F440337

General Info

Members Datasets Scaffolds Average Seq Length
422 161 422 243

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0004558|Ga0439448_0004558_1444_2175
Length 243
Sequence MSAERTAVVTGAGKRVGAAVAQALLEDGWAVVAHIHDSSDSVPDGAKKIAADLADGECARTIFAATKGLPPVRLLLNNAARFAWDGFGEFSVDEFDAHMAVNVRAPTLLIEELARNHDGRDALVVNLLDSKLSAPNPDYLSYTLSKYGLAALTELAARALAPRSIRVNGVAPALMLRSSGQSEENFEAMHASNPLRRGVEPADVIGAIRYLVEATAVTGQIITVDSGQRFMALERDVQFVGDV

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
134 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.45
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000971 3300001915 Bacteria 8621
2 JGI24740J21852_10006193 3300001979 Bacteria 4984
3 JGI24740J21852_10027945 3300001979 Bacteria 1869
4 JGI24740J21852_10028535 3300001979 Bacteria 1843
5 JGI24739J22299_10016108 3300001989 Bacteria 2710
6 JGI24737J22298_10004113 3300001990 Bacteria 5082
7 JGI24737J22298_10026247 3300001990 Bacteria 1840
8 JGI24735J21928_10012073 3300002067 Bacteria 2732
9 JGI24735J21928_10017481 3300002067 Bacteria 2217
10 JGI24735J21928_10023994 3300002067 Bacteria 1848
11 JGI24735J21928_10031895 3300002067 Bacteria 1561
12 JGI24735J21928_10076665 3300002067 Unclassified 958
13 JGI24738J21930_10002211 3300002075 Bacteria 5173
14 JGI24738J21930_10041185 3300002075 Bacteria 939
15 Ga0065712_10263473 3300005290 Bacteria 932
16 Ga0070658_10001347 3300005327 Bacteria 20977
17 Ga0070658_10012460 3300005327 Bacteria 6821
18 Ga0070658_10379242 3300005327 Bacteria 1213
19 Ga0070683_100005771 3300005329 Bacteria 10347
20 Ga0070683_100005789 3300005329 Bacteria 10336
21 Ga0070683_100268923 3300005329 Bacteria 1621
22 Ga0070690_100031790 3300005330 Bacteria 3291
23 Ga0070670_100001836 3300005331 Bacteria 17303
24 Ga0068869_100073637 3300005334 Bacteria 2533
25 Ga0070666_10000168 3300005335 Bacteria 45111
26 Ga0070680_100003062 3300005336 Bacteria 12405
27 Ga0070680_100073538 3300005336 Bacteria 2811
28 Ga0068868_100264469 3300005338 Bacteria 1452
29 Ga0070660_100000009 3300005339 Bacteria 145691
30 Ga0070660_100022816 3300005339 Bacteria 4634
31 Ga0070660_100077346 3300005339 Bacteria 2607
32 Ga0070660_100085639 3300005339 Bacteria 2479
33 Ga0070660_100442725 3300005339 Bacteria 1077
34 Ga0070660_100589872 3300005339 Bacteria 929
35 Ga0070687_100305988 3300005343 Bacteria 1010
36 Ga0070661_100000100 3300005344 Bacteria 70585
37 Ga0070661_100089202 3300005344 Bacteria 2283
38 Ga0070661_100111399 3300005344 Bacteria 2044
39 Ga0070692_10009633 3300005345 Bacteria 4365
40 Ga0070692_10491897 3300005345 Unclassified 793
41 Ga0070668_100027417 3300005347 Bacteria 4325
42 Ga0070668_100031969 3300005347 Bacteria 4005
43 Ga0070671_100006764 3300005355 Bacteria 9174
44 Ga0070671_100012914 3300005355 Bacteria 6731
45 Ga0070671_100057522 3300005355 Bacteria 3236
46 Ga0070673_100077404 3300005364 Bacteria 2688
47 Ga0070673_100150489 3300005364 Bacteria 1971
48 Ga0070673_100248561 3300005364 Bacteria 1549
49 Ga0070659_100000981 3300005366 Bacteria 20980
50 Ga0070659_100009507 3300005366 Bacteria 7143
51 Ga0070659_100015805 3300005366 Bacteria 5657
52 Ga0070659_100054107 3300005366 Bacteria 3161
53 Ga0070659_100109335 3300005366 Bacteria 2231
54 Ga0070659_100119759 3300005366 Bacteria 2131
55 Ga0070659_100132384 3300005366 Bacteria 2026
56 Ga0070659_100144457 3300005366 Bacteria 1938
57 Ga0070659_100150974 3300005366 Bacteria 1895
58 Ga0070659_100176280 3300005366 Bacteria 1753
59 Ga0070667_100000836 3300005367 Bacteria 28641
60 Ga0070667_100006655 3300005367 Bacteria 9606
61 Ga0070667_100023527 3300005367 Bacteria 5112
62 Ga0070714_100042221 3300005435 Bacteria 3851
63 Ga0070714_100638840 3300005435 Bacteria 1024
64 Ga0070694_100011864 3300005444 Bacteria 5405
65 Ga0070663_100004141 3300005455 Bacteria 8476
66 Ga0070663_100004583 3300005455 Bacteria 8141
67 Ga0070663_100074548 3300005455 Bacteria 2478
68 Ga0070663_100582026 3300005455 Bacteria 939
69 Ga0070662_100000035 3300005457 Bacteria 77342
70 Ga0070662_100039429 3300005457 Bacteria 3359
71 Ga0070662_100098623 3300005457 Bacteria 2207
72 Ga0070662_100196026 3300005457 Unclassified 1600
73 Ga0070681_10051007 3300005458 Bacteria 4127
74 Ga0070681_10055637 3300005458 Bacteria 3939
75 Ga0070681_10363037 3300005458 Bacteria 1358
76 Ga0070679_100079237 3300005530 Bacteria 3274
77 Ga0070679_100105409 3300005530 Bacteria 2805
78 Ga0070679_100489036 3300005530 Bacteria 1175
79 Ga0070684_100003789 3300005535 Bacteria 11418
80 Ga0070684_100068831 3300005535 Bacteria 3112
81 Ga0068853_100000409 3300005539 Bacteria 29517
82 Ga0068853_100006570 3300005539 Bacteria 9260
83 Ga0068853_100048013 3300005539 Bacteria 3665
84 Ga0068853_100080030 3300005539 Bacteria 2858
85 Ga0068853_100098900 3300005539 Bacteria 2576
86 Ga0068853_100132939 3300005539 Bacteria 2228
87 Ga0070672_100015815 3300005543 Bacteria 5387
88 Ga0070695_100040097 3300005545 Bacteria 2963
89 Ga0070693_100000322 3300005547 Bacteria 22033
90 Ga0070693_100110238 3300005547 Bacteria 1692
91 Ga0070665_100321676 3300005548 Bacteria 1551
92 Ga0068855_100018982 3300005563 Bacteria 8268
93 Ga0068855_100049492 3300005563 Bacteria 4956
94 Ga0068855_100060316 3300005563 Bacteria 4437
95 Ga0068855_100089424 3300005563 Bacteria 3555
96 Ga0068855_100108367 3300005563 Bacteria 3190
97 Ga0068855_100315842 3300005563 Bacteria 1728
98 Ga0070664_100000025 3300005564 Bacteria 93173
99 Ga0070664_100002857 3300005564 Bacteria 13980
100 Ga0070664_100013803 3300005564 Bacteria 6586
101 Ga0068857_100103752 3300005577 Bacteria 2553
102 Ga0068857_100105827 3300005577 Bacteria 2526
103 Ga0068857_100121043 3300005577 Bacteria 2356
104 Ga0068857_100227368 3300005577 Bacteria 1705
105 Ga0068854_100017451 3300005578 Bacteria 4802
106 Ga0068854_100035016 3300005578 Bacteria 3512
107 Ga0068854_100042911 3300005578 Bacteria 3204
108 Ga0068856_100000219 3300005614 Bacteria 61699
109 Ga0068856_100028999 3300005614 Bacteria 5408
110 Ga0068856_100078201 3300005614 Bacteria 3279
111 Ga0068856_100085381 3300005614 Bacteria 3135
