F440345

General Info

Members Datasets Scaffolds Average Seq Length
422 271 844 311

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0060484|Ga0466963_0060484_869_1858
Length 329
Sequence MHDRRELATVRAYGASMGDMQYRRLGDSGLVVSVVGLGCNNFGRRIDVDATRKVVDAALDAGVTFFDTADVYGESETFLGEVLAGRRDEVVLATKFGNPLRGALGEDHGARGSRWYVRRAVERSLRRLRTDHIDLYQLHRPDPLTPIEETLAALTELVREGKVRYIGNSNFAGWQVADADWISRTRGYERFISAQNEYNLIDTGVESELVPALQHFRLGLLPFFPLANGLLTGKYRRDAPRPEGTRLQSSNYADYATPERFDRMEALQRYADERGLSLLQVAIGGLAARPAVASVIAGATRPEQVTANAEAGSWTPTSEDLAALDQVLA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
117 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
118 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
269 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
270 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
271 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0.47
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.32
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0060484 3300044694 Bacteria 2530
2 JGI24740J21852_10046904 3300001979 Bacteria 1265
3 JGI24737J22298_10021671 3300001990 Bacteria 2046
4 JGI24735J21928_10012154 3300002067 Bacteria 2723
5 Ga0070658_10026530 3300005327 Bacteria 4648
6 Ga0070658_10038509 3300005327 Bacteria 3855
7 Ga0070683_100004507 3300005329 Bacteria 11494
8 Ga0070683_100012226 3300005329 Bacteria 7454
9 Ga0070683_100016483 3300005329 Bacteria 6518
10 Ga0070683_100195209 3300005329 Bacteria 1922
11 Ga0070683_100201445 3300005329 Bacteria 1890
12 Ga0070683_100463052 3300005329 Bacteria 1210
13 Ga0070690_100018408 3300005330 Bacteria 4219
14 Ga0070666_10013377 3300005335 Bacteria 5204
15 Ga0070666_10032846 3300005335 Unclassified 3430
16 Ga0070682_100070812 3300005337 Bacteria 2230
17 Ga0070682_100204371 3300005337 Bacteria 1395
18 Ga0070660_100029030 3300005339 Bacteria 4142
19 Ga0070660_100084421 3300005339 Bacteria 2496
20 Ga0070691_10047445 3300005341 Bacteria 2042
21 Ga0070687_100031664 3300005343 Bacteria 2596
22 Ga0070687_100054192 3300005343 Bacteria 2088
23 Ga0070692_10002794 3300005345 Bacteria 6885
24 Ga0070667_100019869 3300005367 Bacteria 5574
25 Ga0070714_100000428 3300005435 Bacteria 30485
26 Ga0070714_100016445 3300005435 Bacteria 5974
27 Ga0070713_100118537 3300005436 Bacteria 2318
28 Ga0070710_10026024 3300005437 Bacteria 3104
29 Ga0070701_10045917 3300005438 Bacteria 2243
30 Ga0070705_100035715 3300005440 Bacteria 2788
31 Ga0070694_100115614 3300005444 Bacteria 1917
32 Ga0070708_100158886 3300005445 Bacteria 2105
33 Ga0070663_100130381 3300005455 Bacteria 1908
34 Ga0070678_100091278 3300005456 Bacteria 2337
35 Ga0070681_10140464 3300005458 Bacteria 2345
36 Ga0068867_100405599 3300005459 Bacteria 1151
37 Ga0070706_100006255 3300005467 Bacteria 11261
38 Ga0070707_100195387 3300005468 Bacteria 1973
39 Ga0070679_100006703 3300005530 Bacteria 10740
40 Ga0070679_100129532 3300005530 Bacteria 2505
41 Ga0070684_100001453 3300005535 Bacteria 17087
42 Ga0070684_100017597 3300005535 Bacteria 5872
43 Ga0070684_100073996 3300005535 Bacteria 3003
44 Ga0068853_100061128 3300005539 Bacteria 3258
45 Ga0070665_100001537 3300005548 Bacteria 26667
46 Ga0070665_100075621 3300005548 Unclassified 3375
47 Ga0070665_100361869 3300005548 Bacteria 1457
48 Ga0068855_100016243 3300005563 Bacteria 8951
49 Ga0068857_100010452 3300005577 Bacteria 8067
50 Ga0068857_100127166 3300005577 Bacteria 2297
51 Ga0068857_100255420 3300005577 Bacteria 1607
52 Ga0068856_100082494 3300005614 Bacteria 3191
53 Ga0070702_100044393 3300005615 Bacteria 2509
54 Ga0068864_100053879 3300005618 Bacteria 3471
55 Ga0068864_100297746 3300005618 Bacteria 1509
56 Ga0068870_10004326 3300005840 Bacteria 6110
57 Ga0068863_100058966 3300005841 Bacteria 3632
58 Ga0068858_100245032 3300005842 Bacteria 1701
59 Ga0081455_10200065 3300005937 Bacteria 1496
60 Ga0081540_1000584 3300005983 Bacteria 35133
61 Ga0070717_10001222 3300006028 Bacteria 17450
62 Ga0070717_10171424 3300006028 Bacteria 1888
