria 1560
74 Ga0068852_100618593 3300005616 Bacteria 1088
75 Ga0068852_101664638 3300005616 Bacteria 660
76 Ga0070717_10074096 3300006028 Bacteria 2845
77 Ga0070717_11614446 3300006028 Bacteria 587
78 Ga0070715_10737434 3300006163 Unclassified 592
79 Ga0070712_100406957 3300006175 Bacteria 1125
80 Ga0070712_101050323 3300006175 Bacteria 706
81 Ga0070712_101854672 3300006175 Unclassified 528
82 Ga0075433_10639732 3300006852 Bacteria 933
83 Ga0075434_101285348 3300006871 Bacteria 743
84 Ga0075436_100252943 3300006914 Bacteria 1255
85 Ga0075436_101489209 3300006914 Bacteria 514
86 Ga0105240_10026332 3300009093 Bacteria 7630
87 Ga0105240_10222520 3300009093 Bacteria 2198
88 Ga0105240_10410642 3300009093 Bacteria 1523
89 Ga0105240_12412867 3300009093 Bacteria 544
90 Ga0105245_12641036 3300009098 Bacteria 555
91 Ga0114129_10398914 3300009147 Bacteria 1813
92 Ga0105241_11511379 3300009174 Bacteria 647
93 Ga0105242_10449753 3300009176 Bacteria 1214
94 Ga0105238_11153821 3300009551 Bacteria 798
95 Ga0105238_12594019 3300009551 Bacteria 543
96 Ga0105239_12470207 3300010375 Bacteria 605
97 Ga0157373_10160193 3300013100 Bacteria 1583
98 Ga0157373_10317774 3300013100 Bacteria 1107
99 Ga0157373_10660921 3300013100 Bacteria 764
100 Ga0157371_10881054 3300013102 Bacteria 678
101 Ga0157370_10045095 3300013104 Bacteria 4232
102 Ga0157370_10175342 3300013104 Bacteria 1993
103 Ga0157369_10036038 3300013105 Bacteria 5423
104 Ga0157369_10202132 3300013105 Bacteria 2085
105 Ga0157369_11032506 3300013105 Bacteria 841
106 Ga0157369_11238203 3300013105 Bacteria 761
107 Ga0157372_10346660 3300013307 Bacteria 1730
108 Ga0157372_10866692 3300013307 Bacteria 1048
109 Ga0157372_10920320 3300013307 Bacteria 1014
110 Ga0157372_11962554 3300013307 Viruses 673
111 Ga0157375_11378007 3300013308 Bacteria 830
112 Ga0182008_10006559 3300014497 Bacteria 6498
113 Ga0182008_10098057 3300014497 Bacteria 1447
114 Ga0182008_10425938 3300014497 Bacteria 717
115 Ga0182006_1157678 3300015261 Bacteria 766
116 Ga0182007_10004120 3300015262 Bacteria 6673
117 Ga0197907_10314734 3300020069 Bacteria 3689
118 Ga0206356_11178554 3300020070 Bacteria 1487
119 Ga0206356_11340232 3300020070 Bacteria 3024
120 Ga0206356_11704696 3300020070 Bacteria 2083
121 Ga0206354_10331733 3300020081 Bacteria 580
122 Ga0206354_11293241 3300020081 Bacteria 1626
123 Ga0206354_11597317 3300020081 Bacteria 1733
124 Ga0206353_10082997 3300020082 Bacteria 724
125 Ga0206353_10792442 3300020082 Bacteria 5196
126 Ga0206353_11844130 3300020082 Bacteria 983
127 Ga0206353_11919948 3300020082 Bacteria 2754
128 Ga0207685_10334619 3300025905 Unclassified 759
129 Ga0207699_10265645 3300025906 Bacteria 1187
130 Ga0207699_10313803 3300025906 Bacteria 1098
131 Ga0207699_11214292 3300025906 Unclassified 558
132 Ga0207705_10067379 3300025909 Bacteria 2590
133 Ga0207705_10299831 3300025909 Bacteria 1232
134 Ga0207684_10451316 3300025910 Unclassified 1104
135 Ga0207707_10094757 3300025912 Bacteria 2609
136 Ga0207707_10153119 3300025912 Bacteria 2016
137 Ga0207707_10354740 3300025912 Bacteria 1263
138 Ga0207707_10374684 3300025912 Bacteria 1224
139 Ga0207707_10733849 3300025912 Bacteria 827
140 Ga0207695_10027775 3300025913 Bacteria 6295
141 Ga0207693_10249089 3300025915 Unclassified 1394
142 Ga0207693_10819775 3300025915 Bacteria 717