112 Ga0068856_100165202 3300005614 Bacteria 2224
113 Ga0068852_100001450 3300005616 Bacteria 16008
114 Ga0068852_100011960 3300005616 Bacteria 6564
115 Ga0068852_100021551 3300005616 Bacteria 5148
116 Ga0068852_100031305 3300005616 Bacteria 4388
117 Ga0068852_100120524 3300005616 Bacteria 2401
118 Ga0068852_100390962 3300005616 Bacteria 1366
119 Ga0068859_100007663 3300005617 Bacteria 10972
120 Ga0068859_100017405 3300005617 Bacteria 7222
121 Ga0068859_100101529 3300005617 Bacteria 2934
122 Ga0068864_100000078 3300005618 Bacteria 103622
123 Ga0068864_100024144 3300005618 Bacteria 5112
124 Ga0068864_100063522 3300005618 Bacteria 3200
125 Ga0068864_100090555 3300005618 Bacteria 2697
126 Ga0068864_100233947 3300005618 Bacteria 1700
127 Ga0068851_10052238 3300005834 Bacteria 2078
128 Ga0068851_10126360 3300005834 Bacteria 1379
129 Ga0068851_10169725 3300005834 Unclassified 1203
130 Ga0068863_100000882 3300005841 Bacteria 30167
131 Ga0068863_100006447 3300005841 Bacteria 11509
132 Ga0068863_100048676 3300005841 Bacteria 4019
133 Ga0068863_100534684 3300005841 Unclassified 1156
134 Ga0068863_100694951 3300005841 Bacteria 1011
135 Ga0068858_100000874 3300005842 Bacteria 31179
136 Ga0068858_100023548 3300005842 Bacteria 5736
137 Ga0068858_100044667 3300005842 Bacteria 4106
138 Ga0068858_100045644 3300005842 Bacteria 4061
139 Ga0068860_100024087 3300005843 Bacteria 5884
140 Ga0068860_100066609 3300005843 Bacteria 3421
141 Ga0068860_100531165 3300005843 Bacteria 1177
142 Ga0068862_100021164 3300005844 Bacteria 5437
143 Ga0068862_100064993 3300005844 Bacteria 3141
144 Ga0068862_100122106 3300005844 Bacteria 2297
145 Ga0097621_100193826 3300006237 Bacteria 1761
146 Ga0068871_100750413 3300006358 Bacteria 897
147 Ga0075433_10008933 3300006852 Bacteria 8001
148 Ga0097620_100007663 3300006931 Bacteria 10972
149 Ga0097620_100017404 3300006931 Bacteria 7222
150 Ga0097620_100101529 3300006931 Bacteria 2934
151 Ga0105250_10100126 3300009092 Bacteria 1182
152 Ga0105240_10091846 3300009093 Bacteria 3708
153 Ga0105243_10637563 3300009148 Bacteria 1031
154 Ga0105241_10444437 3300009174 Bacteria 1146
155 Ga0105248_10000163 3300009177 Bacteria 77658
156 Ga0105248_10000413 3300009177 Bacteria 49136
157 Ga0105248_10026996 3300009177 Bacteria 6387
158 Ga0105248_10080318 3300009177 Bacteria 3665
159 Ga0105237_10044914 3300009545 Bacteria 4448
160 Ga0105237_10088467 3300009545 Bacteria 3087
161 Ga0105237_10599944 3300009545 Bacteria 1108
162 Ga0105238_10095659 3300009551 Bacteria 2957
163 Ga0105238_10232828 3300009551 Bacteria 1819
164 Ga0105249_10056595 3300009553 Bacteria 3590
165 Ga0105249_10064714 3300009553 Bacteria 3362
166 Ga0105239_10095795 3300010375 Bacteria 3278
167 Ga0105246_10026790 3300011119 Bacteria 3771
168 Ga0157373_10055844 3300013100 Bacteria 2805
169 Ga0157373_10180067 3300013100 Bacteria 1488
170 Ga0157373_10260308 3300013100 Unclassified 1228
171 Ga0157373_10314042 3300013100 Bacteria 1114
172 Ga0157371_10007968 3300013102 Bacteria 8502
173 Ga0157371_10019838 3300013102 Bacteria 4953
174 Ga0157371_10055890 3300013102 Bacteria 2800
175 Ga0157371_10206228 3300013102 Bacteria 1410
176 Ga0157369_10007970 3300013105 Bacteria 12172
177 Ga0157369_10072618 3300013105 Bacteria 3693
178 Ga0157369_10153154 3300013105 Bacteria 2436
179 Ga0157374_10064082 3300013296 Bacteria 3448
180 Ga0163162_10438837 3300013306 Bacteria 1438
181 Ga0157372_10059716 3300013307 Bacteria 4266
182 Ga0157372_10156824 3300013307 Bacteria 2630
183 Ga0157372_10171840 3300013307 Bacteria 2507
184 Ga0157372_10467804 3300013307 Bacteria 1469
185 Ga0157372_10782537 3300013307 Bacteria 1109
186 Ga0157375_10565720 3300013308 Bacteria 1298
187 Ga0163163_10000173 3300014325 Bacteria 67717
188 Ga0163163_10000355 3300014325 Bacteria 44183
189 Ga0182008_10188872 3300014497 Bacteria 1045
190 Ga0157377_10012534 3300014745 Bacteria 4267
191 Ga0157379_10008315 3300014968 Bacteria 9019
192 Ga0157379_10014034 3300014968 Bacteria 7021
193 Ga0157379_10141139 3300014968 Bacteria 2172
194 Ga0157379_10142749 3300014968 Unclassified 2159
195 Ga0207682_10187649 3300025893 Unclassified 946
196 Ga0207680_10005228 3300025903 Bacteria 6191
197 Ga0207647_10001281 3300025904 Bacteria 19328
198 Ga0207647_10012877 3300025904 Bacteria 5812
199 Ga0207647_10047954 3300025904 Bacteria 2654
200 Ga0207705_10000114 3300025909 Bacteria 90132
201 Ga0207705_10002195 3300025909 Bacteria 15094
202 Ga0207705_10005360 3300025909 Bacteria 9588
203 Ga0207705_10007800 3300025909 Bacteria 7858
204 Ga0207705_10014756 3300025909 Bacteria 5617
205 Ga0207654_10266390 3300025911 Bacteria 1154
206 Ga0207707_10016384 3300025912 Bacteria 6464
207 Ga0207707_10232709 3300025912 Bacteria 1603
208 Ga0207695_10566151 3300025913 Bacteria 1018
209 Ga0207660_10000241 3300025917 Bacteria 35515
210 Ga0207660_10011187 3300025917 Bacteria 5833
211 Ga0207660_10013631 3300025917 Bacteria 5330
212 Ga0207660_10100253 3300025917 Bacteria 2162
213 Ga0207660_10284549 3300025917 Bacteria 1313
214 Ga0207662_10188781 3300025918 Bacteria 1329
215 Ga0207657_10000071 3300025919 Bacteria 93725
216 Ga0207657_10006001 3300025919 Bacteria 12639
217 Ga0207657_10007218 3300025919 Bacteria 11410
218 Ga0207657_10021172 3300025919 Bacteria 6125
219 Ga0207657_10048808 3300025919 Bacteria 3694
220 Ga0207657_10068405 3300025919 Bacteria 3017
221 Ga0207657_10219099 3300025919 Bacteria 1525
222 Ga0207649_10000436 3300025920 Bacteria 30088
223 Ga0207649_10008855 3300025920 Bacteria 5496
224 Ga0207649_10234954 3300025920 Bacteria 1313
225 Ga0207652_10012703 3300025921 Bacteria 6811
226 Ga0207652_10043041 3300025921 Bacteria 3845
227 Ga0207652_10135236 3300025921 Bacteria 2201
228 Ga0207652_10144646 3300025921 Bacteria 2127
229 Ga0207652_10579719 3300025921 Bacteria 1007
230 Ga0207681_10018532 3300025923 Bacteria 4386
231 Ga0207694_10161236 3300025924 Bacteria 1811
232 Ga0207694_10192163 3300025924 Bacteria 1659
233 Ga0207664_10058136 3300025929 Bacteria 3076
234 Ga0207664_10400661 3300025929 Bacteria 1220