63 Ga0070715_10019276 3300006163 Bacteria 2613
64 Ga0070716_100046607 3300006173 Bacteria 2440
65 Ga0070712_100006545 3300006175 Bacteria 7231
66 Ga0097621_100087099 3300006237 Bacteria 2607
67 Ga0075428_100289982 3300006844 Bacteria 1760
68 Ga0075430_100071521 3300006846 Bacteria 2910
69 Ga0075431_100255961 3300006847 Bacteria 1778
70 Ga0075429_100030900 3300006880 Bacteria 4655
71 Ga0105240_10006856 3300009093 Bacteria 16651
72 Ga0111539_10179659 3300009094 Bacteria 2472
73 Ga0105245_10004344 3300009098 Bacteria 12545
74 Ga0105245_10816530 3300009098 Bacteria 971
75 Ga0114129_10182562 3300009147 Bacteria 2854
76 Ga0105243_10031066 3300009148 Bacteria 4117
77 Ga0105242_10118755 3300009176 Bacteria 2266
78 Ga0105248_10078631 3300009177 Plasmid 3708
79 Ga0105249_10403543 3300009553 Bacteria 1397
80 Ga0105239_10002517 3300010375 Bacteria 23310
81 Ga0105246_10036359 3300011119 Bacteria 3298
82 Ga0157342_1002221 3300012507 Bacteria 1551
83 Ga0157373_10169691 3300013100 Bacteria 1535
84 Ga0157370_10481858 3300013104 Bacteria 1140
85 Ga0157369_10053756 3300013105 Bacteria 4350
86 Ga0157378_10240869 3300013297 Bacteria 1728
87 Ga0163162_10032278 3300013306 Bacteria 5200
88 Ga0163162_10298246 3300013306 Bacteria 1743
89 Ga0157372_10008749 3300013307 Bacteria 10748
90 Ga0157375_10164425 3300013308 Bacteria 2363
91 Ga0163163_10118008 3300014325 Bacteria 2686
92 Ga0157376_10114616 3300014969 Bacteria 2378
93 Ga0163161_10025566 3300017792 Bacteria 4180
94 Ga0206353_10357630 3300020082 Bacteria 2121
95 Ga0206353_10360944 3300020082 Bacteria 1960
96 Ga0213876_10108453 3300021384 Bacteria 1473
97 Ga0213875_10000180 3300021388 Bacteria 64310
98 Ga0213875_10000532 3300021388 Bacteria 31389
99 Ga0224572_1003500 3300024225 Bacteria 2653
100 Ga0209026_1005073 3300025250 Bacteria 3657
101 Ga0207653_10076500 3300025885 Bacteria 1152
102 Ga0207692_10045807 3300025898 Bacteria 2190
103 Ga0207692_10236078 3300025898 Bacteria 1090
104 Ga0207688_10011231 3300025901 Bacteria 4873
105 Ga0207680_10001517 3300025903 Bacteria 10931
106 Ga0207647_10003755 3300025904 Bacteria 11351
107 Ga0207647_10062685 3300025904 Bacteria 2264
108 Ga0207699_10030272 3300025906 Bacteria 3027
109 Ga0207699_10077009 3300025906 Bacteria 2056
110 Ga0207645_10064109 3300025907 Bacteria 2348
111 Ga0207705_10008522 3300025909 Bacteria 7477
112 Ga0207705_10317375 3300025909 Bacteria 1197
113 Ga0207684_10000446 3300025910 Bacteria 54436
114 Ga0207654_10089973 3300025911 Bacteria 1869
115 Ga0207707_10183959 3300025912 Bacteria 1824
116 Ga0207707_10296812 3300025912 Bacteria 1398
117 Ga0207671_10064433 3300025914 Bacteria 2725
118 Ga0207693_10002968 3300025915 Bacteria 14690
119 Ga0207657_10023218 3300025919 Bacteria 5781
120 Ga0207657_10083060 3300025919 Bacteria 2687
121 Ga0207657_10392639 3300025919 Bacteria 1092
122 Ga0207652_10056645 3300025921 Bacteria 3375
123 Ga0207652_10160807 3300025921 Bacteria 2013
124 Ga0207652_10384271 3300025921 Bacteria 1267
125 Ga0207659_10091509 3300025926 Bacteria 2272
126 Ga0207659_10297715 3300025926 Bacteria 1324
127 Ga0207687_10191627 3300025927 Bacteria 1592
128 Ga0207700_10095234 3300025928 Bacteria 2361
129 Ga0207700_10127405 3300025928 Bacteria 2073
130 Ga0207664_10016339 3300025929 Bacteria 5413
131 Ga0207664_10140375 3300025929 Bacteria 2043
132 Ga0207706_10236930 3300025933 Bacteria 1595
133 Ga0207670_10186204 3300025936 Bacteria 1567
134 Ga0207665_10039875 3300025939 Bacteria 3132
135 Ga0207665_10109261 3300025939 Bacteria 1941
136 Ga0207665_10262042 3300025939 Bacteria 1281
137 Ga0207711_10046821 3300025941 Plasmid 3696
138 Ga0207689_10026416 3300025942 Bacteria 4861
139 Ga0207661_10006344 3300025944 Bacteria 8365
140 Ga0207661_10052766 3300025944 Bacteria 3250
141 Ga0207667_10025415 3300025949 Bacteria 6481
142 Ga0207640_10343666 3300025981 Bacteria 1196
143 Ga0207658_10132901 3300025986 Unclassified 2002
144 Ga0207677_10240894 3300026023 Bacteria 1463
145 Ga0207639_10306576 3300026041 Bacteria 1405
146 Ga0207678_10012797 3300026067 Bacteria 7367
