metagRoot

F440297

General Info

Members	Datasets	Scaffolds	Average Seq Length
422	198	422	241

Family's Representative Sequence

Representative Sequence	3300025941\|Ga0207711_10534080\|Ga0207711_105340802
Length	284
Sequence	VRWQPARRPVAPRGRRKKSHVESRKSKARRTNRSTGFSLYDSCRLLIAVVRSLATYVAVSLYVLVAAPLGMTLAILFGAKDFLYKLGHWGVRLSMGLSGITFRVAGREHVPVDRAVVFCSNHQSNVDPPILFEALHSHTHILFKAELEAIPLLARAFKVGGFIPVDRRNKEAAMRSIEAGAKSIRSGNSFLIFPEGTRSKTAQLLPFKKGGFIMAIKAQAPILPVAVQGGDAAMQKGSKIIRPATVSIRIGEPIETAGLALTDRDALIAKTRQRIEGLLALGPV

Samples

	Sample ID	Description	Type	Environment
1	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
2	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
3	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
5	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
12	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
22	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
23	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
24	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
25	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
26	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
33	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
34	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
35	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
36	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
37	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
38	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
39	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
40	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
41	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
50	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
55	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
56	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
57	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
58	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
59	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
61	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
62	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
68	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
70	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
72	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
75	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
76	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
77	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
78	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
79	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
80	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
81	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
82	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
83	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
84	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
85	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
123	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
126	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
127	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
128	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
129	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
130	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
131	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
132	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
133	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
134	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
135	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
136	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
137	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
138	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
139	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
140	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
141	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
142	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
143	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
144	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
145	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
146	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
147	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
148	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