235 Ga0207644_10011048 3300025931 Bacteria 5965
236 Ga0207644_10023724 3300025931 Bacteria 4205
237 Ga0207690_10000045 3300025932 Bacteria 116965
238 Ga0207690_10001514 3300025932 Bacteria 14537
239 Ga0207690_10004549 3300025932 Bacteria 8192
240 Ga0207690_10007377 3300025932 Bacteria 6527
241 Ga0207690_10016977 3300025932 Bacteria 4438
242 Ga0207690_10085434 3300025932 Bacteria 2215
243 Ga0207690_10160091 3300025932 Bacteria 1677
244 Ga0207706_10000086 3300025933 Bacteria 95284
245 Ga0207706_10009166 3300025933 Bacteria 9100
246 Ga0207706_10035106 3300025933 Bacteria 4460
247 Ga0207706_10615083 3300025933 Bacteria 932
248 Ga0207691_10024700 3300025940 Bacteria 5651
249 Ga0207691_10243738 3300025940 Bacteria 1553
250 Ga0207711_10000218 3300025941 Bacteria 61467
251 Ga0207711_10002330 3300025941 Bacteria 17013
252 Ga0207711_10026803 3300025941 Bacteria 4837
253 Ga0207711_10031671 3300025941 Bacteria 4466
254 Ga0207711_10038776 3300025941 Bacteria 4051
255 Ga0207689_10004458 3300025942 Bacteria 12697
256 Ga0207689_10081410 3300025942 Bacteria 2661
257 Ga0207661_10008191 3300025944 Bacteria 7461
258 Ga0207661_10012980 3300025944 Bacteria 6079
259 Ga0207661_10124759 3300025944 Bacteria 2198
260 Ga0207661_10324631 3300025944 Bacteria 1384
261 Ga0207679_10003696 3300025945 Bacteria 9483
262 Ga0207679_10008987 3300025945 Bacteria 6385
263 Ga0207667_10002712 3300025949 Bacteria 21894
264 Ga0207667_10110739 3300025949 Bacteria 2832
265 Ga0207667_10462642 3300025949 Bacteria 1288
266 Ga0207651_10060187 3300025960 Bacteria 2635
267 Ga0207651_10118925 3300025960 Bacteria 2000
268 Ga0207712_10001363 3300025961 Bacteria 16740
269 Ga0207668_10165495 3300025972 Bacteria 1728
270 Ga0207668_10223183 3300025972 Bacteria 1514
271 Ga0207668_10297682 3300025972 Bacteria 1330
272 Ga0207640_10031822 3300025981 Bacteria 3265
273 Ga0207640_10081337 3300025981 Unclassified 2214
274 Ga0207640_10117565 3300025981 Bacteria 1898
275 Ga0207640_10241724 3300025981 Bacteria 1395
276 Ga0207640_10469319 3300025981 Bacteria 1041
277 Ga0207658_10004488 3300025986 Bacteria 9699
278 Ga0207658_10234601 3300025986 Bacteria 1550
279 Ga0207677_10048633 3300026023 Bacteria 2856
280 Ga0207703_10006561 3300026035 Bacteria 9282
281 Ga0207703_10018365 3300026035 Bacteria 5460
282 Ga0207703_10053446 3300026035 Bacteria 3283
283 Ga0207639_10000776 3300026041 Bacteria 21757
284 Ga0207639_10016918 3300026041 Bacteria 5166
285 Ga0207639_10018830 3300026041 Bacteria 4913
286 Ga0207639_10027911 3300026041 Bacteria 4116
287 Ga0207639_10030652 3300026041 Bacteria 3946
288 Ga0207639_10087058 3300026041 Bacteria 2489
289 Ga0207639_10241473 3300026041 Bacteria 1571
290 Ga0207639_10298397 3300026041 Bacteria 1423
291 Ga0207678_10005970 3300026067 Bacteria 10843
292 Ga0207678_10030453 3300026067 Bacteria 4711
293 Ga0207678_10063498 3300026067 Bacteria 3173
294 Ga0207678_10084499 3300026067 Bacteria 2714
295 Ga0207702_10016856 3300026078 Bacteria 6048
296 Ga0207702_10175407 3300026078 Unclassified 1969
297 Ga0207641_10000573 3300026088 Bacteria 40695
298 Ga0207641_10075309 3300026088 Bacteria 2914
299 Ga0207641_10089990 3300026088 Bacteria 2683
300 Ga0207641_10182237 3300026088 Bacteria 1924
301 Ga0207641_10654466 3300026088 Bacteria 1032
302 Ga0207676_10000783 3300026095 Bacteria 24809
303 Ga0207676_10077821 3300026095 Bacteria 2684
304 Ga0207674_10002909 3300026116 Bacteria 21260
305 Ga0207674_10007642 3300026116 Bacteria 12590
306 Ga0207674_10008283 3300026116 Bacteria 12040
307 Ga0207674_10127881 3300026116 Bacteria 2505
308 Ga0207674_10127882 3300026116 Bacteria 2505
309 Ga0207674_10327356 3300026116 Bacteria 1482
310 Ga0207698_10007632 3300026142 Bacteria 6782
311 Ga0207698_10009654 3300026142 Bacteria 6163
312 Ga0207698_10012706 3300026142 Bacteria 5523
313 Ga0207698_10039755 3300026142 Bacteria 3487
314 Ga0207698_10220050 3300026142 Bacteria 1715
315 Ga0268266_10069307 3300028379 Bacteria 3055
316 Ga0268265_10013521 3300028380 Bacteria 5547
317 Ga0268265_10093299 3300028380 Bacteria 2411
318 Ga0268265_10108108 3300028380 Bacteria 2263
319 Ga0268264_10011766 3300028381 Bacteria 7215
320 Ga0268264_10046256 3300028381 Bacteria 3614
321 Ga0268264_10232547 3300028381 Bacteria 1703
322 Ga0307405_10030201 3300031731 Bacteria 3176
323 Ga0307413_10038214 3300031824 Bacteria 2780
324 Ga0307410_10017304 3300031852 Bacteria 4325
325 Ga0307409_100014042 3300031995 Bacteria 5188
326 Ga0307409_100023457 3300031995 Bacteria 4276
327 Ga0307409_100124362 3300031995 Bacteria 2191
328 Ga0307416_100063936 3300032002 Bacteria 3016
329 Ga0307416_100233828 3300032002 Bacteria 1774
330 Ga0307414_10014721 3300032004 Bacteria 4700
331 Ga0307411_10235567 3300032005 Unclassified 1430
332 Ga0307415_100003904 3300032126 Bacteria 7662
333 Ga0307415_100007479 3300032126 Bacteria 5980
334 Ga0373961_0029110 3300035241 Bacteria 1528
335 Ga0373931_0027827 3300035691 Bacteria 2889
336 Ga0395899_0025226 3300037312 Bacteria 4488
337 Ga0395899_0097936 3300037312 Unclassified 2119
338 Ga0395899_0108828 3300037312 Bacteria 1994
339 Ga0395899_0253925 3300037312 Bacteria 1205
340 Ga0395900_0000803 3300037418 Bacteria 41506
341 Ga0395900_0032977 3300037418 Bacteria 5329
342 Ga0395900_0041332 3300037418 Bacteria 4753
343 Ga0395900_0045057 3300037418 Bacteria 4543
344 Ga0395900_0185808 3300037418 Bacteria 2110
345 Ga0395900_0503363 3300037418 Bacteria 1161
346 Ga0395898_0062064 3300037466 Bacteria 3630
347 Ga0395898_0079411 3300037466 Bacteria 3165
348 Ga0395898_0096020 3300037466 Bacteria 2847
349 Ga0395898_0472733 3300037466 Bacteria 1193
350 Ga0395905_0036895 3300037471 Bacteria 4591
351 Ga0395905_0045854 3300037471 Bacteria 4100
352 Ga0395905_0057463 3300037471 Bacteria 3639
353 Ga0395905_0063882 3300037471 Bacteria 3445
354 Ga0395905_0078129 3300037471 Bacteria 3101
355 Ga0395905_0090698 3300037471 Bacteria 2865
356 Ga0395905_0103037 3300037471 Unclassified 2679
357 Ga0395905_0123116 3300037471 Bacteria 2438
358 Ga0395905_0179832 3300037471 Bacteria 1985