147 Ga0207702_10041134 3300026078 Bacteria 3875
148 Ga0207702_10413946 3300026078 Bacteria 1302
149 Ga0207676_10039402 3300026095 Bacteria 3614
150 Ga0207674_10005161 3300026116 Bacteria 15569
151 Ga0207674_10008851 3300026116 Bacteria 11580
152 Ga0207675_100093186 3300026118 Bacteria 2833
153 Ga0207683_10002452 3300026121 Bacteria 16173
154 Ga0207683_10113878 3300026121 Bacteria 2423
155 Ga0207698_10171386 3300026142 Bacteria 1911
156 Ga0268266_10003180 3300028379 Bacteria 16659
157 Ga0268266_10075646 3300028379 Plasmid 2925
158 Ga0268266_10236447 3300028379 Bacteria 1684
159 Ga0268264_10379997 3300028381 Bacteria 1352
160 Ga0265337_1002809 3300028556 Bacteria 7786
161 Ga0265326_10003567 3300028558 Bacteria 5088
162 Ga0265319_1008329 3300028563 Bacteria 4559
163 Ga0265334_10004231 3300028573 Bacteria 6401
164 Ga0265318_10008931 3300028577 Bacteria 4438
165 Ga0265323_10006489 3300028653 Bacteria 4921
166 Ga0265336_10008230 3300028666 Bacteria 3668
167 Ga0265338_10000375 3300028800 Bacteria 79976
168 Ga0265338_10027341 3300028800 Bacteria 5725
169 Ga0265324_10000935 3300029957 Bacteria 18303
170 Ga0265332_10002617 3300031238 Bacteria 9080
171 Ga0265320_10002761 3300031240 Bacteria 12121
172 Ga0265325_10006373 3300031241 Bacteria 7165
173 Ga0265340_10003258 3300031247 Bacteria 9203
174 Ga0265339_10047712 3300031249 Bacteria 2351
175 Ga0265327_10000076 3300031251 Bacteria 212272
176 Ga0265327_10003969 3300031251 Bacteria 13508
177 Ga0265316_10023462 3300031344 Bacteria 5182
178 Ga0265313_10018826 3300031595 Bacteria 3865
179 Ga0307508_10180266 3300031616 Bacteria 1715
180 Ga0265314_10004383 3300031711 Bacteria 13131
181 Ga0265342_10002423 3300031712 Bacteria 16132
182 Ga0373930_0017547 3300034816 Bacteria 1366
183 Ga0373938_0026850 3300034957 Bacteria 1208
184 Ga0373926_0007384 3300035083 Bacteria 3662
185 Ga0373934_0051535 3300035086 Bacteria 1631
186 Ga0373934_0072233 3300035086 Bacteria 1381
187 Ga0373949_0036293 3300035090 Bacteria 1195
188 Ga0373923_0020286 3300035111 Bacteria 2580
189 Ga0373923_0027389 3300035111 Bacteria 2274
190 Ga0373923_0033481 3300035111 Bacteria 2081
191 Ga0373936_0006347 3300035113 Bacteria 4454
192 Ga0373936_0052033 3300035113 Bacteria 1658
193 Ga0373945_0002447 3300035116 Bacteria 5827
194 Ga0373945_0046801 3300035116 Bacteria 1579
195 Ga0373953_0008545 3300035117 Bacteria 3482
196 Ga0373954_0120079 3300035118 Bacteria 1275
197 Ga0373954_0126307 3300035118 Bacteria 1243
198 Ga0373957_0075107 3300035120 Bacteria 1327
199 Ga0373960_0009655 3300035121 Bacteria 2343
200 Ga0373943_0000621 3300035170 Bacteria 15399
201 Ga0373943_0001024 3300035170 Bacteria 12397
202 Ga0373946_0002255 3300035171 Bacteria 6808
203 Ga0373946_0006728 3300035171 Bacteria 4177
204 Ga0373955_0039305 3300035172 Bacteria 2525
205 Ga0373955_0121110 3300035172 Bacteria 1521
206 Ga0373924_0007743 3300035410 Bacteria 3882
207 Ga0373924_0028742 3300035410 Bacteria 2217
208 Ga0373931_0008422 3300035691 Bacteria 4892
209 Ga0373935_0002638 3300035692 Bacteria 10302
210 Ga0373935_0062703 3300035692 Bacteria 2381
211 Ga0373935_0070438 3300035692 Bacteria 2254
212 Ga0373935_0124389 3300035692 Bacteria 1726
213 Ga0373927_0000878 3300035695 Bacteria 22907
214 Ga0373927_0033576 3300035695 Bacteria 3340
215 Ga0373933_0029400 3300035724 Bacteria 3177
216 Ga0373933_0157146 3300035724 Bacteria 1442
217 Ga0373947_0002380 3300035725 Bacteria 11355
218 Ga0373937_0042753 3300036401 Bacteria 4134
219 Ga0373937_0256669 3300036401 Bacteria 1648
220 Ga0373937_0297739 3300036401 Bacteria 1524
221 Ga0373937_0310499 3300036401 Bacteria 1491
222 Ga0373925_0002161 3300037068 Bacteria 16057
223 Ga0373925_0009789 3300037068 Bacteria 6960
224 Ga0373925_0018216 3300037068 Bacteria 5101
225 Ga0395899_0034004 3300037312 Bacteria 3827
226 Ga0395899_0098367 3300037312 Bacteria 2114
227 Ga0395898_0008069 3300037466 Bacteria 11156
228 Ga0395898_0683054 3300037466 Bacteria 969
229 Ga0436364_0235491 3300037853 Bacteria 1719