149	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
150	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
151	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
152	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
153	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
154	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
155	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
156	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
157	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
158	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
159	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
160	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
161	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
162	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
163	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
164	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
165	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
166	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
167	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
168	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
169	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
170	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
171	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
172	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
173	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
174	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
175	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
176	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
177	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
178	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
179	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
180	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
181	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
182	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
183	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
184	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
185	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
186	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
187	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
188	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
189	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
190	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
191	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
192	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
193	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
194	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
195	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
196	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
197	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
198	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.95
Nodule	0
Rhizoplane	5.45
Rhizosphere	92.89
Stem	0
Stem Tuber	0
Unclassified	0.71

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065714_10101768	3300005288	Bacteria	1636
2	Ga0065712_10021174	3300005290	Unclassified	1817
3	Ga0065712_10068296	3300005290	Bacteria	12095
4	Ga0065712_10146084	3300005290	Bacteria	1408
5	Ga0065715_10108772	3300005293	Bacteria	2701
6	Ga0065715_10263191	3300005293	Bacteria	1132
7	Ga0070658_10324614	3300005327	Bacteria	1315
8	Ga0070683_100007443	3300005329	Bacteria	9249
9	Ga0070683_100084813	3300005329	Bacteria	2968
10	Ga0070690_100005501	3300005330	Bacteria	7122
11	Ga0070670_100007452	3300005331	Bacteria	9293
12	Ga0070670_100019041	3300005331	Bacteria	5886
13	Ga0070670_100120249	3300005331	Bacteria	2265
14	Ga0070677_10043303	3300005333	Archaea	1787
15	Ga0068868_100051644	3300005338	Unclassified	3235
16	Ga0070689_100005638	3300005340	Bacteria	8574
17	Ga0070689_100077651	3300005340	Bacteria	2603
18	Ga0070689_100114328	3300005340	Bacteria	2150
19	Ga0070689_100299228	3300005340	Unclassified	1339
20	Ga0070687_100227935	3300005343	Bacteria	1145
21	Ga0070661_100001358	3300005344	Bacteria	17086
22	Ga0070661_100108975	3300005344	Bacteria	2067
23	Ga0070668_100210549	3300005347	Unclassified	1599
24	Ga0070668_100362897	3300005347	Bacteria	1229
25	Ga0070669_100259571	3300005353	Bacteria	1386