359 Ga0395905_0333244 3300037471 Unclassified 1408
360 Ga0395905_0429696 3300037471 Bacteria 1217
361 Ga0395905_0834431 3300037471 Bacteria 824
362 Ga0395901_0001141 3300038443 Bacteria 28157
363 Ga0395901_0011748 3300038443 Bacteria 8875
364 Ga0395901_0081711 3300038443 Bacteria 3375
365 Ga0395901_0220712 3300038443 Bacteria 1981
366 Ga0395901_0288324 3300038443 Unclassified 1704
367 Ga0395901_0369751 3300038443 Bacteria 1477
368 Ga0395901_0395776 3300038443 Bacteria 1420
369 Ga0395901_0448089 3300038443 Bacteria 1320
370 Ga0395901_0598867 3300038443 Bacteria 1111
371 Ga0439448_0004558 3300042005 Bacteria 3913
372 Ga0439455_0001571 3300042012 Bacteria 3878
373 Ga0450905_003146 3300042142 Bacteria 2159
374 Ga0450889_000555 3300042144 Bacteria 4182
375 Ga0439458_0000646 3300042157 Bacteria 8999
376 Ga0466963_0018115 3300044694 Bacteria 4397
377 Ga0466963_0022767 3300044694 Bacteria 3971
378 Ga0466963_0037146 3300044694 Bacteria 3179
379 Ga0466963_0043627 3300044694 Bacteria 2950
380 Ga0466963_0124855 3300044694 Bacteria 1774
381 Ga0466971_0160339 3300044719 Bacteria 1053
382 Ga0466957_0053985 3300044842 Bacteria 2451
383 Ga0466957_0068825 3300044842 Bacteria 2186
384 Ga0466957_0109371 3300044842 Unclassified 1751
385 Ga0466958_0094742 3300045836 Bacteria 1850
386 Ga0466967_0000192 3300045976 Bacteria 25501
387 Ga0466967_0019084 3300045976 Bacteria 5504
388 Ga0466967_0026614 3300045976 Bacteria 4793
389 Ga0466967_0065879 3300045976 Bacteria 3226
390 Ga0466967_0071636 3300045976 Bacteria 3104
391 Ga0466967_0555545 3300045976 Bacteria 1130
392 Ga0495642_0111663 3300046528 Bacteria 1169
393 Ga0495669_0052242 3300046684 Bacteria 1835
394 Ga0495669_0232287 3300046684 Unclassified 885
395 Ga0496100_0535038 3300048903 Bacteria 905
396 Ga0496101_0030116 3300048904 Bacteria 3803
397 Ga0496102_0011737 3300048905 Bacteria 7561
398 Ga0496103_0111485 3300048906 Bacteria 1738
399 Ga0496104_0047452 3300048907 Bacteria 4048
400 Ga0496105_0447173 3300048908 Unclassified 1020
401 Ga0496106_0007667 3300048909 Bacteria 7985
402 Ga0496107_0022021 3300048910 Bacteria 4501
403 Ga0496107_0023077 3300048910 Bacteria 4397
404 Ga0496108_0000676 3300048911 Bacteria 26369
405 Ga0496108_0102628 3300048911 Bacteria 2440
406 Ga0496109_0043079 3300048912 Bacteria 4091
407 Ga0496109_0301409 3300048912 Unclassified 1511
408 Ga0496110_0033042 3300048913 Bacteria 4473
409 Ga0496110_0056491 3300048913 Bacteria 3454
410 Ga0496110_0274692 3300048913 Unclassified 1534
411 Ga0496111_0053156 3300048914 Bacteria 2926
412 Ga0496111_0270382 3300048914 Bacteria 1261
413 Ga0496112_0033810 3300048915 Bacteria 4972
414 Ga0496112_0165214 3300048915 Bacteria 2179
415 Ga0496112_0433715 3300048915 Bacteria 1252
416 Ga0496113_0009478 3300048916 Bacteria 6387
417 Ga0496113_0343471 3300048916 Bacteria 1197
418 Ga0501067_0010483 3300049583 Bacteria 5131
419 Ga0501068_0139816 3300049584 Bacteria 1518
420 nmdc:mga09592_630493_c1 3300050508 Bacteria 916
421 nmdc:mga0a205_2631_c1 3300050515 Bacteria 15859
422 Ga0466962_0032656 3300061719 Bacteria 2492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10055637 Ga0070681_100556372 225
2 3300005530 Ga0070679_100489036 Ga0070679_1004890362 225
3 3300005614 Ga0068856_100085381 Ga0068856_1000853812 225
4 3300025912 Ga0207707_10232709 Ga0207707_102327092 225
5 3300025917 Ga0207660_10013631 Ga0207660_100136315 225
6 3300025921 Ga0207652_10135236 Ga0207652_101352362 225
7 3300025949 Ga0207667_10462642 Ga0207667_104626422 232
8 3300005366 Ga0070659_100132384 Ga0070659_1001323842 233
9 3300025893 Ga0207682_10187649 Ga0207682_101876491 233
10 3300026142 Ga0207698_10220050 Ga0207698_102200501 233
11 3300005539 Ga0068853_100080030 Ga0068853_1000800302 235
12 3300005616 Ga0068852_100031305 Ga0068852_1000313053 235
13 3300005834 Ga0068851_10052238 Ga0068851_100522383 235
14 3300009093 Ga0105240_10091846 Ga0105240_100918462 235
15 3300009545 Ga0105237_10044914 Ga0105237_100449143 235
16 3300013100 Ga0157373_10260308 Ga0157373_102603082 235
17 3300013102 Ga0157371_10055890 Ga0157371_100558901 235
18 3300025904 Ga0207647_10012877 Ga0207647_100128774 235
19 3300026041 Ga0207639_10000776 Ga0207639_1000077613 235
20 3300026142 Ga0207698_10039755 Ga0207698_100397554 235
21 3300005334 Ga0068869_100073637 Ga0068869_1000736371 236
22 3300005338 Ga0068868_100264469 Ga0068868_1002644692 236
23 3300005355 Ga0070671_100057522 Ga0070671_1000575221 236
24 3300005367 Ga0070667_100023527 Ga0070667_1000235272 236
25 3300005455 Ga0070663_100074548 Ga0070663_1000745483 236
26 3300005548 Ga0070665_100321676 Ga0070665_1003216762 236
27 3300005617 Ga0068859_100007663 Ga0068859_10000766310 236
28 3300005618 Ga0068864_100000078 Ga0068864_10000007817 236
29 3300005841 Ga0068863_100000882 Ga0068863_10000088225 236
30 3300005842 Ga0068858_100000874 Ga0068858_10000087431 236
31 3300005843 Ga0068860_100024087 Ga0068860_1000240876 236
32 3300005844 Ga0068862_100122106 Ga0068862_1001221062 236
33 3300006931 Ga0097620_100007663 Ga0097620_1000076636 236
34 3300009177 Ga0105248_10000413 Ga0105248_1000041324 236
35 3300013306 Ga0163162_10438837 Ga0163162_104388372 236
36 3300014325 Ga0163163_10000355 Ga0163163_1000035531 236
37 3300014968 Ga0157379_10008315 Ga0157379_100083155 236
38 3300025941 Ga0207711_10000218 Ga0207711_1000021827 236
39 3300025942 Ga0207689_10081410 Ga0207689_100814104 236
40 3300025986 Ga0207658_10234601 Ga0207658_102346012 236
41 3300026067 Ga0207678_10084499 Ga0207678_100844993 236
42 3300026088 Ga0207641_10000573 Ga0207641_1000057331 236
43 3300026095 Ga0207676_10000783 Ga0207676_100007838 236
44 3300028380 Ga0268265_10108108 Ga0268265_101081083 236
45 3300028381 Ga0268264_10011766 Ga0268264_100117662 236
46 3300005618 Ga0068864_100233947 Ga0068864_1002339472 239
47 3300005844 Ga0068862_100064993 Ga0068862_1000649933 239
48 3300028380 Ga0268265_10093299 Ga0268265_100932993 239
49 3300032002 Ga0307416_100233828 Ga0307416_1002338282 239
50 3300046684 Ga0495669_0232287 Ga0495669_0232287_51_773 239