230 Ga0436364_0267648 3300037853 Bacteria 2713
231 Ga0436364_0479292 3300037853 Bacteria 35381
232 Ga0436364_0999853 3300037853 Bacteria 64321
233 Ga0395901_0016639 3300038443 Bacteria 7492
234 Ga0395901_0178187 3300038443 Bacteria 2229
235 Ga0466966_0090537 3300044684 Bacteria 1900
236 Ga0466963_0065332 3300044694 Bacteria 2439
237 Ga0466964_0017278 3300044706 Bacteria 2760
238 Ga0466971_0037791 3300044719 Bacteria 2165
239 Ga0466957_0012422 3300044842 Bacteria 4929
240 Ga0466959_0067987 3300045049 Bacteria 2582
241 Ga0466959_0343086 3300045049 Bacteria 1019
242 Ga0466958_0292823 3300045836 Bacteria 1044
243 Ga0466967_0010440 3300045976 Bacteria 6968
244 Ga0466967_0016711 3300045976 Bacteria 5797
245 Ga0466967_0253282 3300045976 Bacteria 1682
246 Ga0466967_0613538 3300045976 Bacteria 1074
247 Ga0495592_0040856 3300046454 Bacteria 3479
248 Ga0495592_0061043 3300046454 Bacteria 2771
249 Ga0495592_0074950 3300046454 Bacteria 2457
250 Ga0495592_0187870 3300046454 Bacteria 1402
251 Ga0495603_0017364 3300046455 Bacteria 4354
252 Ga0495629_0030167 3300046459 Bacteria 3845
253 Ga0495641_0004081 3300046461 Bacteria 10549
254 Ga0495641_0010389 3300046461 Bacteria 5402
255 Ga0495651_0010899 3300046462 Bacteria 6992
256 Ga0495651_0027970 3300046462 Bacteria 4395
257 Ga0495651_0048342 3300046462 Bacteria 3285
258 Ga0495651_0103134 3300046462 Bacteria 2120
259 Ga0495653_0002295 3300046463 Bacteria 15160
260 Ga0495653_0012180 3300046463 Bacteria 7016
261 Ga0495580_0008879 3300046472 Bacteria 7952
262 Ga0495582_0017885 3300046473 Bacteria 3874
263 Ga0495639_0012120 3300046475 Bacteria 3716
264 Ga0495639_0013959 3300046475 Bacteria 3475
265 Ga0495662_0004023 3300046476 Bacteria 7405
266 Ga0495662_0145158 3300046476 Bacteria 1168
267 Ga0495664_0000893 3300046477 Bacteria 15330
268 Ga0495664_0040814 3300046477 Bacteria 2745
269 Ga0495664_0186114 3300046477 Bacteria 1259
270 Ga0495608_0001725 3300046511 Bacteria 15659
271 Ga0495608_0059735 3300046511 Bacteria 2511
272 Ga0495618_0009326 3300046514 Bacteria 5924
273 Ga0495618_0048700 3300046514 Bacteria 2675
274 Ga0495618_0196000 3300046514 Bacteria 1279
275 Ga0495628_0096461 3300046516 Bacteria 2284
276 Ga0495628_0203740 3300046516 Bacteria 1490
277 Ga0495630_0004867 3300046517 Bacteria 9429
278 Ga0495630_0133602 3300046517 Bacteria 1885
279 Ga0495666_0012726 3300046526 Bacteria 4193
280 Ga0495652_0002944 3300046529 Bacteria 17137
281 Ga0495652_0030644 3300046529 Bacteria 4715
282 Ga0495652_0128673 3300046529 Bacteria 2008
283 Ga0495652_0183535 3300046529 Bacteria 1603
284 Ga0495665_0002206 3300046531 Bacteria 10547
285 Ga0495640_0013440 3300046533 Bacteria 6220
286 Ga0495640_0220586 3300046533 Bacteria 1196
287 Ga0495586_0006294 3300046535 Bacteria 6342
288 Ga0495587_0007617 3300046536 Bacteria 7008
289 Ga0495587_0013059 3300046536 Bacteria 5223
290 Ga0495587_0013413 3300046536 Bacteria 5151
291 Ga0495587_0151179 3300046536 Bacteria 1323
292 Ga0495645_0024668 3300046543 Bacteria 4364
293 Ga0495645_0091812 3300046543 Bacteria 2169
294 Ga0495667_0001235 3300046559 Bacteria 16724
295 Ga0495667_0053474 3300046559 Bacteria 2659
296 Ga0495634_0027323 3300046642 Bacteria 3971
297 Ga0495635_0002940 3300046663 Bacteria 11701
298 Ga0495635_0029307 3300046663 Bacteria 3826
299 Ga0495635_0038173 3300046663 Bacteria 3325
300 Ga0495657_0060470 3300046675 Bacteria 2509
301 Ga0495657_0070934 3300046675 Bacteria 2276
302 Ga0495657_0217149 3300046675 Bacteria 1160
303 Ga0495599_0007811 3300046678 Bacteria 6492
304 Ga0495599_0026238 3300046678 Bacteria 3651
305 Ga0495599_0040641 3300046678 Bacteria 2919
306 Ga0495599_0164340 3300046678 Bacteria 1371
307 Ga0495623_0014218 3300046679 Bacteria 5155
308 Ga0495646_0052671 3300046680 Bacteria 2457
309 Ga0495646_0068804 3300046680 Bacteria 2089
310 Ga0495647_0006997 3300046681 Bacteria 3759
311 Ga0495658_0001348 3300046683 Bacteria 12874
312 Ga0495658_0154097 3300046683 Bacteria 1413
313 Ga0495613_0030854 3300046689 Bacteria 3981