26	Ga0070675_100000217	3300005354	Bacteria	36989
27	Ga0070675_100007246	3300005354	Bacteria	8556
28	Ga0070675_100057942	3300005354	Bacteria	3194
29	Ga0070675_100060937	3300005354	Unclassified	3115
30	Ga0070675_100599110	3300005354	Bacteria	999
31	Ga0070674_100048185	3300005356	Bacteria	2924
32	Ga0070674_100066585	3300005356	Bacteria	2531
33	Ga0070674_100430306	3300005356	Bacteria	1085
34	Ga0070674_100441658	3300005356	Unclassified	1072
35	Ga0070673_100044339	3300005364	Unclassified	3443
36	Ga0070673_100050250	3300005364	Bacteria	3260
37	Ga0070673_100433260	3300005364	Unclassified	1180
38	Ga0070673_100506308	3300005364	Bacteria	1093
39	Ga0070688_100027303	3300005365	Bacteria	3400
40	Ga0070688_100091027	3300005365	Bacteria	1993
41	Ga0070659_100079244	3300005366	Bacteria	2622
42	Ga0070667_100113672	3300005367	Unclassified	2350
43	Ga0070667_100215493	3300005367	Bacteria	1708
44	Ga0070713_100010911	3300005436	Bacteria	6587
45	Ga0070701_10048888	3300005438	Bacteria	2184
46	Ga0070711_100604179	3300005439	Unclassified	915
47	Ga0070705_100119493	3300005440	Bacteria	1699
48	Ga0070705_100617437	3300005440	Unclassified	841
49	Ga0070700_100053671	3300005441	Unclassified	2516
50	Ga0070700_100399759	3300005441	Unclassified	1033
51	Ga0070694_100501777	3300005444	Bacteria	966
52	Ga0070708_100078166	3300005445	Unclassified	2991
53	Ga0070663_100017166	3300005455	Bacteria	4718
54	Ga0070663_100031080	3300005455	Bacteria	3667
55	Ga0070678_100175428	3300005456	Bacteria	1750
56	Ga0070678_100195904	3300005456	Bacteria	1664
57	Ga0070681_10538554	3300005458	Bacteria	1081
58	Ga0068867_100288455	3300005459	Bacteria	1348
59	Ga0070707_100082581	3300005468	Bacteria	3104
60	Ga0070707_100268025	3300005468	Bacteria	1661
61	Ga0070707_100481183	3300005468	Unclassified	1203
62	Ga0070698_100521516	3300005471	Unclassified	1127
63	Ga0070699_100311683	3300005518	Unclassified	1413
64	Ga0070684_100007674	3300005535	Bacteria	8412
65	Ga0068853_100585299	3300005539	Unclassified	1059
66	Ga0070672_100018873	3300005543	Bacteria	4995
67	Ga0070672_100104342	3300005543	Unclassified	2303
68	Ga0070672_100213740	3300005543	Bacteria	1616
69	Ga0070686_100013002	3300005544	Bacteria	4752
70	Ga0070695_100032704	3300005545	Bacteria	3252
71	Ga0070695_100067944	3300005545	Unclassified	2326
72	Ga0070696_100009618	3300005546	Bacteria	6465
73	Ga0070696_100076587	3300005546	Unclassified	2362
74	Ga0070693_100294428	3300005547	Bacteria	1091
75	Ga0070665_100935725	3300005548	Bacteria	879
76	Ga0070704_100011603	3300005549	Bacteria	5408
77	Ga0070704_100121908	3300005549	Unclassified	2005
78	Ga0070664_100001311	3300005564	Bacteria	19875
79	Ga0070664_100026969	3300005564	Unclassified	4771
80	Ga0068857_100179140	3300005577	Bacteria	1929
81	Ga0068852_100010895	3300005616	Bacteria	6813
82	Ga0068859_100013189	3300005617	Bacteria	8298
83	Ga0068859_100118440	3300005617	Bacteria	2714
84	Ga0068859_100386756	3300005617	Unclassified	1495
85	Ga0068859_100793178	3300005617	Bacteria	1035
86	Ga0068864_100005986	3300005618	Bacteria	9978
87	Ga0068861_100194497	3300005719	Unclassified	1698
88	Ga0068870_10168216	3300005840	Bacteria	1306
89	Ga0068863_100399664	3300005841	Bacteria	1344
90	Ga0068858_100040705	3300005842	Bacteria	4311
91	Ga0068860_100909441	3300005843	Unclassified	896
92	Ga0068862_100032692	3300005844	Unclassified	4395
93	Ga0068862_100167721	3300005844	Unclassified	1964
94	Ga0068862_100218629	3300005844	Bacteria	1724
95	Ga0081539_10011274	3300005985	Bacteria	7100
96	Ga0075364_10248834	3300006051	Bacteria	1208
97	Ga0075432_10015607	3300006058	Bacteria	2591
98	Ga0075366_10102333	3300006195	Bacteria	1719
99	Ga0075366_10214125	3300006195	Unclassified	1173
100	Ga0097621_100045067	3300006237	Unclassified	3561
101	Ga0097621_100050603	3300006237	Bacteria	3379
102	Ga0097621_100247898	3300006237	Unclassified	1559
103	Ga0097621_100519716	3300006237	Bacteria	1080
104	Ga0068871_100009719	3300006358	Bacteria	6983
105	Ga0068871_100137646	3300006358	Bacteria	2074
106	Ga0075428_100000815	3300006844	Bacteria	32626
107	Ga0075428_100016389	3300006844	Bacteria	8188
108	Ga0075428_100020071	3300006844	Bacteria	7400
109	Ga0075428_100797268	3300006844	Unclassified	1004
110	Ga0075433_10019401	3300006852	Bacteria	5666
111	Ga0075433_10020505	3300006852	Bacteria	5529