51 3300049583 Ga0501067_0010483 Ga0501067_0010483_3177_3941 239
52 3300049584 Ga0501068_0139816 Ga0501068_0139816_619_1383 239
53 3300032005 Ga0307411_10235567 Ga0307411_102355672 241
54 3300005457 Ga0070662_100196026 Ga0070662_1001960261 242
55 3300005834 Ga0068851_10169725 Ga0068851_101697252 242
56 3300025981 Ga0207640_10241724 Ga0207640_102417242 242
57 3300026041 Ga0207639_10241473 Ga0207639_102414732 242
58 3300048911 Ga0496108_0000676 Ga0496108_0000676_19000_19737 242
59 3300001979 JGI24740J21852_10027945 JGI24740J21852_100279452 243
60 3300002067 JGI24735J21928_10017481 JGI24735J21928_100174812 243
61 3300002067 JGI24735J21928_10031895 JGI24735J21928_100318953 243
62 3300005336 Ga0070680_100073538 Ga0070680_1000735384 243
63 3300005339 Ga0070660_100022816 Ga0070660_1000228166 243
64 3300005339 Ga0070660_100077346 Ga0070660_1000773464 243
65 3300005345 Ga0070692_10009633 Ga0070692_100096335 243
66 3300005347 Ga0070668_100027417 Ga0070668_1000274175 243
67 3300005364 Ga0070673_100150489 Ga0070673_1001504891 243
68 3300005364 Ga0070673_100248561 Ga0070673_1002485612 243
69 3300005366 Ga0070659_100015805 Ga0070659_1000158053 243
70 3300005366 Ga0070659_100109335 Ga0070659_1001093353 243
71 3300005444 Ga0070694_100011864 Ga0070694_1000118642 243
72 3300005455 Ga0070663_100582026 Ga0070663_1005820261 243
73 3300005457 Ga0070662_100039429 Ga0070662_1000394295 243
74 3300005458 Ga0070681_10051007 Ga0070681_100510076 243
75 3300005530 Ga0070679_100079237 Ga0070679_1000792372 243
76 3300005539 Ga0068853_100048013 Ga0068853_1000480135 243
77 3300005539 Ga0068853_100132939 Ga0068853_1001329392 243
78 3300005543 Ga0070672_100015815 Ga0070672_1000158158 243
79 3300005563 Ga0068855_100049492 Ga0068855_1000494924 243
80 3300005564 Ga0070664_100013803 Ga0070664_1000138037 243
81 3300005577 Ga0068857_100105827 Ga0068857_1001058273 243
82 3300005577 Ga0068857_100227368 Ga0068857_1002273682 243
83 3300005616 Ga0068852_100120524 Ga0068852_1001205243 243
84 3300005617 Ga0068859_100017405 Ga0068859_1000174056 243
85 3300005618 Ga0068864_100090555 Ga0068864_1000905554 243
86 3300005841 Ga0068863_100048676 Ga0068863_1000486763 243
87 3300005841 Ga0068863_100534684 Ga0068863_1005346842 243
88 3300005841 Ga0068863_100694951 Ga0068863_1006949512 243
89 3300005842 Ga0068858_100045644 Ga0068858_1000456443 243
90 3300005843 Ga0068860_100066609 Ga0068860_1000666092 243
91 3300006852 Ga0075433_10008933 Ga0075433_100089339 243
92 3300006931 Ga0097620_100017404 Ga0097620_1000174046 243
93 3300009092 Ga0105250_10100126 Ga0105250_101001262 243
94 3300009177 Ga0105248_10026996 Ga0105248_100269966 243
95 3300009177 Ga0105248_10080318 Ga0105248_100803183 243
96 3300009545 Ga0105237_10599944 Ga0105237_105999442 243
97 3300009553 Ga0105249_10056595 Ga0105249_100565952 243
98 3300009553 Ga0105249_10064714 Ga0105249_100647142 243
99 3300010375 Ga0105239_10095795 Ga0105239_100957955 243
100 3300011119 Ga0105246_10026790 Ga0105246_100267903 243
101 3300013102 Ga0157371_10206228 Ga0157371_102062282 243
102 3300013308 Ga0157375_10565720 Ga0157375_105657202 243
103 3300014745 Ga0157377_10012534 Ga0157377_100125344 243
104 3300014968 Ga0157379_10142749 Ga0157379_101427494 243
105 3300025904 Ga0207647_10001281 Ga0207647_100012819 243
106 3300025909 Ga0207705_10002195 Ga0207705_1000219510 243
107 3300025919 Ga0207657_10006001 Ga0207657_100060016 243
108 3300025919 Ga0207657_10021172 Ga0207657_100211727 243
109 3300025921 Ga0207652_10012703 Ga0207652_100127038 243
110 3300025923 Ga0207681_10018532 Ga0207681_100185325 243
111 3300025932 Ga0207690_10001514 Ga0207690_1000151414 243
112 3300025932 Ga0207690_10007377 Ga0207690_100073771 243
113 3300025933 Ga0207706_10035106 Ga0207706_100351065 243
114 3300025940 Ga0207691_10024700 Ga0207691_100247006 243
115 3300025940 Ga0207691_10243738 Ga0207691_102437382 243
116 3300025941 Ga0207711_10026803 Ga0207711_100268032 243
117 3300025941 Ga0207711_10038776 Ga0207711_100387762 243
118 3300025942 Ga0207689_10004458 Ga0207689_1000445810 243
119 3300025945 Ga0207679_10003696 Ga0207679_100036967 243
120 3300025960 Ga0207651_10118925 Ga0207651_101189252 243
121 3300025961 Ga0207712_10001363 Ga0207712_100013639 243
122 3300025972 Ga0207668_10223183 Ga0207668_102231831 243
123 3300025972 Ga0207668_10297682 Ga0207668_102976822 243
124 3300025981 Ga0207640_10081337 Ga0207640_100813373 243
125 3300026023 Ga0207677_10048633 Ga0207677_100486334 243
126 3300026035 Ga0207703_10006561 Ga0207703_100065615 243
127 3300026041 Ga0207639_10027911 Ga0207639_100279115 243
128 3300026041 Ga0207639_10087058 Ga0207639_100870582 243
129 3300026067 Ga0207678_10063498 Ga0207678_100634983 243
130 3300026088 Ga0207641_10089990 Ga0207641_100899901 243
131 3300026088 Ga0207641_10182237 Ga0207641_101822373 243
132 3300026088 Ga0207641_10654466 Ga0207641_106544661 243
133 3300026095 Ga0207676_10077821 Ga0207676_100778214 243
134 3300026116 Ga0207674_10127881 Ga0207674_101278812 243
135 3300026116 Ga0207674_10127882 Ga0207674_101278822 243
136 3300028381 Ga0268264_10046256 Ga0268264_100462562 243
137 3300031731 Ga0307405_10030201 Ga0307405_100302013 243
138 3300031824 Ga0307413_10038214 Ga0307413_100382142 243
139 3300031995 Ga0307409_100014042 Ga0307409_1000140425 243
140 3300032002 Ga0307416_100063936 Ga0307416_1000639361 243
141 3300032004 Ga0307414_10014721 Ga0307414_100147214 243
142 3300032126 Ga0307415_100003904 Ga0307415_1000039046 243
143 3300037418 Ga0395900_0000803 Ga0395900_0000803_8882_9613 243
144 3300037418 Ga0395900_0045057 Ga0395900_0045057_708_1439 243
145 3300037471 Ga0395905_0090698 Ga0395905_0090698_937_1668 243
146 3300037471 Ga0395905_0103037 Ga0395905_0103037_1408_2139 243
147 3300038443 Ga0395901_0001141 Ga0395901_0001141_18576_19307 243
148 3300038443 Ga0395901_0288324 Ga0395901_0288324_487_1218 243
149 3300038443 Ga0395901_0369751 Ga0395901_0369751_180_911 243
150 3300042005 Ga0439448_0004558 Ga0439448_0004558_1444_2175 243
151 3300042012 Ga0439455_0001571 Ga0439455_0001571_570_1301 243