143 Ga0207693_11115881 3300025915 Bacteria 598
144 Ga0207693_11322694 3300025915 Bacteria 538
145 Ga0207663_10347459 3300025916 Bacteria 1122
146 Ga0207660_10049435 3300025917 Bacteria 2981
147 Ga0207660_10067458 3300025917 Bacteria 2591
148 Ga0207660_10382637 3300025917 Bacteria 1131
149 Ga0207660_10645051 3300025917 Bacteria 863
150 Ga0207660_10714191 3300025917 Bacteria 818
151 Ga0207657_10007679 3300025919 Bacteria 11024
152 Ga0207657_10011480 3300025919 Bacteria 8795
153 Ga0207657_10087118 3300025919 Bacteria 2613
154 Ga0207657_10551634 3300025919 Bacteria 901
155 Ga0207657_10576150 3300025919 Bacteria 879
156 Ga0207657_11047093 3300025919 Bacteria 625
157 Ga0207649_10421512 3300025920 Bacteria 1002
158 Ga0207649_10992276 3300025920 Bacteria 661
159 Ga0207652_10008146 3300025921 Bacteria 8415
160 Ga0207652_10256891 3300025921 Bacteria 1576
161 Ga0207652_10412975 3300025921 Unclassified 1217
162 Ga0207652_10448274 3300025921 Bacteria 1163
163 Ga0207652_10468700 3300025921 Bacteria 1135
164 Ga0207646_10354441 3300025922 Bacteria 1326
165 Ga0207646_10858933 3300025922 Bacteria 806
166 Ga0207700_10057152 3300025928 Bacteria 2941
167 Ga0207700_10576982 3300025928 Bacteria 1000
168 Ga0207700_11436601 3300025928 Bacteria 613
169 Ga0207664_10043861 3300025929 Bacteria 3500
170 Ga0207664_10071700 3300025929 Bacteria 2791
171 Ga0207664_10103770 3300025929 Bacteria 2353
172 Ga0207664_10611650 3300025929 Bacteria 979
173 Ga0207664_11072361 3300025929 Bacteria 721
174 Ga0207664_11185436 3300025929 Bacteria 681
175 Ga0207664_11275378 3300025929 Bacteria 654
176 Ga0207664_11767738 3300025929 Unclassified 541
177 Ga0207690_10366222 3300025932 Bacteria 1143
178 Ga0207690_10692370 3300025932 Bacteria 837
179 Ga0207690_11760009 3300025932 Unclassified 517
180 Ga0207661_10277264 3300025944 Bacteria 1498
181 Ga0207661_12110214 3300025944 Bacteria 510
182 Ga0207667_10170277 3300025949 Bacteria 2238
183 Ga0207667_10352157 3300025949 Bacteria 1502
184 Ga0207640_10091194 3300025981 Bacteria 2111
185 Ga0207639_10395605 3300026041 Bacteria 1244
186 Ga0207678_11625278 3300026067 Bacteria 569
187 Ga0207702_11924476 3300026078 Bacteria 582
188 Ga0207698_10309576 3300026142 Bacteria 1474
189 Ga0207698_11277669 3300026142 Bacteria 748
190 Ga0265337_1109565 3300028556 Bacteria 750
191 Ga0265326_10062825 3300028558 Bacteria 1050
192 Ga0265319_1000592 3300028563 Bacteria 24262
193 Ga0265319_1003854 3300028563 Bacteria 7666
194 Ga0265334_10065932 3300028573 Bacteria 1356
195 Ga0265334_10092540 3300028573 Unclassified 1101
196 Ga0265334_10242970 3300028573 Bacteria 620
197 Ga0265318_10000219 3300028577 Bacteria 49788
198 Ga0265318_10009436 3300028577 Bacteria 4291
199 Ga0265323_10038956 3300028653 Bacteria 1734
200 Ga0265322_10022724 3300028654 Bacteria 1794
201 Ga0265336_10043865 3300028666 Bacteria 1362
202 Ga0265336_10176938 3300028666 Bacteria 635
203 Ga0265338_10017781 3300028800 Bacteria 7643
204 Ga0265338_10070945 3300028800 Bacteria 2983
205 Ga0265330_10056692 3300031235 Bacteria 1710
206 Ga0265330_10350856 3300031235 Bacteria 623
207 Ga0265332_10019305 3300031238 Bacteria 3008
208 Ga0265328_10005682 3300031239 Bacteria 5327
209 Ga0265320_10029161 3300031240 Bacteria 2857
210 Ga0265320_10040273 3300031240 Bacteria 2331
211 Ga0265325_10000443 3300031241 Bacteria 29809