112	Ga0075433_10169067	3300006852	Bacteria	1946
113	Ga0075433_10187942	3300006852	Bacteria	1838
114	Ga0075433_10353716	3300006852	Bacteria	1298
115	Ga0075434_100025446	3300006871	Bacteria	5791
116	Ga0075434_100208180	3300006871	Unclassified	1977
117	Ga0075434_100361339	3300006871	Unclassified	1473
118	Ga0075429_100211868	3300006880	Bacteria	1697
119	Ga0075429_100234971	3300006880	Bacteria	1606
120	Ga0075436_100251861	3300006914	Bacteria	1258
121	Ga0075436_100365920	3300006914	Bacteria	1041
122	Ga0097620_100013189	3300006931	Bacteria	8298
123	Ga0097620_100024919	3300006931	Bacteria	6005
124	Ga0097620_100050473	3300006931	Bacteria	4178
125	Ga0097620_100118441	3300006931	Bacteria	2714
126	Ga0097620_100386746	3300006931	Unclassified	1495
127	Ga0097620_100793317	3300006931	Bacteria	1035
128	Ga0075435_100010135	3300007076	Bacteria	6882
129	Ga0075435_100254228	3300007076	Bacteria	1496
130	Ga0111539_10001132	3300009094	Bacteria	35254
131	Ga0111539_10002890	3300009094	Bacteria	22802
132	Ga0111539_10029425	3300009094	Bacteria	6690
133	Ga0111539_10137553	3300009094	Unclassified	2860
134	Ga0111539_10210025	3300009094	Unclassified	2268
135	Ga0111539_10245074	3300009094	Bacteria	2086
136	Ga0111539_10349945	3300009094	Unclassified	1719
137	Ga0111539_10360330	3300009094	Bacteria	1693
138	Ga0111539_10408495	3300009094	Bacteria	1581
139	Ga0111539_10413914	3300009094	Bacteria	1570
140	Ga0111539_10841139	3300009094	Bacteria	1068
141	Ga0105245_10330357	3300009098	Bacteria	1505
142	Ga0114129_10037852	3300009147	Bacteria	6808
143	Ga0114129_10041548	3300009147	Bacteria	6478
144	Ga0114129_10045944	3300009147	Bacteria	6137
145	Ga0114129_10051521	3300009147	Bacteria	5779
146	Ga0114129_10075928	3300009147	Unclassified	4679
147	Ga0114129_10083502	3300009147	Bacteria	4436
148	Ga0114129_10106504	3300009147	Bacteria	3873
149	Ga0114129_10222529	3300009147	Bacteria	2545
150	Ga0114129_10363071	3300009147	Bacteria	1916
151	Ga0105241_10169380	3300009174	Bacteria	1803
152	Ga0105242_10083068	3300009176	Bacteria	2681
153	Ga0105242_10620980	3300009176	Unclassified	1047
154	Ga0105248_10046933	3300009177	Bacteria	4843
155	Ga0105248_10090276	3300009177	Unclassified	3450
156	Ga0105248_10142326	3300009177	Unclassified	2705
157	Ga0105248_10481793	3300009177	Unclassified	1398
158	Ga0105248_10533409	3300009177	Bacteria	1324
159	Ga0105249_10302789	3300009553	Bacteria	1604
160	Ga0105249_10387559	3300009553	Unclassified	1425
161	Ga0105246_10045592	3300011119	Bacteria	2986
162	Ga0157374_10006581	3300013296	Bacteria	9866
163	Ga0157374_10016820	3300013296	Bacteria	6435
164	Ga0157374_10425646	3300013296	Bacteria	1327
165	Ga0157374_10724792	3300013296	Bacteria	1008
166	Ga0163162_10810098	3300013306	Unclassified	1053
167	Ga0163162_11294932	3300013306	Bacteria	828
168	Ga0157375_10101383	3300013308	Unclassified	2962
169	Ga0157375_10371873	3300013308	Unclassified	1596
170	Ga0157375_10379538	3300013308	Bacteria	1580
171	Ga0163163_10016181	3300014325	Bacteria	6923
172	Ga0163163_10018559	3300014325	Bacteria	6516
173	Ga0163163_10054149	3300014325	Bacteria	3963
174	Ga0163163_10178313	3300014325	Bacteria	2172
175	Ga0157380_10006546	3300014326	Bacteria	8214
176	Ga0157380_10028597	3300014326	Unclassified	4252
177	Ga0157380_10690646	3300014326	Bacteria	1024
178	Ga0157377_10029052	3300014745	Bacteria	2981
179	Ga0157377_10081484	3300014745	Unclassified	1893
180	Ga0157377_10263761	3300014745	Bacteria	1122
181	Ga0157379_10034837	3300014968	Bacteria	4489
182	Ga0157379_10478061	3300014968	Unclassified	1153
183	Ga0157376_10121304	3300014969	Bacteria	2317
184	Ga0157376_10146435	3300014969	Bacteria	2125
185	Ga0163161_10016387	3300017792	Bacteria	5172
186	Ga0163161_10401548	3300017792	Bacteria	1099
187	Ga0207697_10002592	3300025315	Bacteria	9303
188	Ga0207697_10030827	3300025315	Unclassified	2194
189	Ga0207697_10055689	3300025315	Unclassified	1640
190	Ga0207688_10008851	3300025901	Bacteria	5478
191	Ga0207645_10074579	3300025907	Bacteria	2172
192	Ga0207645_10133537	3300025907	Bacteria	1616
193	Ga0207643_10126557	3300025908	Bacteria	1517
194	Ga0207663_10134174	3300025916	Bacteria	1715
195	Ga0207660_10642791	3300025917	Unclassified	865
196	Ga0207649_10036738	3300025920	Bacteria	2953
197	Ga0207646_10055444	3300025922	Unclassified	3543
198	Ga0207646_10153034	3300025922	Bacteria	2080