314 Ga0495624_0003995 3300046690 Bacteria 10855
315 Ga0495624_0005314 3300046690 Bacteria 9302
316 Ga0495600_0004293 3300046809 Bacteria 8523
317 Ga0495600_0148375 3300046809 Bacteria 1519
318 Ga0495581_0000242 3300047315 Bacteria 25978
319 Ga0495581_0041907 3300047315 Bacteria 2650
320 Ga0495604_0034597 3300047317 Bacteria 3996
321 Ga0495674_0000764 3300047319 Bacteria 30501
322 Ga0495674_0019509 3300047319 Bacteria 6290
323 Ga0495676_0007077 3300047321 Bacteria 10293
324 Ga0495676_0007454 3300047321 Bacteria 10034
325 Ga0495680_0012611 3300047322 Bacteria 7425
326 Ga0495680_0015048 3300047322 Bacteria 6682
327 Ga0495680_0021606 3300047322 Bacteria 5385
328 Ga0495680_0080460 3300047322 Bacteria 2462
329 Ga0495675_0005292 3300047444 Bacteria 7858
330 Ga0495675_0020644 3300047444 Bacteria 4194
331 Ga0495675_0070329 3300047444 Bacteria 2209
332 Ga0495684_0001339 3300047471 Bacteria 19825
333 Ga0495684_0023074 3300047471 Bacteria 4786
334 Ga0495593_0026440 3300047673 Bacteria 3204
335 Ga0495602_0023708 3300048088 Bacteria 5973
336 Ga0495602_0101547 3300048088 Bacteria 2359
337 Ga0495602_0133007 3300048088 Bacteria 1980
338 Ga0496100_0063994 3300048903 Bacteria 2432
339 Ga0496102_0080631 3300048905 Bacteria 2998
340 Ga0496103_0019203 3300048906 Bacteria 4104
341 Ga0496104_0071548 3300048907 Bacteria 3297
342 Ga0496105_0033729 3300048908 Bacteria 4206
343 Ga0496107_0034447 3300048910 Bacteria 3627
344 Ga0496108_0011417 3300048911 Bacteria 7221
345 Ga0496109_0174950 3300048912 Bacteria 2014
346 Ga0496110_0006095 3300048913 Bacteria 9500
347 Ga0496111_0001951 3300048914 Bacteria 12237
348 Ga0496111_0016441 3300048914 Bacteria 5096
349 Ga0496112_0400094 3300048915 Bacteria 1313
350 Ga0496114_0048567 3300048917 Bacteria 3530
351 Ga0496115_0102825 3300048918 Bacteria 2343
352 Ga0496126_0326990 3300048929 Bacteria 1259
353 Ga0501031_0007398 3300049568 Bacteria 7153
354 Ga0501032_0215024 3300049569 Bacteria 1252
355 Ga0501034_0083584 3300049571 Bacteria 3194
356 Ga0501036_0027449 3300049572 Bacteria 4810
357 Ga0501038_0147766 3300049574 Bacteria 1918
358 Ga0501038_0258836 3300049574 Bacteria 1376
359 Ga0501039_0020586 3300049575 Bacteria 5055
360 Ga0501040_0059412 3300049576 Bacteria 2626
361 Ga0501041_0006235 3300049577 Bacteria 6971
362 Ga0501042_0025088 3300049578 Bacteria 4185
363 Ga0501046_0059090 3300049580 Bacteria 3005
364 Ga0501047_0078230 3300049581 Bacteria 3181
365 Ga0501048_0236029 3300049582 Bacteria 1297
366 Ga0501067_0002218 3300049583 Bacteria 10737
367 Ga0501067_0005718 3300049583 Bacteria 6902
368 Ga0501067_0092630 3300049583 Bacteria 1678
369 Ga0501068_0020002 3300049584 Bacteria 3895
370 Ga0501068_0031658 3300049584 Bacteria 3142
371 Ga0501068_0055287 3300049584 Bacteria 2405
372 Ga0501069_0004212 3300049585 Bacteria 7428
373 Ga0501069_0016413 3300049585 Bacteria 3979
374 Ga0501069_0252858 3300049585 Bacteria 1028
375 Ga0501070_0007465 3300049586 Bacteria 9288
376 Ga0501070_0047712 3300049586 Bacteria 3558
377 Ga0501070_0133388 3300049586 Bacteria 2051
378 Ga0501070_0193548 3300049586 Bacteria 1671
379 Ga0501071_0013345 3300049587 Bacteria 5597
380 Ga0501071_0117305 3300049587 Bacteria 1971
381 Ga0501072_0012360 3300049588 Bacteria 6524
382 Ga0501072_0032654 3300049588 Bacteria 4077
383 Ga0501072_0078571 3300049588 Bacteria 2613
384 Ga0501073_0018684 3300049589 Bacteria 5010
385 Ga0501073_0065554 3300049589 Bacteria 2532
386 Ga0501074_0007423 3300049590 Bacteria 7931
387 Ga0501074_0045569 3300049590 Bacteria 3172
388 Ga0501074_0120940 3300049590 Bacteria 1872
389 Ga0501075_0017249 3300049591 Bacteria 5214
390 Ga0501075_0266078 3300049591 Bacteria 1307
391 Ga0501077_0063559 3300049593 Bacteria 2341
392 Ga0501079_0100372 3300049741 Bacteria 2244
393 Ga0501080_0000361 3300049742 Bacteria 35108
394 Ga0501080_0043505 3300049742 Bacteria 4182
395 Ga0501080_0357429 3300049742 Bacteria 1318
396 Ga0501081_0232667 3300049743 Bacteria 1342
397 Ga0501083_0028837 3300049744 Bacteria 3824
398 Ga0501035_0306468 3300049822 Bacteria 1337