212 Ga0265325_10297039 3300031241 Bacteria 722
213 Ga0265329_10021343 3300031242 Bacteria 2175
214 Ga0265329_10121934 3300031242 Bacteria 836
215 Ga0265340_10001255 3300031247 Bacteria 14573
216 Ga0265340_10126452 3300031247 Unclassified 1174
217 Ga0265339_10034855 3300031249 Bacteria 2826
218 Ga0265331_10052901 3300031250 Bacteria 1938
219 Ga0265327_10009396 3300031251 Bacteria 7060
220 Ga0265327_10017856 3300031251 Bacteria 4426
221 Ga0265327_10031105 3300031251 Bacteria 3005
222 Ga0265327_10397079 3300031251 Bacteria 599
223 Ga0265316_10004108 3300031344 Bacteria 14573
224 Ga0265316_10024864 3300031344 Bacteria 5005
225 Ga0265313_10423976 3300031595 Bacteria 519
226 Ga0265314_10028527 3300031711 Bacteria 4160
227 Ga0265314_10323876 3300031711 Bacteria 856
228 Ga0265342_10272181 3300031712 Unclassified 898
229 Ga0373932_0262434 3300035112 Unclassified 634
230 Ga0373953_0033929 3300035117 Bacteria 1999
231 Ga0373924_0144617 3300035410 Bacteria 1038
232 Ga0373933_0033168 3300035724 Bacteria 3002
233 Ga0373947_0020292 3300035725 Bacteria 3836
234 Ga0373937_0211832 3300036401 Bacteria 1823
235 Ga0373937_0342704 3300036401 Bacteria 1415
236 Ga0373937_1288947 3300036401 Bacteria 679
237 Ga0373925_0095528 3300037068 Bacteria 2277
238 Ga0395899_0016395 3300037312 Bacteria 5647
239 Ga0395899_0041450 3300037312 Bacteria 3440
240 Ga0395899_0106852 3300037312 Bacteria 2015
241 Ga0395899_0145006 3300037312 Bacteria 1687
242 Ga0395899_0411798 3300037312 Bacteria 892
243 Ga0395900_0029652 3300037418 Bacteria 5613
244 Ga0395900_0032358 3300037418 Bacteria 5378
245 Ga0395900_0050558 3300037418 Bacteria 4281
246 Ga0395900_0261913 3300037418 Bacteria 1726
247 Ga0395900_0463899 3300037418 Bacteria 1221
248 Ga0395900_1609317 3300037418 Unclassified 561
249 Ga0395900_1697013 3300037418 Unclassified 543
250 Ga0395898_0009901 3300037466 Bacteria 9989
251 Ga0395898_0086021 3300037466 Bacteria 3030
252 Ga0395898_0088036 3300037466 Bacteria 2990
253 Ga0395898_0252552 3300037466 Bacteria 1682
254 Ga0395898_0420752 3300037466 Bacteria 1273
255 Ga0395898_0612317 3300037466 Bacteria 1032
256 Ga0395898_0620904 3300037466 Bacteria 1023
257 Ga0395898_0835101 3300037466 Bacteria 861
258 Ga0395898_1048789 3300037466 Unclassified 750
259 Ga0395905_0024820 3300037471 Bacteria 5657
260 Ga0395905_0126394 3300037471 Bacteria 2404
261 Ga0395905_0167539 3300037471 Bacteria 2064
262 Ga0395905_0357893 3300037471 Bacteria 1352
263 Ga0395905_0966213 3300037471 Unclassified 755
264 Ga0395905_0973059 3300037471 Unclassified 752
265 Ga0395901_0004360 3300038443 Bacteria 14277
266 Ga0395901_0096822 3300038443 Bacteria 3093
267 Ga0395901_0111383 3300038443 Bacteria 2874
268 Ga0395901_0187619 3300038443 Bacteria 2168
269 Ga0395901_0390153 3300038443 Bacteria 1432
270 Ga0395901_0417370 3300038443 Bacteria 1377
271 Ga0395901_1184751 3300038443 Bacteria 730
272 Ga0436365_0938851 3300039437 Bacteria 776
273 Ga0451855_1051220 3300041511 Unclassified 607
274 Ga0451853_0666306 3300041512 Bacteria 777
275 Ga0439448_0029428 3300042005 Bacteria 1739
276 Ga0466972_0318028 3300044658 Unclassified 727
277 Ga0466963_0072120 3300044694 Bacteria 2326
278 Ga0466963_0083472 3300044694 Bacteria 2167
279 Ga0466963_0443072 3300044694 Bacteria 916
280 Ga0466963_0633907 3300044694 Bacteria 754