199	Ga0207646_10280299	3300025922	Bacteria	1506
200	Ga0207681_10017521	3300025923	Bacteria	4498
201	Ga0207681_10025150	3300025923	Unclassified	3828
202	Ga0207650_10010367	3300025925	Bacteria	6390
203	Ga0207650_10065292	3300025925	Bacteria	2727
204	Ga0207650_10154421	3300025925	Bacteria	1814
205	Ga0207650_10164012	3300025925	Bacteria	1762
206	Ga0207650_10169090	3300025925	Bacteria	1736
207	Ga0207650_10176078	3300025925	Unclassified	1702
208	Ga0207659_10005077	3300025926	Bacteria	7982
209	Ga0207659_10006474	3300025926	Bacteria	7177
210	Ga0207659_10184617	3300025926	Bacteria	1655
211	Ga0207687_10535717	3300025927	Bacteria	981
212	Ga0207644_10111181	3300025931	Bacteria	2072
213	Ga0207690_10085049	3300025932	Bacteria	2219
214	Ga0207706_10054820	3300025933	Unclassified	3518
215	Ga0207706_10206026	3300025933	Bacteria	1724
216	Ga0207706_10350956	3300025933	Bacteria	1283
217	Ga0207670_10153415	3300025936	Bacteria	1712
218	Ga0207670_10258418	3300025936	Unclassified	1349
219	Ga0207669_10010527	3300025937	Bacteria	4456
220	Ga0207669_10103421	3300025937	Bacteria	1889
221	Ga0207669_10299759	3300025937	Bacteria	1221
222	Ga0207669_10401124	3300025937	Unclassified	1074
223	Ga0207691_10001785	3300025940	Bacteria	21161
224	Ga0207691_10015543	3300025940	Bacteria	7236
225	Ga0207691_10072131	3300025940	Unclassified	3115
226	Ga0207691_10079503	3300025940	Unclassified	2951
227	Ga0207691_10121896	3300025940	Bacteria	2310
228	Ga0207711_10025112	3300025941	Bacteria	5000
229	Ga0207711_10057484	3300025941	Bacteria	3344
230	Ga0207711_10130646	3300025941	Bacteria	2251
231	Ga0207711_10534080	3300025941	Bacteria	1094
232	Ga0207689_10093473	3300025942	Bacteria	2470
233	Ga0207689_10479166	3300025942	Unclassified	1042
234	Ga0207679_10160672	3300025945	Unclassified	1839
235	Ga0207679_10271114	3300025945	Bacteria	1451
236	Ga0207651_10003845	3300025960	Bacteria	7449
237	Ga0207651_10007404	3300025960	Bacteria	5846
238	Ga0207651_10279058	3300025960	Bacteria	1380
239	Ga0207712_10139960	3300025961	Bacteria	1855
240	Ga0207668_10261075	3300025972	Bacteria	1411
241	Ga0207640_10669598	3300025981	Bacteria	886
242	Ga0207658_10051027	3300025986	Bacteria	3047
243	Ga0207658_10133022	3300025986	Bacteria	2001
244	Ga0207658_10254505	3300025986	Bacteria	1494
245	Ga0207677_10024218	3300026023	Bacteria	3767
246	Ga0207677_10218676	3300026023	Bacteria	1526
247	Ga0207703_10835091	3300026035	Bacteria	881
248	Ga0207639_10690822	3300026041	Bacteria	946
249	Ga0207678_10046847	3300026067	Bacteria	3739
250	Ga0207678_10048374	3300026067	Bacteria	3676
251	Ga0207708_10065745	3300026075	Unclassified	2772
252	Ga0207708_10071966	3300026075	Unclassified	2649
253	Ga0207641_10030498	3300026088	Bacteria	4467
254	Ga0207648_10065068	3300026089	Bacteria	3178
255	Ga0207674_10194634	3300026116	Bacteria	1977
256	Ga0207675_100229645	3300026118	Unclassified	1790
257	Ga0207675_100489318	3300026118	Unclassified	1223
258	Ga0207683_10295543	3300026121	Bacteria	1482
259	Ga0207683_10701432	3300026121	Bacteria	938
260	Ga0207698_10186805	3300026142	Bacteria	1841
261	Ga0207698_10376140	3300026142	Unclassified	1350
262	Ga0207428_10004476	3300027907	Bacteria	13249
263	Ga0207428_10016438	3300027907	Bacteria	6365
264	Ga0207428_10188715	3300027907	Bacteria	1554
265	Ga0207428_10308934	3300027907	Bacteria	1169
266	Ga0268266_10429758	3300028379	Unclassified	1253
267	Ga0268265_10070650	3300028380	Unclassified	2716
268	Ga0268265_10144213	3300028380	Unclassified	1998
269	Ga0268265_10216319	3300028380	Unclassified	1673
270	Ga0268265_10325031	3300028380	Bacteria	1395
271	Ga0268265_10437566	3300028380	Bacteria	1218
272	Ga0265330_10084734	3300031235	Bacteria	1364
273	Ga0307408_100013074	3300031548	Bacteria	5509
274	Ga0307408_100071009	3300031548	Bacteria	2573
275	Ga0307408_100088758	3300031548	Unclassified	2329
276	Ga0307405_10041586	3300031731	Bacteria	2792
277	Ga0307405_10064615	3300031731	Bacteria	2327
278	Ga0307405_10089836	3300031731	Bacteria	2030
279	Ga0307413_10010456	3300031824	Bacteria	4502
280	Ga0307413_10036496	3300031824	Bacteria	2830
281	Ga0307413_10068649	3300031824	Bacteria	2221
282	Ga0307410_10076225	3300031852	Bacteria	2340
283	Ga0307410_10080106	3300031852	Bacteria	2290
284	Ga0307410_10107233	3300031852	Bacteria	2014
285	Ga0307406_10006932	3300031901	Bacteria	6276