399 Ga0501045_0049484 3300049824 Bacteria 3064
400 nmdc:mga05p37_136561_c1 3300050507 Bacteria 3006
401 nmdc:mga09592_176784_c1 3300050508 Bacteria 1846
402 nmdc:mga0qj67_103490_c1 3300050509 Bacteria 2297
403 nmdc:mga06r32_228667_c1 3300050510 Bacteria 1848
404 nmdc:mga08y16_132857_c1 3300050511 Bacteria 2587
405 nmdc:mga0n895_258210_c1 3300050512 Bacteria 1768
406 Ga0495601_0014785 3300053077 Bacteria 4709
407 Ga0495601_0061276 3300053077 Bacteria 2388
408 Ga0495612_0002909 3300053078 Bacteria 7101
409 Ga0495612_0069150 3300053078 Bacteria 1470
410 Ga0495619_0004576 3300053085 Bacteria 8837
411 Ga0495619_0015803 3300053085 Bacteria 4778
412 Ga0500559_0035707 3300053136 Bacteria 2148
413 Ga0501084_0020770 3300054114 Bacteria 5477
414 Ga0501084_0271609 3300054114 Bacteria 1431
415 Ga0501082_0038779 3300060353 Bacteria 4109
416 Ga0501082_0064752 3300060353 Bacteria 3148
417 Ga0501082_0138529 3300060353 Bacteria 2112
418 Ga0530510_0012385 3300061734 Bacteria 5991
419 2856747696 2856741275 Bacteria 8096094
420 2891403990 2891395885 Bacteria 9251614
421 2891557703 2891554331 Bacteria 8812224
422 3006491113 3006486233 Bacteria 8157040
423 Ga0466963_0060484
424 JGI24740J21852_10046904
425 JGI24737J22298_10021671
426 JGI24735J21928_10012154
427 Ga0070658_10026530
428 Ga0070658_10038509
429 Ga0070683_100004507
430 Ga0070683_100012226
431 Ga0070683_100016483
432 Ga0070683_100195209
433 Ga0070683_100201445
434 Ga0070683_100463052
435 Ga0070690_100018408
436 Ga0070666_10013377
437 Ga0070666_10032846
438 Ga0070682_100070812
439 Ga0070682_100204371
440 Ga0070660_100029030
441 Ga0070660_100084421
442 Ga0070691_10047445
443 Ga0070687_100031664
444 Ga0070687_100054192
445 Ga0070692_10002794
446 Ga0070667_100019869
447 Ga0070714_100000428
448 Ga0070714_100016445
449 Ga0070713_100118537
450 Ga0070710_10026024
451 Ga0070701_10045917
452 Ga0070705_100035715
453 Ga0070694_100115614
454 Ga0070708_100158886
455 Ga0070663_100130381
456 Ga0070678_100091278
457 Ga0070681_10140464
458 Ga0068867_100405599
459 Ga0070706_100006255
460 Ga0070707_100195387
461 Ga0070679_100006703
462 Ga0070679_100129532
463 Ga0070684_100001453
464 Ga0070684_100017597
465 Ga0070684_100073996
466 Ga0068853_100061128
467 Ga0070665_100001537
468 Ga0070665_100075621
469 Ga0070665_100361869
470 Ga0068855_100016243
471 Ga0068857_100010452
472 Ga0068857_100127166
473 Ga0068857_100255420
474 Ga0068856_100082494
475 Ga0070702_100044393
476 Ga0068864_100053879
477 Ga0068864_100297746
478 Ga0068870_10004326
479 Ga0068863_100058966
480 Ga0068858_100245032
481 Ga0081455_10200065
482 Ga0081540_1000584
483 Ga0070717_10001222
484 Ga0070717_10171424
485 Ga0070715_10019276
486 Ga0070716_100046607
487 Ga0070712_100006545
488 Ga0097621_100087099
489 Ga0075428_100289982
490 Ga0075430_100071521
491 Ga0075431_100255961
492 Ga0075429_100030900
493 Ga0105240_10006856
494 Ga0111539_10179659
495 Ga0105245_10004344
496 Ga0105245_10816530
497 Ga0114129_10182562
498 Ga0105243_10031066
499 Ga0105242_10118755
500 Ga0105248_10078631
501 Ga0105249_10403543
502 Ga0105239_10002517
503 Ga0105246_10036359
504 Ga0157342_1002221
505 Ga0157373_10169691
506 Ga0157370_10481858
507 Ga0157369_10053756
508 Ga0157378_10240869
509 Ga0163162_10032278
510 Ga0163162_10298246
511 Ga0157372_10008749
512 Ga0157375_10164425
513 Ga0163163_10118008
514 Ga0157376_10114616
515 Ga0163161_10025566
516 Ga0206353_10357630
517 Ga0206353_10360944
518 Ga0213876_10108453
519 Ga0213875_10000180
520 Ga0213875_10000532
521 Ga0224572_1003500
522 Ga0209026_1005073
523 Ga0207653_10076500
524 Ga0207692_10045807
525 Ga0207692_10236078
526 Ga0207688_10011231
527 Ga0207680_10001517
528 Ga0207647_10003755
529 Ga0207647_10062685
530 Ga0207699_10030272
531 Ga0207699_10077009
532 Ga0207645_10064109
533 Ga0207705_10008522
534 Ga0207705_10317375
535 Ga0207684_10000446
536 Ga0207654_10089973
537 Ga0207707_10183959
538 Ga0207707_10296812
539 Ga0207671_10064433
540 Ga0207693_10002968
541 Ga0207657_10023218