281 Ga0466963_0741910 3300044694 Bacteria 693
282 Ga0466963_1329175 3300044694 Bacteria 504
283 Ga0466964_0011938 3300044706 Bacteria 3283
284 Ga0466964_0238152 3300044706 Bacteria 891
285 Ga0466971_0097501 3300044719 Bacteria 1349
286 Ga0466968_0146967 3300044735 Bacteria 1081
287 Ga0466957_0287526 3300044842 Bacteria 1102
288 Ga0466960_0515534 3300044901 Bacteria 702
289 Ga0466960_0671029 3300044901 Bacteria 620
290 Ga0451576_0858500 3300045051 Bacteria 953
291 Ga0451576_1066485 3300045051 Bacteria 846
292 Ga0451576_1757028 3300045051 Bacteria 642
293 Ga0466958_1112564 3300045836 Bacteria 516
294 Ga0466967_0000476 3300045976 Bacteria 19415
295 Ga0466967_0037310 3300045976 Bacteria 4157
296 Ga0466967_0049196 3300045976 Bacteria 3685
297 Ga0466967_0109257 3300045976 Bacteria 2539
298 Ga0466967_0122556 3300045976 Bacteria 2404
299 Ga0466967_0373028 3300045976 Bacteria 1384
300 Ga0466967_0538164 3300045976 Bacteria 1149
301 Ga0466967_0762586 3300045976 Bacteria 960
302 Ga0466967_0840607 3300045976 Bacteria 912
303 Ga0466967_1905589 3300045976 Bacteria 591
304 Ga0466967_2054269 3300045976 Unclassified 568
305 Ga0466967_2434132 3300045976 Unclassified 519
306 Ga0495603_0030727 3300046455 Bacteria 3235
307 Ga0495629_0158412 3300046459 Bacteria 1572
308 Ga0495629_0256681 3300046459 Bacteria 1202
309 Ga0495651_0110915 3300046462 Bacteria 2028
310 Ga0495653_0075173 3300046463 Bacteria 2515
311 Ga0495653_0101722 3300046463 Bacteria 2081
312 Ga0495653_0497787 3300046463 Bacteria 760
313 Ga0495582_0020954 3300046473 Bacteria 3580
314 Ga0495605_0104497 3300046474 Bacteria 1298
315 Ga0495664_0823623 3300046477 Bacteria 545
316 Ga0495594_0034811 3300046499 Bacteria 2741
317 Ga0495596_0166590 3300046500 Bacteria 857
318 Ga0495596_0360729 3300046500 Bacteria 566
319 Ga0495608_0015878 3300046511 Bacteria 5211
320 Ga0495618_0233090 3300046514 Bacteria 1159
321 Ga0495618_0463890 3300046514 Bacteria 767
322 Ga0495630_0108125 3300046517 Bacteria 2107
323 Ga0495630_0114474 3300046517 Bacteria 2044
324 Ga0495644_0098647 3300046523 Bacteria 1105
325 Ga0495663_0018544 3300046525 Bacteria 1982
326 Ga0495642_0189025 3300046528 Unclassified 897
327 Ga0495652_0077028 3300046529 Bacteria 2765
328 Ga0495652_0339487 3300046529 Bacteria 1080
329 Ga0495640_0525073 3300046533 Bacteria 719
330 Ga0495640_0572894 3300046533 Bacteria 683
331 Ga0495586_0281400 3300046535 Bacteria 952
332 Ga0495609_0122954 3300046538 Bacteria 1115
333 Ga0495609_0339132 3300046538 Bacteria 608
334 Ga0495667_0992388 3300046559 Bacteria 512
335 Ga0495656_0191615 3300046615 Bacteria 1010
336 Ga0495656_0350939 3300046615 Unclassified 764
337 Ga0495668_0497698 3300046616 Bacteria 672
338 Ga0495634_0354995 3300046642 Bacteria 877
339 Ga0495635_0053419 3300046663 Bacteria 2784
340 Ga0495635_0285870 3300046663 Bacteria 1107
341 Ga0495661_0285192 3300046665 Bacteria 831
342 Ga0495661_0541265 3300046665 Bacteria 552
343 Ga0495588_0042945 3300046674 Bacteria 2312
344 Ga0495588_0752346 3300046674 Unclassified 509
345 Ga0495657_0161404 3300046675 Bacteria 1387
346 Ga0495657_0392182 3300046675 Bacteria 818
347 Ga0495599_0253834 3300046678 Bacteria 1070
348 Ga0495646_0483805 3300046680 Unclassified 637
349 Ga0495647_0253065 3300046681 Bacteria 784
350 Ga0495647_0354117 3300046681 Bacteria 668