152 3300042157 Ga0439458_0000646 Ga0439458_0000646_1777_2508 243
153 3300044694 Ga0466963_0043627 Ga0466963_0043627_291_1022 243
154 3300044842 Ga0466957_0053985 Ga0466957_0053985_1360_2091 243
155 3300045976 Ga0466967_0000192 Ga0466967_0000192_8653_9438 243
156 3300046528 Ga0495642_0111663 Ga0495642_0111663_245_976 243
157 3300048903 Ga0496100_0535038 Ga0496100_0535038_157_888 243
158 3300048904 Ga0496101_0030116 Ga0496101_0030116_1768_2499 243
159 3300048909 Ga0496106_0007667 Ga0496106_0007667_3951_4682 243
160 3300048910 Ga0496107_0023077 Ga0496107_0023077_838_1569 243
161 3300048912 Ga0496109_0043079 Ga0496109_0043079_165_896 243
162 3300048913 Ga0496110_0033042 Ga0496110_0033042_3545_4276 243
163 3300048914 Ga0496111_0053156 Ga0496111_0053156_198_929 243
164 3300048915 Ga0496112_0433715 Ga0496112_0433715_273_1004 243
165 3300048916 Ga0496113_0009478 Ga0496113_0009478_4325_5056 243
166 3300050508 nmdc:mga09592_630493_c1 nmdc:mga09592_630493_c1_174_905 243
167 3300050515 nmdc:mga0a205_2631_c1 nmdc:mga0a205_2631_c1_8621_9352 243
168 3300001915 JGI24741J21665_1000971 JGI24741J21665_10009719 244
169 3300001979 JGI24740J21852_10006193 JGI24740J21852_100061933 244
170 3300001979 JGI24740J21852_10028535 JGI24740J21852_100285353 244
171 3300001989 JGI24739J22299_10016108 JGI24739J22299_100161083 244
172 3300001990 JGI24737J22298_10004113 JGI24737J22298_100041135 244
173 3300001990 JGI24737J22298_10026247 JGI24737J22298_100262473 244
174 3300002067 JGI24735J21928_10012073 JGI24735J21928_100120733 244
175 3300002067 JGI24735J21928_10023994 JGI24735J21928_100239943 244
176 3300002067 JGI24735J21928_10076665 JGI24735J21928_100766651 244
177 3300002075 JGI24738J21930_10002211 JGI24738J21930_100022114 244
178 3300002075 JGI24738J21930_10041185 JGI24738J21930_100411851 244
179 3300005290 Ga0065712_10263473 Ga0065712_102634731 244
180 3300005327 Ga0070658_10001347 Ga0070658_1000134715 244
181 3300005327 Ga0070658_10012460 Ga0070658_100124604 244
182 3300005327 Ga0070658_10379242 Ga0070658_103792421 244
183 3300005329 Ga0070683_100005771 Ga0070683_1000057717 244
184 3300005329 Ga0070683_100005789 Ga0070683_1000057897 244
185 3300005329 Ga0070683_100268923 Ga0070683_1002689232 244
186 3300005330 Ga0070690_100031790 Ga0070690_1000317902 244
187 3300005331 Ga0070670_100001836 Ga0070670_1000018366 244
188 3300005335 Ga0070666_10000168 Ga0070666_1000016834 244
189 3300005336 Ga0070680_100003062 Ga0070680_10000306211 244
190 3300005339 Ga0070660_100000009 Ga0070660_10000000914 244
191 3300005339 Ga0070660_100085639 Ga0070660_1000856393 244
192 3300005339 Ga0070660_100442725 Ga0070660_1004427252 244
193 3300005339 Ga0070660_100589872 Ga0070660_1005898721 244
194 3300005343 Ga0070687_100305988 Ga0070687_1003059882 244
195 3300005344 Ga0070661_100000100 Ga0070661_10000010014 244
196 3300005344 Ga0070661_100089202 Ga0070661_1000892022 244
197 3300005344 Ga0070661_100111399 Ga0070661_1001113992 244
198 3300005345 Ga0070692_10491897 Ga0070692_104918971 244
199 3300005347 Ga0070668_100031969 Ga0070668_1000319692 244
200 3300005355 Ga0070671_100006764 Ga0070671_1000067645 244
201 3300005355 Ga0070671_100012914 Ga0070671_1000129148 244
202 3300005364 Ga0070673_100077404 Ga0070673_1000774042 244
203 3300005366 Ga0070659_100000981 Ga0070659_1000009818 244
204 3300005366 Ga0070659_100009507 Ga0070659_1000095072 244
205 3300005366 Ga0070659_100054107 Ga0070659_1000541073 244
206 3300005366 Ga0070659_100119759 Ga0070659_1001197593 244
207 3300005366 Ga0070659_100144457 Ga0070659_1001444573 244
208 3300005366 Ga0070659_100150974 Ga0070659_1001509743 244
209 3300005366 Ga0070659_100176280 Ga0070659_1001762803 244
210 3300005367 Ga0070667_100000836 Ga0070667_10000083619 244
211 3300005367 Ga0070667_100006655 Ga0070667_1000066558 244
212 3300005435 Ga0070714_100042221 Ga0070714_1000422214 244
213 3300005435 Ga0070714_100638840 Ga0070714_1006388402 244
214 3300005455 Ga0070663_100004141 Ga0070663_1000041412 244
215 3300005455 Ga0070663_100004583 Ga0070663_1000045832 244
216 3300005457 Ga0070662_100000035 Ga0070662_1000000355 244
217 3300005457 Ga0070662_100098623 Ga0070662_1000986233 244
218 3300005458 Ga0070681_10363037 Ga0070681_103630372 244
219 3300005530 Ga0070679_100105409 Ga0070679_1001054093 244
220 3300005535 Ga0070684_100003789 Ga0070684_1000037894 244
221 3300005535 Ga0070684_100068831 Ga0070684_1000688313 244
222 3300005539 Ga0068853_100000409 Ga0068853_10000040917 244
223 3300005539 Ga0068853_100006570 Ga0068853_1000065707 244
224 3300005539 Ga0068853_100098900 Ga0068853_1000989003 244
225 3300005545 Ga0070695_100040097 Ga0070695_1000400974 244
226 3300005547 Ga0070693_100000322 Ga0070693_10000032215 244
227 3300005547 Ga0070693_100110238 Ga0070693_1001102382 244
228 3300005563 Ga0068855_100018982 Ga0068855_1000189822 244
229 3300005563 Ga0068855_100060316 Ga0068855_1000603162 244
230 3300005563 Ga0068855_100089424 Ga0068855_1000894244 244
231 3300005563 Ga0068855_100108367 Ga0068855_1001083674 244
232 3300005563 Ga0068855_100315842 Ga0068855_1003158422 244
233 3300005564 Ga0070664_100000025 Ga0070664_10000002589 244
234 3300005564 Ga0070664_100002857 Ga0070664_10000285710 244
235 3300005577 Ga0068857_100103752 Ga0068857_1001037522 244
236 3300005577 Ga0068857_100121043 Ga0068857_1001210433 244
237 3300005578 Ga0068854_100017451 Ga0068854_1000174512 244
238 3300005578 Ga0068854_100035016 Ga0068854_1000350165 244
239 3300005578 Ga0068854_100042911 Ga0068854_1000429112 244
240 3300005614 Ga0068856_100000219 Ga0068856_10000021917 244
241 3300005614 Ga0068856_100028999 Ga0068856_1000289996 244
242 3300005614 Ga0068856_100078201 Ga0068856_1000782012 244
243 3300005614 Ga0068856_100165202 Ga0068856_1001652022 244
244 3300005616 Ga0068852_100001450 Ga0068852_1000014503 244
245 3300005616 Ga0068852_100011960 Ga0068852_1000119603 244
246 3300005616 Ga0068852_100021551 Ga0068852_1000215515 244
247 3300005616 Ga0068852_100390962 Ga0068852_1003909622 244
248 3300005617 Ga0068859_100101529 Ga0068859_1001015294 244