286	Ga0307406_10019573	3300031901	Unclassified	3975
287	Ga0307407_10006321	3300031903	Bacteria	5246
288	Ga0307407_10022280	3300031903	Bacteria	3283
289	Ga0307407_10038426	3300031903	Unclassified	2653
290	Ga0307407_10042785	3300031903	Unclassified	2542
291	Ga0307412_10006209	3300031911	Bacteria	6740
292	Ga0307412_10148882	3300031911	Bacteria	1724
293	Ga0307412_10189736	3300031911	Bacteria	1553
294	Ga0307412_10308449	3300031911	Bacteria	1254
295	Ga0307409_100001175	3300031995	Bacteria	12509
296	Ga0307409_100020189	3300031995	Bacteria	4535
297	Ga0307409_100024959	3300031995	Unclassified	4181
298	Ga0307409_100421060	3300031995	Bacteria	1281
299	Ga0307416_100007450	3300032002	Bacteria	6962
300	Ga0307416_100051888	3300032002	Bacteria	3280
301	Ga0307416_100061477	3300032002	Unclassified	3065
302	Ga0307416_100094808	3300032002	Bacteria	2575
303	Ga0307416_100674263	3300032002	Bacteria	1121
304	Ga0307414_10016146	3300032004	Bacteria	4531
305	Ga0307414_10033596	3300032004	Bacteria	3392
306	Ga0307414_10052238	3300032004	Bacteria	2843
307	Ga0307411_10020242	3300032005	Unclassified	3864
308	Ga0307411_10025055	3300032005	Unclassified	3567
309	Ga0307411_10050903	3300032005	Unclassified	2700
310	Ga0307415_100000697	3300032126	Bacteria	14962
311	Ga0307415_100238674	3300032126	Bacteria	1469
312	Ga0373939_0007595	3300035114	Bacteria	2636
313	Ga0373943_0039502	3300035170	Unclassified	2274
314	Ga0439461_0052708	3300041410	Unclassified	906
315	Ga0451807_0859993	3300041486	Bacteria	3597
316	Ga0451847_0159406	3300041503	Bacteria	1143
317	Ga0451851_1255796	3300041507	Bacteria	888
318	Ga0451853_0342525	3300041512	Bacteria	1051
319	Ga0439445_0111364	3300042004	Bacteria	781
320	Ga0439449_0109667	3300042007	Unclassified	1022
321	Ga0439457_048430	3300042014	Unclassified	952
322	Ga0439446_0019382	3300042156	Unclassified	1912
323	Ga0439435_0002276	3300042436	Bacteria	3776
324	Ga0451577_0061815	3300042876	Bacteria	3339
325	Ga0451577_0633463	3300042876	Bacteria	970
326	Ga0453684_0474529	3300044712	Bacteria	1389
327	Ga0453684_0526656	3300044712	Bacteria	1305
328	Ga0451576_0436615	3300045051	Unclassified	1374
329	Ga0451576_1203091	3300045051	Unclassified	791
330	Ga0495586_0191721	3300046535	Bacteria	1158
331	Ga0495598_0050939	3300046537	Bacteria	1246
332	Ga0495588_0135832	3300046674	Bacteria	1298
333	Ga0495658_0372196	3300046683	Bacteria	909
334	Ga0496101_0185922	3300048904	Bacteria	1602
335	Ga0496101_0301524	3300048904	Bacteria	1255
336	Ga0496101_0408211	3300048904	Unclassified	1070
337	Ga0496102_0599428	3300048905	Bacteria	1025
338	Ga0496104_0069016	3300048907	Bacteria	3359
339	Ga0496104_0166703	3300048907	Bacteria	2112
340	Ga0496105_0112654	3300048908	Bacteria	2245
341	Ga0496106_0352254	3300048909	Bacteria	1183
342	Ga0496108_0035939	3300048911	Bacteria	4121
343	Ga0496108_0192748	3300048911	Unclassified	1767
344	Ga0496109_0004180	3300048912	Bacteria	12046
345	Ga0496109_0256504	3300048912	Unclassified	1647
346	Ga0496109_0392823	3300048912	Bacteria	1311
347	Ga0496110_0001028	3300048913	Bacteria	19617
348	Ga0496110_0105532	3300048913	Bacteria	2528
349	Ga0496110_0471651	3300048913	Bacteria	1143
350	Ga0496111_0108828	3300048914	Bacteria	2040
351	Ga0496112_0332468	3300048915	Bacteria	1463
352	Ga0496112_0430554	3300048915	Bacteria	1258
353	Ga0496114_0088861	3300048917	Unclassified	2621
354	Ga0496114_0092006	3300048917	Bacteria	2576
355	Ga0496115_0171199	3300048918	Unclassified	1796
356	Ga0501034_0022962	3300049571	Bacteria	6357
357	Ga0501040_0200755	3300049576	Bacteria	1416
358	Ga0501040_0376199	3300049576	Bacteria	1019
359	Ga0501041_0053221	3300049577	Bacteria	2469
360	Ga0501041_0159997	3300049577	Bacteria	1408
361	Ga0501041_0208787	3300049577	Unclassified	1225
362	Ga0501042_0381877	3300049578	Bacteria	1020
363	Ga0501047_0014486	3300049581	Bacteria	7500
364	Ga0501067_0286370	3300049583	Bacteria	917
365	Ga0501069_0057063	3300049585	Bacteria	2176
366	Ga0501072_0113126	3300049588	Bacteria	2161
367	Ga0501072_0269962	3300049588	Unclassified	1354
368	Ga0501075_0093457	3300049591	Bacteria	2283
369	Ga0501075_0178533	3300049591	Unclassified	1620
370	Ga0501076_0119306	3300049592	Unclassified	2136
371	Ga0501076_0149504	3300049592	Unclassified	1900
372	Ga0501079_0236865	3300049741	Bacteria	1426
373	Ga0501079_0321048	3300049741	Bacteria	1212