351 Ga0495658_0090399 3300046683 Bacteria 1812
352 Ga0495658_0359236 3300046683 Bacteria 926
353 Ga0495669_0166015 3300046684 Bacteria 1049
354 Ga0495613_0646487 3300046689 Bacteria 700
355 Ga0495624_0118488 3300046690 Bacteria 1626
356 Ga0495670_0456283 3300046691 Bacteria 693
357 Ga0495671_0444250 3300046692 Unclassified 620
358 Ga0495589_0263074 3300046794 Bacteria 804
359 Ga0495600_0364031 3300046809 Bacteria 904
360 Ga0495581_0005525 3300047315 Bacteria 7321
361 Ga0495581_0013097 3300047315 Bacteria 4808
362 Ga0495581_0475385 3300047315 Unclassified 727
363 Ga0495604_0662719 3300047317 Bacteria 665
364 Ga0495636_0445822 3300047318 Bacteria 621
365 Ga0495674_0599582 3300047319 Bacteria 873
366 Ga0495674_0639959 3300047319 Bacteria 839
367 Ga0495676_0062132 3300047321 Bacteria 2918
368 Ga0495680_0009403 3300047322 Bacteria 8791
369 Ga0495683_0299128 3300047323 Bacteria 692
370 Ga0495675_0784837 3300047444 Unclassified 528
371 Ga0495677_0129880 3300047445 Bacteria 964
372 Ga0495684_0099023 3300047471 Bacteria 2204
373 Ga0495684_0154839 3300047471 Bacteria 1712
374 Ga0495602_0683753 3300048088 Unclassified 698
375 Ga0495614_0244719 3300048089 Bacteria 819
376 Ga0496100_0758003 3300048903 Bacteria 759
377 Ga0496101_0224123 3300048904 Bacteria 1460
378 Ga0496101_1119856 3300048904 Bacteria 618
379 Ga0496101_1401060 3300048904 Bacteria 545
380 Ga0496102_0563106 3300048905 Bacteria 1062
381 Ga0496102_0601061 3300048905 Bacteria 1023
382 Ga0496102_1429353 3300048905 Bacteria 611
383 Ga0496102_1911913 3300048905 Unclassified 510
384 Ga0496103_0355784 3300048906 Bacteria 941
385 Ga0496103_0359881 3300048906 Bacteria 935
386 Ga0496104_0798649 3300048907 Bacteria 850
387 Ga0496105_0813090 3300048908 Bacteria 710
388 Ga0496106_0003054 3300048909 Bacteria 12476
389 Ga0496107_0004985 3300048910 Bacteria 9037
390 Ga0496107_0952997 3300048910 Bacteria 624
391 Ga0496108_0116413 3300048911 Bacteria 2289
392 Ga0496108_0647141 3300048911 Bacteria 919
393 Ga0496109_1160110 3300048912 Bacteria 709
394 Ga0496110_0832150 3300048913 Bacteria 828
395 Ga0496111_1100423 3300048914 Bacteria 566
396 Ga0496112_0004702 3300048915 Bacteria 11627
397 Ga0496112_0004906 3300048915 Bacteria 11445
398 Ga0496112_0469883 3300048915 Bacteria 1195
399 Ga0496112_0976453 3300048915 Unclassified 767
400 Ga0496112_1927827 3300048915 Unclassified 502
401 Ga0496113_0582073 3300048916 Bacteria 897
402 Ga0496113_0594921 3300048916 Bacteria 886
403 Ga0496114_0538128 3300048917 Bacteria 1033
404 Ga0496115_0096008 3300048918 Bacteria 2427
405 Ga0501067_0077884 3300049583 Unclassified 1837
406 Ga0501067_0211791 3300049583 Bacteria 1079
407 Ga0501069_0063234 3300049585 Bacteria 2067
408 Ga0501069_0080543 3300049585 Bacteria 1834
409 nmdc:mga05p37_1928698_c1 3300050507 Bacteria 563
410 nmdc:mga0n895_307090_c1 3300050512 Bacteria 1608
411 nmdc:mga0rr50_627944_c1 3300050513 Bacteria 916
412 nmdc:mga08x19_463044_c1 3300050514 Bacteria 893
413 nmdc:mga08x19_942252_c1 3300050514 Bacteria 613
414 nmdc:mga0a205_586924_c1 3300050515 Bacteria 968
415 Ga0495655_0351231 3300053083 Bacteria 516
416 Ga0495595_0050896 3300053084 Bacteria 1919
417 Ga0495595_0615278 3300053084 Bacteria 556
418 Ga0495619_0086294 3300053085 Bacteria 2121
419 Ga0495619_0242197 3300053085 Bacteria 1250