542 Ga0207657_10083060
543 Ga0207657_10392639
544 Ga0207652_10056645
545 Ga0207652_10160807
546 Ga0207652_10384271
547 Ga0207659_10091509
548 Ga0207659_10297715
549 Ga0207687_10191627
550 Ga0207700_10095234
551 Ga0207700_10127405
552 Ga0207664_10016339
553 Ga0207664_10140375
554 Ga0207706_10236930
555 Ga0207670_10186204
556 Ga0207665_10039875
557 Ga0207665_10109261
558 Ga0207665_10262042
559 Ga0207711_10046821
560 Ga0207689_10026416
561 Ga0207661_10006344
562 Ga0207661_10052766
563 Ga0207667_10025415
564 Ga0207640_10343666
565 Ga0207658_10132901
566 Ga0207677_10240894
567 Ga0207639_10306576
568 Ga0207678_10012797
569 Ga0207702_10041134
570 Ga0207702_10413946
571 Ga0207676_10039402
572 Ga0207674_10005161
573 Ga0207674_10008851
574 Ga0207675_100093186
575 Ga0207683_10002452
576 Ga0207683_10113878
577 Ga0207698_10171386
578 Ga0268266_10003180
579 Ga0268266_10075646
580 Ga0268266_10236447
581 Ga0268264_10379997
582 Ga0265337_1002809
583 Ga0265326_10003567
584 Ga0265319_1008329
585 Ga0265334_10004231
586 Ga0265318_10008931
587 Ga0265323_10006489
588 Ga0265336_10008230
589 Ga0265338_10000375
590 Ga0265338_10027341
591 Ga0265324_10000935
592 Ga0265332_10002617
593 Ga0265320_10002761
594 Ga0265325_10006373
595 Ga0265340_10003258
596 Ga0265339_10047712
597 Ga0265327_10000076
598 Ga0265327_10003969
599 Ga0265316_10023462
600 Ga0265313_10018826
601 Ga0307508_10180266
602 Ga0265314_10004383
603 Ga0265342_10002423
604 Ga0373930_0017547
605 Ga0373938_0026850
606 Ga0373926_0007384
607 Ga0373934_0051535
608 Ga0373934_0072233
609 Ga0373949_0036293
610 Ga0373923_0020286
611 Ga0373923_0027389
612 Ga0373923_0033481
613 Ga0373936_0006347
614 Ga0373936_0052033
615 Ga0373945_0002447
616 Ga0373945_0046801
617 Ga0373953_0008545
618 Ga0373954_0120079
619 Ga0373954_0126307
620 Ga0373957_0075107
621 Ga0373960_0009655
622 Ga0373943_0000621
623 Ga0373943_0001024
624 Ga0373946_0002255
625 Ga0373946_0006728
626 Ga0373955_0039305
627 Ga0373955_0121110
628 Ga0373924_0007743
629 Ga0373924_0028742
630 Ga0373931_0008422
631 Ga0373935_0002638
632 Ga0373935_0062703
633 Ga0373935_0070438
634 Ga0373935_0124389
635 Ga0373927_0000878
636 Ga0373927_0033576
637 Ga0373933_0029400
638 Ga0373933_0157146
639 Ga0373947_0002380
640 Ga0373937_0042753
641 Ga0373937_0256669
642 Ga0373937_0297739
643 Ga0373937_0310499
644 Ga0373925_0002161
645 Ga0373925_0009789
646 Ga0373925_0018216
647 Ga0395899_0034004
648 Ga0395899_0098367
649 Ga0395898_0008069
650 Ga0395898_0683054
651 Ga0436364_0235491
652 Ga0436364_0267648
653 Ga0436364_0479292
654 Ga0436364_0999853
655 Ga0395901_0016639
656 Ga0395901_0178187
657 Ga0466966_0090537
658 Ga0466963_0065332
659 Ga0466964_0017278
660 Ga0466971_0037791
661 Ga0466957_0012422
662 Ga0466959_0067987
663 Ga0466959_0343086
664 Ga0466958_0292823
665 Ga0466967_0010440
666 Ga0466967_0016711
667 Ga0466967_0253282
668 Ga0466967_0613538
669 Ga0495592_0040856
670 Ga0495592_0061043
671 Ga0495592_0074950
672 Ga0495592_0187870
673 Ga0495603_0017364
674 Ga0495629_0030167
675 Ga0495641_0004081
676 Ga0495641_0010389
677 Ga0495651_0010899
678 Ga0495651_0027970
679 Ga0495651_0048342
680 Ga0495651_0103134
681 Ga0495653_0002295
682 Ga0495653_0012180
683 Ga0495580_0008879
684 Ga0495582_0017885
685 Ga0495639_0012120
686 Ga0495639_0013959
687 Ga0495662_0004023
688 Ga0495662_0145158
689 Ga0495664_0000893
690 Ga0495664_0040814
691 Ga0495664_0186114
692 Ga0495608_0001725
693 Ga0495608_0059735
694 Ga0495618_0009326
695 Ga0495618_0048700
696 Ga0495618_0196000
697 Ga0495628_0096461
698 Ga0495628_0203740
699 Ga0495630_0004867
700 Ga0495630_0133602
701 Ga0495666_0012726
702 Ga0495652_0002944
703 Ga0495652_0030644
704 Ga0495652_0128673
705 Ga0495652_0183535
706 Ga0495665_0002206
707 Ga0495640_0013440
708 Ga0495640_0220586
709 Ga0495586_0006294
710 Ga0495587_0007617
711 Ga0495587_0013059
712 Ga0495587_0013413
713 Ga0495587_0151179
714 Ga0495645_0024668
715 Ga0495645_0091812
716 Ga0495667_0001235
717 Ga0495667_0053474
718 Ga0495634_0027323
719 Ga0495635_0002940