374	Ga0501079_0616049	3300049741	Bacteria	854
375	Ga0501080_0279196	3300049742	Bacteria	1519
376	Ga0501080_0331059	3300049742	Bacteria	1377
377	Ga0501080_0618587	3300049742	Unclassified	960
378	Ga0501283_027646	3300049779	Bacteria	938
379	Ga0501044_0021367	3300049823	Bacteria	6907
380	Ga0501045_0522592	3300049824	Unclassified	881
381	nmdc:mga00v17_250234_c1	3300050491	Bacteria	1149
382	nmdc:mga05p37_125824_c1	3300050507	Unclassified	3148
383	nmdc:mga05p37_12967_c1	3300050507	Bacteria	9670
384	nmdc:mga05p37_16542_c1	3300050507	Bacteria	8886
385	nmdc:mga05p37_200555_c1	3300050507	Bacteria	2417
386	nmdc:mga05p37_212978_c1	3300050507	Bacteria	2335
387	nmdc:mga05p37_240686_c1	3300050507	Unclassified	2176
388	nmdc:mga05p37_24959_c1	3300050507	Bacteria	7266
389	nmdc:mga05p37_260374_c2	3300050507	Bacteria	1738
390	nmdc:mga05p37_342101_c1	3300050507	Bacteria	1764
391	nmdc:mga05p37_3535_c2	3300050507	Bacteria	17492
392	nmdc:mga05p37_78617_c1	3300050507	Bacteria	4062
393	nmdc:mga09592_234108_c1	3300050508	Bacteria	1591
394	nmdc:mga0qj67_549422_c1	3300050509	Bacteria	926
395	nmdc:mga08y16_121687_c1	3300050511	Bacteria	2716
396	nmdc:mga08y16_1619_c1	3300050511	Bacteria	22805
397	nmdc:mga08y16_228026_c1	3300050511	Bacteria	1927
398	nmdc:mga08y16_286990_c1	3300050511	Bacteria	1697
399	nmdc:mga08y16_326260_c1	3300050511	Unclassified	1580
400	nmdc:mga08y16_5842_c1	3300050511	Bacteria	12898
401	nmdc:mga0n895_18243_c1	3300050512	Bacteria	6488
402	nmdc:mga0n895_294171_c1	3300050512	Bacteria	1646
403	nmdc:mga0n895_36143_c1	3300050512	Bacteria	4769
404	nmdc:mga0rr50_128038_c1	3300050513	Unclassified	2029
405	nmdc:mga0rr50_156895_c1	3300050513	Unclassified	1844
406	nmdc:mga0rr50_181998_c1	3300050513	Bacteria	1718
407	nmdc:mga0rr50_3952_c1	3300050513	Bacteria	8624
408	nmdc:mga08x19_149174_c1	3300050514	Bacteria	1582
409	nmdc:mga08x19_19735_c1	3300050514	Unclassified	4141
410	nmdc:mga08x19_4551_c1	3300050514	Bacteria	8226
411	nmdc:mga0a205_17910_c1	3300050515	Bacteria	6648
412	nmdc:mga0a205_180220_c1	3300050515	Bacteria	2007
413	nmdc:mga0a205_28967_c1	3300050515	Bacteria	5297
414	nmdc:mga0a205_299172_c1	3300050515	Bacteria	1482
415	nmdc:mga0a205_47717_c1	3300050515	Bacteria	4133
416	nmdc:mga0a205_64368_c1	3300050515	Unclassified	3542
417	Ga0501084_0277479	3300054114	Unclassified	1415
418	Ga0590071_000385	3300059421	Bacteria	12968
419	Ga0590075_002015	3300059424	Bacteria	4894
420	Ga0590077_001693	3300059426	Bacteria	5035
421	Ga0501082_0540385	3300060353	Bacteria	1019
422	Ga0530510_0020356	3300061734	Unclassified	4717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042004	Ga0439445_0111364	Ga0439445_0111364_66_704	208
2	3300048913	Ga0496110_0001028	Ga0496110_0001028_2775_3446	209
3	3300013306	Ga0163162_10810098	Ga0163162_108100982	210
4	3300042014	Ga0439457_048430	Ga0439457_048430_16_678	211
5	3300049583	Ga0501067_0286370	Ga0501067_0286370_217_903	211
6	3300049585	Ga0501069_0057063	Ga0501069_0057063_1020_1706	211
7	3300049779	Ga0501283_027646	Ga0501283_027646_227_907	213
8	3300005458	Ga0070681_10538554	Ga0070681_105385542	214
9	3300025986	Ga0207658_10254505	Ga0207658_102545052	214
10	3300028379	Ga0268266_10429758	Ga0268266_104297582	214
11	3300005436	Ga0070713_100010911	Ga0070713_1000109117	215
12	3300032005	Ga0307411_10050903	Ga0307411_100509031	220
13	3300005290	Ga0065712_10068296	Ga0065712_100682969	221
14	3300005329	Ga0070683_100007443	Ga0070683_1000074433	221
15	3300005331	Ga0070670_100007452	Ga0070670_1000074528	221
16	3300005344	Ga0070661_100001358	Ga0070661_10000135812	221
17	3300005366	Ga0070659_100079244	Ga0070659_1000792442	221
18	3300005367	Ga0070667_100113672	Ga0070667_1001136723	221
19	3300005439	Ga0070711_100604179	Ga0070711_1006041791	221
20	3300005455	Ga0070663_100031080	Ga0070663_1000310804	221
21	3300005535	Ga0070684_100007674	Ga0070684_1000076743	221
22	3300005539	Ga0068853_100585299	Ga0068853_1005852991	221
23	3300005547	Ga0070693_100294428	Ga0070693_1002944282	221
24	3300005564	Ga0070664_100001311	Ga0070664_10000131116	221
25	3300006844	Ga0075428_100797268	Ga0075428_1007972682	221
26	3300006871	Ga0075434_100361339	Ga0075434_1003613392	221
27	3300007076	Ga0075435_100254228	Ga0075435_1002542282	221
28	3300009094	Ga0111539_10245074	Ga0111539_102450742	221