420 Ga0495619_0434753 3300053085 Bacteria 905
421 Ga0495619_0740939 3300053085 Bacteria 667
422 Ga0466962_0321669 3300061719 Unclassified 767
423 Ga0530510_0340254 3300061734 Bacteria 1126
424 Ga0070683_100062549
425 Ga0070658_10018785
426 Ga0070658_10043711
427 Ga0070658_10189980
428 Ga0070658_10405955
429 Ga0070658_11044637
430 Ga0070683_101362802
431 Ga0070680_100025693
432 Ga0070680_100202363
433 Ga0070680_100240542
434 Ga0070682_100084371
435 Ga0070682_100179984
436 Ga0070682_100969261
437 Ga0070660_100002970
438 Ga0070660_100026497
439 Ga0070660_100049188
440 Ga0070660_100798805
441 Ga0070660_101498388
442 Ga0070661_100111189
443 Ga0070661_100152079
444 Ga0070661_100965771
445 Ga0070659_100826402
446 Ga0070659_101636590
447 Ga0070709_10164819
448 Ga0070709_10729899
449 Ga0070709_10967780
450 Ga0070714_100018200
451 Ga0070714_100063589
452 Ga0070714_100091138
453 Ga0070714_100121260
454 Ga0070714_101806732
455 Ga0070714_102405051
456 Ga0070713_100088924
457 Ga0070713_101227350
458 Ga0070713_102194977
459 Ga0070711_101669052
460 Ga0070694_100397183
461 Ga0070708_100249305
462 Ga0070708_100339476
463 Ga0070681_10049180
464 Ga0070681_10136638
465 Ga0070681_10270662
466 Ga0070681_10290324
467 Ga0070681_10298221
468 Ga0070681_11040683
469 Ga0070707_100223499
470 Ga0070707_100513020
471 Ga0070698_100048670
472 Ga0070698_100722501
473 Ga0070699_100079857
474 Ga0070699_100422149
475 Ga0070679_100085797
476 Ga0070679_100170711
477 Ga0070679_100463961
478 Ga0070679_100632564
479 Ga0070684_100035656
480 Ga0070684_100063523
481 Ga0070684_101470935
482 Ga0070697_100202876
483 Ga0068853_100858344
484 Ga0068853_100960682
485 Ga0070695_100246276
486 Ga0070696_100552392
487 Ga0070696_100795489
488 Ga0070693_100891087
489 Ga0070704_101029994
490 Ga0068855_100037023
491 Ga0068855_102312058
492 Ga0070664_101218977
493 Ga0068854_100256677
494 Ga0068856_100492285
495 Ga0070702_101066325
496 Ga0068852_100297929
497 Ga0068852_100618593
498 Ga0068852_101664638
499 Ga0070717_10074096
500 Ga0070717_11614446
501 Ga0070715_10737434
502 Ga0070712_100406957
503 Ga0070712_101050323
504 Ga0070712_101854672
505 Ga0075433_10639732
506 Ga0075434_101285348
507 Ga0075436_100252943
508 Ga0075436_101489209
509 Ga0105240_10026332
510 Ga0105240_10222520
511 Ga0105240_10410642
512 Ga0105240_12412867
513 Ga0105245_12641036
514 Ga0114129_10398914
515 Ga0105241_11511379
516 Ga0105242_10449753
517 Ga0105238_11153821
518 Ga0105238_12594019
519 Ga0105239_12470207
520 Ga0157373_10160193
521 Ga0157373_10317774
522 Ga0157373_10660921
523 Ga0157371_10881054
524 Ga0157370_10045095
525 Ga0157370_10175342
526 Ga0157369_10036038
527 Ga0157369_10202132
528 Ga0157369_11032506
529 Ga0157369_11238203
530 Ga0157372_10346660
531 Ga0157372_10866692
532 Ga0157372_10920320
533 Ga0157372_11962554
534 Ga0157375_11378007
535 Ga0182008_10006559
536 Ga0182008_10098057
537 Ga0182008_10425938
538 Ga0182006_1157678
539 Ga0182007_10004120
540 Ga0197907_10314734
541 Ga0206356_11178554
542 Ga0206356_11340232
543 Ga0206356_11704696
544 Ga0206354_10331733
545 Ga0206354_11293241
546 Ga0206354_11597317
547 Ga0206353_10082997
548 Ga0206353_10792442
549 Ga0206353_11844130
550 Ga0206353_11919948
551 Ga0207685_10334619
552 Ga0207699_10265645
553 Ga0207699_10313803
554 Ga0207699_11214292
555 Ga0207705_10067379