249 3300005618 Ga0068864_100024144 Ga0068864_1000241443 244
250 3300005618 Ga0068864_100063522 Ga0068864_1000635222 244
251 3300005834 Ga0068851_10126360 Ga0068851_101263602 244
252 3300005841 Ga0068863_100006447 Ga0068863_1000064478 244
253 3300005842 Ga0068858_100023548 Ga0068858_1000235484 244
254 3300005842 Ga0068858_100044667 Ga0068858_1000446674 244
255 3300005843 Ga0068860_100531165 Ga0068860_1005311652 244
256 3300005844 Ga0068862_100021164 Ga0068862_1000211646 244
257 3300006237 Ga0097621_100193826 Ga0097621_1001938263 244
258 3300006358 Ga0068871_100750413 Ga0068871_1007504132 244
259 3300006931 Ga0097620_100101529 Ga0097620_1001015294 244
260 3300009148 Ga0105243_10637563 Ga0105243_106375631 244
261 3300009174 Ga0105241_10444437 Ga0105241_104444372 244
262 3300009177 Ga0105248_10000163 Ga0105248_1000016314 244
263 3300009545 Ga0105237_10088467 Ga0105237_100884672 244
264 3300009551 Ga0105238_10095659 Ga0105238_100956592 244
265 3300009551 Ga0105238_10232828 Ga0105238_102328282 244
266 3300013100 Ga0157373_10055844 Ga0157373_100558444 244
267 3300013100 Ga0157373_10180067 Ga0157373_101800671 244
268 3300013100 Ga0157373_10314042 Ga0157373_103140422 244
269 3300013102 Ga0157371_10007968 Ga0157371_100079684 244
270 3300013102 Ga0157371_10019838 Ga0157371_100198385 244
271 3300013105 Ga0157369_10007970 Ga0157369_1000797011 244
272 3300013105 Ga0157369_10072618 Ga0157369_100726184 244
273 3300013105 Ga0157369_10153154 Ga0157369_101531543 244
274 3300013296 Ga0157374_10064082 Ga0157374_100640824 244
275 3300013307 Ga0157372_10059716 Ga0157372_100597166 244
276 3300013307 Ga0157372_10156824 Ga0157372_101568242 244
277 3300013307 Ga0157372_10171840 Ga0157372_101718403 244
278 3300013307 Ga0157372_10467804 Ga0157372_104678042 244
279 3300013307 Ga0157372_10782537 Ga0157372_107825372 244
280 3300014325 Ga0163163_10000173 Ga0163163_1000017368 244
281 3300014497 Ga0182008_10188872 Ga0182008_101888721 244
282 3300014968 Ga0157379_10014034 Ga0157379_100140344 244
283 3300014968 Ga0157379_10141139 Ga0157379_101411393 244
284 3300025903 Ga0207680_10005228 Ga0207680_100052285 244
285 3300025904 Ga0207647_10047954 Ga0207647_100479543 244
286 3300025909 Ga0207705_10000114 Ga0207705_100001142 244
287 3300025909 Ga0207705_10005360 Ga0207705_100053602 244
288 3300025909 Ga0207705_10007800 Ga0207705_100078008 244
289 3300025909 Ga0207705_10014756 Ga0207705_100147562 244
290 3300025911 Ga0207654_10266390 Ga0207654_102663902 244
291 3300025912 Ga0207707_10016384 Ga0207707_100163848 244
292 3300025913 Ga0207695_10566151 Ga0207695_105661512 244
293 3300025917 Ga0207660_10000241 Ga0207660_1000024124 244
294 3300025917 Ga0207660_10011187 Ga0207660_100111878 244
295 3300025917 Ga0207660_10100253 Ga0207660_101002532 244
296 3300025917 Ga0207660_10284549 Ga0207660_102845492 244
297 3300025918 Ga0207662_10188781 Ga0207662_101887812 244
298 3300025919 Ga0207657_10000071 Ga0207657_1000007188 244
299 3300025919 Ga0207657_10007218 Ga0207657_100072189 244
300 3300025919 Ga0207657_10048808 Ga0207657_100488086 244
301 3300025919 Ga0207657_10068405 Ga0207657_100684051 244
302 3300025919 Ga0207657_10219099 Ga0207657_102190992 244
303 3300025920 Ga0207649_10000436 Ga0207649_1000043617 244
304 3300025920 Ga0207649_10008855 Ga0207649_100088557 244
305 3300025920 Ga0207649_10234954 Ga0207649_102349542 244
306 3300025921 Ga0207652_10043041 Ga0207652_100430413 244
307 3300025921 Ga0207652_10144646 Ga0207652_101446463 244
308 3300025921 Ga0207652_10579719 Ga0207652_105797192 244
309 3300025924 Ga0207694_10161236 Ga0207694_101612363 244
310 3300025924 Ga0207694_10192163 Ga0207694_101921632 244
311 3300025929 Ga0207664_10058136 Ga0207664_100581361 244
312 3300025929 Ga0207664_10400661 Ga0207664_104006612 244
313 3300025931 Ga0207644_10011048 Ga0207644_100110485 244
314 3300025931 Ga0207644_10023724 Ga0207644_100237244 244
315 3300025932 Ga0207690_10000045 Ga0207690_1000004539 244
316 3300025932 Ga0207690_10004549 Ga0207690_100045495 244
317 3300025932 Ga0207690_10016977 Ga0207690_100169773 244
318 3300025932 Ga0207690_10085434 Ga0207690_100854343 244
319 3300025932 Ga0207690_10160091 Ga0207690_101600912 244
320 3300025933 Ga0207706_10000086 Ga0207706_1000008614 244
321 3300025933 Ga0207706_10009166 Ga0207706_100091663 244
322 3300025933 Ga0207706_10615083 Ga0207706_106150831 244
323 3300025941 Ga0207711_10002330 Ga0207711_1000233017 244
324 3300025941 Ga0207711_10031671 Ga0207711_100316713 244
325 3300025944 Ga0207661_10008191 Ga0207661_100081917 244
326 3300025944 Ga0207661_10012980 Ga0207661_100129808 244
327 3300025944 Ga0207661_10124759 Ga0207661_101247594 244
328 3300025944 Ga0207661_10324631 Ga0207661_103246312 244
329 3300025945 Ga0207679_10008987 Ga0207679_100089872 244
330 3300025949 Ga0207667_10002712 Ga0207667_100027126 244
331 3300025949 Ga0207667_10110739 Ga0207667_101107394 244
332 3300025960 Ga0207651_10060187 Ga0207651_100601874 244
333 3300025972 Ga0207668_10165495 Ga0207668_101654952 244
334 3300025981 Ga0207640_10031822 Ga0207640_100318224 244
335 3300025981 Ga0207640_10117565 Ga0207640_101175653 244
336 3300025981 Ga0207640_10469319 Ga0207640_104693192 244
337 3300025986 Ga0207658_10004488 Ga0207658_100044888 244
338 3300026035 Ga0207703_10018365 Ga0207703_100183654 244
339 3300026035 Ga0207703_10053446 Ga0207703_100534463 244
340 3300026041 Ga0207639_10016918 Ga0207639_100169182 244
341 3300026041 Ga0207639_10018830 Ga0207639_100188305 244
342 3300026041 Ga0207639_10030652 Ga0207639_100306524 244
343 3300026041 Ga0207639_10298397 Ga0207639_102983972 244
344 3300026067 Ga0207678_10005970 Ga0207678_100059706 244
345 3300026067 Ga0207678_10030453 Ga0207678_100304537 244
346 3300026078 Ga0207702_10016856 Ga0207702_100168564 244
347 3300026078 Ga0207702_10175407 Ga0207702_101754073 244
348 3300026088 Ga0207641_10075309 Ga0207641_100753092 244
349 3300026116 Ga0207674_10002909 Ga0207674_100029094 244
350 3300026116 Ga0207674_10007642 Ga0207674_1000764211 244