720 Ga0495635_0029307
721 Ga0495635_0038173
722 Ga0495657_0060470
723 Ga0495657_0070934
724 Ga0495657_0217149
725 Ga0495599_0007811
726 Ga0495599_0026238
727 Ga0495599_0040641
728 Ga0495599_0164340
729 Ga0495623_0014218
730 Ga0495646_0052671
731 Ga0495646_0068804
732 Ga0495647_0006997
733 Ga0495658_0001348
734 Ga0495658_0154097
735 Ga0495613_0030854
736 Ga0495624_0003995
737 Ga0495624_0005314
738 Ga0495600_0004293
739 Ga0495600_0148375
740 Ga0495581_0000242
741 Ga0495581_0041907
742 Ga0495604_0034597
743 Ga0495674_0000764
744 Ga0495674_0019509
745 Ga0495676_0007077
746 Ga0495676_0007454
747 Ga0495680_0012611
748 Ga0495680_0015048
749 Ga0495680_0021606
750 Ga0495680_0080460
751 Ga0495675_0005292
752 Ga0495675_0020644
753 Ga0495675_0070329
754 Ga0495684_0001339
755 Ga0495684_0023074
756 Ga0495593_0026440
757 Ga0495602_0023708
758 Ga0495602_0101547
759 Ga0495602_0133007
760 Ga0496100_0063994
761 Ga0496102_0080631
762 Ga0496103_0019203
763 Ga0496104_0071548
764 Ga0496105_0033729
765 Ga0496107_0034447
766 Ga0496108_0011417
767 Ga0496109_0174950
768 Ga0496110_0006095
769 Ga0496111_0001951
770 Ga0496111_0016441
771 Ga0496112_0400094
772 Ga0496114_0048567
773 Ga0496115_0102825
774 Ga0496126_0326990
775 Ga0501031_0007398
776 Ga0501032_0215024
777 Ga0501034_0083584
778 Ga0501036_0027449
779 Ga0501038_0147766
780 Ga0501038_0258836
781 Ga0501039_0020586
782 Ga0501040_0059412
783 Ga0501041_0006235
784 Ga0501042_0025088
785 Ga0501046_0059090
786 Ga0501047_0078230
787 Ga0501048_0236029
788 Ga0501067_0002218
789 Ga0501067_0005718
790 Ga0501067_0092630
791 Ga0501068_0020002
792 Ga0501068_0031658
793 Ga0501068_0055287
794 Ga0501069_0004212
795 Ga0501069_0016413
796 Ga0501069_0252858
797 Ga0501070_0007465
798 Ga0501070_0047712
799 Ga0501070_0133388
800 Ga0501070_0193548
801 Ga0501071_0013345
802 Ga0501071_0117305
803 Ga0501072_0012360
804 Ga0501072_0032654
805 Ga0501072_0078571
806 Ga0501073_0018684
807 Ga0501073_0065554
808 Ga0501074_0007423
809 Ga0501074_0045569
810 Ga0501074_0120940
811 Ga0501075_0017249
812 Ga0501075_0266078
813 Ga0501077_0063559
814 Ga0501079_0100372
815 Ga0501080_0000361
816 Ga0501080_0043505
817 Ga0501080_0357429
818 Ga0501081_0232667
819 Ga0501083_0028837
820 Ga0501035_0306468
821 Ga0501045_0049484
822 nmdc:mga05p37_136561_c1
823 nmdc:mga09592_176784_c1
824 nmdc:mga0qj67_103490_c1
825 nmdc:mga06r32_228667_c1
826 nmdc:mga08y16_132857_c1
827 nmdc:mga0n895_258210_c1
828 Ga0495601_0014785
829 Ga0495601_0061276
830 Ga0495612_0002909
831 Ga0495612_0069150
832 Ga0495619_0004576
833 Ga0495619_0015803
834 Ga0500559_0035707
835 Ga0501084_0020770
836 Ga0501084_0271609
837 Ga0501082_0038779
838 Ga0501082_0064752
839 Ga0501082_0138529
840 Ga0530510_0012385
841 2856747696
842 2891403990
843 2891557703
844 3006491113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

34

329

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9465 10 321
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9366 10 321
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9353 8 321
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9313 10 321
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9296 10 319
ID Description Score Start End Superfamily
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9207 10 320 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9196 10 319 3.20.20.100
af_A0A1D6KXU0_241_470_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9093 135 320 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9085 10 318 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9084 11 320 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6J4LSH1-F1-model_v4 Oxidoreductase 0.9942 9 204 GO:0005829
GO:0016491
AF-A0A4R4MDL8-F1-model_v4 deleted 0.9913 10 201
AF-A0A4V1VJE8-F1-model_v4 Aldo/keto reductase 0.986 10 153 GO:0005829
GO:0016491
AF-N1V548-F1-model_v4 Aldo/keto reductase 0.9859 10 237 GO:0005829
GO:0016491
AF-A9WRA7-F1-model_v4 Oxidoreductase (EC 1.1.1.-) 0.9801 10 212 GO:0005829
GO:0016491

Map