556 Ga0207705_10299831
557 Ga0207684_10451316
558 Ga0207707_10094757
559 Ga0207707_10153119
560 Ga0207707_10354740
561 Ga0207707_10374684
562 Ga0207707_10733849
563 Ga0207695_10027775
564 Ga0207693_10249089
565 Ga0207693_10819775
566 Ga0207693_11115881
567 Ga0207693_11322694
568 Ga0207663_10347459
569 Ga0207660_10049435
570 Ga0207660_10067458
571 Ga0207660_10382637
572 Ga0207660_10645051
573 Ga0207660_10714191
574 Ga0207657_10007679
575 Ga0207657_10011480
576 Ga0207657_10087118
577 Ga0207657_10551634
578 Ga0207657_10576150
579 Ga0207657_11047093
580 Ga0207649_10421512
581 Ga0207649_10992276
582 Ga0207652_10008146
583 Ga0207652_10256891
584 Ga0207652_10412975
585 Ga0207652_10448274
586 Ga0207652_10468700
587 Ga0207646_10354441
588 Ga0207646_10858933
589 Ga0207700_10057152
590 Ga0207700_10576982
591 Ga0207700_11436601
592 Ga0207664_10043861
593 Ga0207664_10071700
594 Ga0207664_10103770
595 Ga0207664_10611650
596 Ga0207664_11072361
597 Ga0207664_11185436
598 Ga0207664_11275378
599 Ga0207664_11767738
600 Ga0207690_10366222
601 Ga0207690_10692370
602 Ga0207690_11760009
603 Ga0207661_10277264
604 Ga0207661_12110214
605 Ga0207667_10170277
606 Ga0207667_10352157
607 Ga0207640_10091194
608 Ga0207639_10395605
609 Ga0207678_11625278
610 Ga0207702_11924476
611 Ga0207698_10309576
612 Ga0207698_11277669
613 Ga0265337_1109565
614 Ga0265326_10062825
615 Ga0265319_1000592
616 Ga0265319_1003854
617 Ga0265334_10065932
618 Ga0265334_10092540
619 Ga0265334_10242970
620 Ga0265318_10000219
621 Ga0265318_10009436
622 Ga0265323_10038956
623 Ga0265322_10022724
624 Ga0265336_10043865
625 Ga0265336_10176938
626 Ga0265338_10017781
627 Ga0265338_10070945
628 Ga0265330_10056692
629 Ga0265330_10350856
630 Ga0265332_10019305
631 Ga0265328_10005682
632 Ga0265320_10029161
633 Ga0265320_10040273
634 Ga0265325_10000443
635 Ga0265325_10297039
636 Ga0265329_10021343
637 Ga0265329_10121934
638 Ga0265340_10001255
639 Ga0265340_10126452
640 Ga0265339_10034855
641 Ga0265331_10052901
642 Ga0265327_10009396
643 Ga0265327_10017856
644 Ga0265327_10031105
645 Ga0265327_10397079
646 Ga0265316_10004108
647 Ga0265316_10024864
648 Ga0265313_10423976
649 Ga0265314_10028527
650 Ga0265314_10323876
651 Ga0265342_10272181
652 Ga0373932_0262434
653 Ga0373953_0033929
654 Ga0373924_0144617
655 Ga0373933_0033168
656 Ga0373947_0020292
657 Ga0373937_0211832
658 Ga0373937_0342704
659 Ga0373937_1288947
660 Ga0373925_0095528
661 Ga0395899_0016395
662 Ga0395899_0041450
663 Ga0395899_0106852
664 Ga0395899_0145006
665 Ga0395899_0411798
666 Ga0395900_0029652
667 Ga0395900_0032358
668 Ga0395900_0050558
669 Ga0395900_0261913
670 Ga0395900_0463899
671 Ga0395900_1609317
672 Ga0395900_1697013
673 Ga0395898_0009901
674 Ga0395898_0086021
675 Ga0395898_0088036
676 Ga0395898_0252552
677 Ga0395898_0420752
678 Ga0395898_0612317
679 Ga0395898_0620904
680 Ga0395898_0835101
681 Ga0395898_1048789
682 Ga0395905_0024820
683 Ga0395905_0126394
684 Ga0395905_0167539
685 Ga0395905_0357893
686 Ga0395905_0966213
687 Ga0395905_0973059
688 Ga0395901_0004360
689 Ga0395901_0096822
690 Ga0395901_0111383
691 Ga0395901_0187619
692 Ga0395901_0390153
693 Ga0395901_0417370
694 Ga0395901_1184751
695 Ga0436365_0938851
696 Ga0451855_1051220
697 Ga0451853_0666306
698 Ga0439448_0029428
699 Ga0466972_0318028
700 Ga0466963_0072120
701 Ga0466963_0083472