351 3300026116 Ga0207674_10008283 Ga0207674_1000828312 244
352 3300026116 Ga0207674_10327356 Ga0207674_103273562 244
353 3300026142 Ga0207698_10007632 Ga0207698_100076325 244
354 3300026142 Ga0207698_10009654 Ga0207698_100096546 244
355 3300026142 Ga0207698_10012706 Ga0207698_100127065 244
356 3300028379 Ga0268266_10069307 Ga0268266_100693072 244
357 3300028380 Ga0268265_10013521 Ga0268265_100135213 244
358 3300028381 Ga0268264_10232547 Ga0268264_102325472 244
359 3300031852 Ga0307410_10017304 Ga0307410_100173045 244
360 3300031995 Ga0307409_100023457 Ga0307409_1000234572 244
361 3300031995 Ga0307409_100124362 Ga0307409_1001243624 244
362 3300032126 Ga0307415_100007479 Ga0307415_1000074799 244
363 3300035241 Ga0373961_0029110 Ga0373961_0029110_79_813 244
364 3300035691 Ga0373931_0027827 Ga0373931_0027827_1983_2717 244
365 3300037312 Ga0395899_0025226 Ga0395899_0025226_3704_4438 244
366 3300037312 Ga0395899_0097936 Ga0395899_0097936_1239_1973 244
367 3300037312 Ga0395899_0108828 Ga0395899_0108828_114_848 244
368 3300037312 Ga0395899_0253925 Ga0395899_0253925_120_854 244
369 3300037418 Ga0395900_0032977 Ga0395900_0032977_120_854 244
370 3300037418 Ga0395900_0041332 Ga0395900_0041332_2820_3554 244
371 3300037418 Ga0395900_0185808 Ga0395900_0185808_343_1077 244
372 3300037418 Ga0395900_0503363 Ga0395900_0503363_361_1137 244
373 3300037466 Ga0395898_0062064 Ga0395898_0062064_50_784 244
374 3300037466 Ga0395898_0079411 Ga0395898_0079411_1240_1974 244
375 3300037466 Ga0395898_0096020 Ga0395898_0096020_115_849 244
376 3300037466 Ga0395898_0472733 Ga0395898_0472733_103_837 244
377 3300037471 Ga0395905_0036895 Ga0395905_0036895_309_1085 244
378 3300037471 Ga0395905_0045854 Ga0395905_0045854_2497_3231 244
379 3300037471 Ga0395905_0057463 Ga0395905_0057463_64_798 244
380 3300037471 Ga0395905_0063882 Ga0395905_0063882_1458_2192 244
381 3300037471 Ga0395905_0078129 Ga0395905_0078129_970_1704 244
382 3300037471 Ga0395905_0123116 Ga0395905_0123116_20_754 244
383 3300037471 Ga0395905_0179832 Ga0395905_0179832_15_752 244
384 3300037471 Ga0395905_0333244 Ga0395905_0333244_26_760 244
385 3300037471 Ga0395905_0429696 Ga0395905_0429696_31_765 244
386 3300037471 Ga0395905_0834431 Ga0395905_0834431_40_774 244
387 3300038443 Ga0395901_0011748 Ga0395901_0011748_2380_3114 244
388 3300038443 Ga0395901_0081711 Ga0395901_0081711_973_1707 244
389 3300038443 Ga0395901_0220712 Ga0395901_0220712_493_1227 244
390 3300038443 Ga0395901_0395776 Ga0395901_0395776_489_1223 244
391 3300038443 Ga0395901_0448089 Ga0395901_0448089_30_764 244
392 3300038443 Ga0395901_0598867 Ga0395901_0598867_148_882 244
393 3300042142 Ga0450905_003146 Ga0450905_003146_1414_2148 244
394 3300042144 Ga0450889_000555 Ga0450889_000555_784_1518 244
395 3300044694 Ga0466963_0018115 Ga0466963_0018115_1196_1930 244
396 3300044694 Ga0466963_0022767 Ga0466963_0022767_2741_3478 244
397 3300044694 Ga0466963_0037146 Ga0466963_0037146_1832_2620 244
398 3300044694 Ga0466963_0124855 Ga0466963_0124855_193_927 244
399 3300044719 Ga0466971_0160339 Ga0466971_0160339_273_1037 244
400 3300044842 Ga0466957_0068825 Ga0466957_0068825_864_1598 244
401 3300044842 Ga0466957_0109371 Ga0466957_0109371_65_802 244
402 3300045836 Ga0466958_0094742 Ga0466958_0094742_1090_1824 244
403 3300045976 Ga0466967_0019084 Ga0466967_0019084_2099_2833 244
404 3300045976 Ga0466967_0026614 Ga0466967_0026614_3659_4396 244
405 3300045976 Ga0466967_0065879 Ga0466967_0065879_2445_3179 244
406 3300045976 Ga0466967_0071636 Ga0466967_0071636_2010_2747 244
407 3300045976 Ga0466967_0555545 Ga0466967_0555545_216_950 244
408 3300046684 Ga0495669_0052242 Ga0495669_0052242_999_1733 244
409 3300048905 Ga0496102_0011737 Ga0496102_0011737_1469_2203 244
410 3300048906 Ga0496103_0111485 Ga0496103_0111485_711_1445 244
411 3300048907 Ga0496104_0047452 Ga0496104_0047452_34_768 244
412 3300048908 Ga0496105_0447173 Ga0496105_0447173_266_1000 244
413 3300048910 Ga0496107_0022021 Ga0496107_0022021_1775_2509 244
414 3300048911 Ga0496108_0102628 Ga0496108_0102628_998_1732 244
415 3300048912 Ga0496109_0301409 Ga0496109_0301409_31_765 244
416 3300048913 Ga0496110_0056491 Ga0496110_0056491_1706_2440 244
417 3300048913 Ga0496110_0274692 Ga0496110_0274692_771_1505 244
418 3300048914 Ga0496111_0270382 Ga0496111_0270382_342_1076 244
419 3300048915 Ga0496112_0033810 Ga0496112_0033810_3450_4184 244
420 3300048915 Ga0496112_0165214 Ga0496112_0165214_1254_1988 244
421 3300048916 Ga0496113_0343471 Ga0496113_0343471_380_1114 244
422 3300061719 Ga0466962_0032656 Ga0466962_0032656_1681_2418 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

5

188

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

11

229

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ztu-assembly1.cif.gz_B t190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+ 0.9054 9 228
4pn3-assembly2.cif.gz_F crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis 0.897 4 227
3uxy-assembly1.cif.gz_D the crystal structure of short chain dehydrogenase from rhodobacter sphaeroides 0.8955 5 228
8sbw-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.895 5 231
5tgd-assembly1.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.8946 1 239
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9323 5 40 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9185 3 170 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9076 5 175 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.907 4 181 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9054 9 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5AXY7-F1-model_v4 Short-chain dehydrogenase/reductase 0.9164 2 177 GO:0016020
GO:0016491
AF-A0A7Y2CF42-F1-model_v4 SDR family oxidoreductase 0.9108 4 235
AF-A0A352EDY6-F1-model_v4 3-oxoacyl-ACP reductase 0.9095 5 177 GO:0016491
AF-A0A6J7ELQ4-F1-model_v4 Unannotated protein 0.9041 4 228 GO:0016616
AF-A0A850KZY5-F1-model_v4 SDR family oxidoreductase 0.9039 5 229

Feature Viewer

pLDDT pTM Quality
82.94 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map