702 Ga0466963_0443072
703 Ga0466963_0633907
704 Ga0466963_0741910
705 Ga0466963_1329175
706 Ga0466964_0011938
707 Ga0466964_0238152
708 Ga0466971_0097501
709 Ga0466968_0146967
710 Ga0466957_0287526
711 Ga0466960_0515534
712 Ga0466960_0671029
713 Ga0451576_0858500
714 Ga0451576_1066485
715 Ga0451576_1757028
716 Ga0466958_1112564
717 Ga0466967_0000476
718 Ga0466967_0037310
719 Ga0466967_0049196
720 Ga0466967_0109257
721 Ga0466967_0122556
722 Ga0466967_0373028
723 Ga0466967_0538164
724 Ga0466967_0762586
725 Ga0466967_0840607
726 Ga0466967_1905589
727 Ga0466967_2054269
728 Ga0466967_2434132
729 Ga0495603_0030727
730 Ga0495629_0158412
731 Ga0495629_0256681
732 Ga0495651_0110915
733 Ga0495653_0075173
734 Ga0495653_0101722
735 Ga0495653_0497787
736 Ga0495582_0020954
737 Ga0495605_0104497
738 Ga0495664_0823623
739 Ga0495594_0034811
740 Ga0495596_0166590
741 Ga0495596_0360729
742 Ga0495608_0015878
743 Ga0495618_0233090
744 Ga0495618_0463890
745 Ga0495630_0108125
746 Ga0495630_0114474
747 Ga0495644_0098647
748 Ga0495663_0018544
749 Ga0495642_0189025
750 Ga0495652_0077028
751 Ga0495652_0339487
752 Ga0495640_0525073
753 Ga0495640_0572894
754 Ga0495586_0281400
755 Ga0495609_0122954
756 Ga0495609_0339132
757 Ga0495667_0992388
758 Ga0495656_0191615
759 Ga0495656_0350939
760 Ga0495668_0497698
761 Ga0495634_0354995
762 Ga0495635_0053419
763 Ga0495635_0285870
764 Ga0495661_0285192
765 Ga0495661_0541265
766 Ga0495588_0042945
767 Ga0495588_0752346
768 Ga0495657_0161404
769 Ga0495657_0392182
770 Ga0495599_0253834
771 Ga0495646_0483805
772 Ga0495647_0253065
773 Ga0495647_0354117
774 Ga0495658_0090399
775 Ga0495658_0359236
776 Ga0495669_0166015
777 Ga0495613_0646487
778 Ga0495624_0118488
779 Ga0495670_0456283
780 Ga0495671_0444250
781 Ga0495589_0263074
782 Ga0495600_0364031
783 Ga0495581_0005525
784 Ga0495581_0013097
785 Ga0495581_0475385
786 Ga0495604_0662719
787 Ga0495636_0445822
788 Ga0495674_0599582
789 Ga0495674_0639959
790 Ga0495676_0062132
791 Ga0495680_0009403
792 Ga0495683_0299128
793 Ga0495675_0784837
794 Ga0495677_0129880
795 Ga0495684_0099023
796 Ga0495684_0154839
797 Ga0495602_0683753
798 Ga0495614_0244719
799 Ga0496100_0758003
800 Ga0496101_0224123
801 Ga0496101_1119856
802 Ga0496101_1401060
803 Ga0496102_0563106
804 Ga0496102_0601061
805 Ga0496102_1429353
806 Ga0496102_1911913
807 Ga0496103_0355784
808 Ga0496103_0359881
809 Ga0496104_0798649
810 Ga0496105_0813090
811 Ga0496106_0003054
812 Ga0496107_0004985
813 Ga0496107_0952997
814 Ga0496108_0116413
815 Ga0496108_0647141
816 Ga0496109_1160110
817 Ga0496110_0832150
818 Ga0496111_1100423
819 Ga0496112_0004702
820 Ga0496112_0004906
821 Ga0496112_0469883
822 Ga0496112_0976453
823 Ga0496112_1927827
824 Ga0496113_0582073
825 Ga0496113_0594921
826 Ga0496114_0538128
827 Ga0496115_0096008
828 Ga0501067_0077884
829 Ga0501067_0211791
830 Ga0501069_0063234
831 Ga0501069_0080543
832 nmdc:mga05p37_1928698_c1
833 nmdc:mga0n895_307090_c1
834 nmdc:mga0rr50_627944_c1
835 nmdc:mga08x19_463044_c1
836 nmdc:mga08x19_942252_c1
837 nmdc:mga0a205_586924_c1
838 Ga0495655_0351231
839 Ga0495595_0050896
840 Ga0495595_0615278
841 Ga0495619_0086294
842 Ga0495619_0242197
843 Ga0495619_0434753
844 Ga0495619_0740939
845 Ga0466962_0321669
846 Ga0530510_0340254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map