29	3300009094	Ga0111539_10360330	Ga0111539_103603302	221
30	3300009177	Ga0105248_10046933	Ga0105248_100469334	221
31	3300009553	Ga0105249_10387559	Ga0105249_103875591	221
32	3300014325	Ga0163163_10054149	Ga0163163_100541493	221
33	3300014326	Ga0157380_10690646	Ga0157380_106906462	221
34	3300014968	Ga0157379_10478061	Ga0157379_104780612	221
35	3300025315	Ga0207697_10030827	Ga0207697_100308272	221
36	3300025916	Ga0207663_10134174	Ga0207663_101341742	221
37	3300025920	Ga0207649_10036738	Ga0207649_100367384	221
38	3300025925	Ga0207650_10010367	Ga0207650_100103672	221
39	3300025933	Ga0207706_10206026	Ga0207706_102060262	221
40	3300025933	Ga0207706_10350956	Ga0207706_103509561	221
41	3300025945	Ga0207679_10160672	Ga0207679_101606722	221
42	3300026041	Ga0207639_10690822	Ga0207639_106908221	221
43	3300026067	Ga0207678_10046847	Ga0207678_100468474	221
44	3300031731	Ga0307405_10064615	Ga0307405_100646153	221
45	3300031824	Ga0307413_10068649	Ga0307413_100686492	221
46	3300031901	Ga0307406_10006932	Ga0307406_100069323	221
47	3300032002	Ga0307416_100007450	Ga0307416_1000074502	221
48	3300032126	Ga0307415_100238674	Ga0307415_1002386741	221
49	3300041410	Ga0439461_0052708	Ga0439461_0052708_174_890	221
50	3300042007	Ga0439449_0109667	Ga0439449_0109667_206_922	221
51	3300045051	Ga0451576_1203091	Ga0451576_1203091_51_767	221
52	3300046674	Ga0495588_0135832	Ga0495588_0135832_37_804	221
53	3300046683	Ga0495658_0372196	Ga0495658_0372196_14_730	221
54	3300048907	Ga0496104_0166703	Ga0496104_0166703_803_1519	221
55	3300048908	Ga0496105_0112654	Ga0496105_0112654_741_1457	221
56	3300048912	Ga0496109_0004180	Ga0496109_0004180_4103_4819	221
57	3300048914	Ga0496111_0108828	Ga0496111_0108828_766_1482	221
58	3300049576	Ga0501040_0200755	Ga0501040_0200755_405_1121	221
59	3300049588	Ga0501072_0113126	Ga0501072_0113126_455_1171	221
60	3300049591	Ga0501075_0093457	Ga0501075_0093457_1313_2029	221
61	3300049592	Ga0501076_0149504	Ga0501076_0149504_418_1134	221
62	3300049742	Ga0501080_0331059	Ga0501080_0331059_295_1011	221
63	3300050513	nmdc:mga0rr50_128038_c1	nmdc:mga0rr50_128038_c1_233_949	221
64	3300060353	Ga0501082_0540385	Ga0501082_0540385_156_872	221
65	3300005293	Ga0065715_10108772	Ga0065715_101087723	222
66	3300006195	Ga0075366_10214125	Ga0075366_102141252	222
67	3300006844	Ga0075428_100000815	Ga0075428_1000008155	222
68	3300006844	Ga0075428_100020071	Ga0075428_1000200718	222
69	3300031911	Ga0307412_10189736	Ga0307412_101897362	222
70	3300032002	Ga0307416_100051888	Ga0307416_1000518882	222
71	3300048904	Ga0496101_0301524	Ga0496101_0301524_305_1024	222
72	3300050507	nmdc:mga05p37_125824_c1	nmdc:mga05p37_125824_c1_945_1664	222
73	3300050515	nmdc:mga0a205_28967_c1	nmdc:mga0a205_28967_c1_1458_2177	222
74	3300005331	Ga0070670_100120249	Ga0070670_1001202492	223
75	3300005338	Ga0068868_100051644	Ga0068868_1000516443	223
76	3300005354	Ga0070675_100057942	Ga0070675_1000579423	223
77	3300005356	Ga0070674_100430306	Ga0070674_1004303061	223
78	3300005617	Ga0068859_100118440	Ga0068859_1001184403	223
79	3300006237	Ga0097621_100050603	Ga0097621_1000506032	223
80	3300006358	Ga0068871_100009719	Ga0068871_1000097194	223
81	3300006931	Ga0097620_100118441	Ga0097620_1001184413	223
82	3300009177	Ga0105248_10142326	Ga0105248_101423263	223
83	3300011119	Ga0105246_10045592	Ga0105246_100455922	223
84	3300017792	Ga0163161_10401548	Ga0163161_104015482	223
85	3300025925	Ga0207650_10154421	Ga0207650_101544212	223
86	3300025933	Ga0207706_10054820	Ga0207706_100548202	223
87	3300026035	Ga0207703_10835091	Ga0207703_108350911	223
88	3300031903	Ga0307407_10038426	Ga0307407_100384262	223
89	3300049577	Ga0501041_0208787	Ga0501041_0208787_169_882	223
90	3300049588	Ga0501072_0269962	Ga0501072_0269962_458_1171	223
91	3300049591	Ga0501075_0178533	Ga0501075_0178533_207_920	223
92	3300049592	Ga0501076_0119306	Ga0501076_0119306_814_1527	223
93	3300049741	Ga0501079_0321048	Ga0501079_0321048_194_907	223
94	3300049742	Ga0501080_0618587	Ga0501080_0618587_66_779	223
95	3300054114	Ga0501084_0277479	Ga0501084_0277479_459_1172	223
96	3300005333	Ga0070677_10043303	Ga0070677_100433032	224
97	3300005438	Ga0070701_10048888	Ga0070701_100488881	224
98	3300005441	Ga0070700_100053671	Ga0070700_1000536713	224
99	3300005441	Ga0070700_100399759	Ga0070700_1003997592	224
100	3300005444	Ga0070694_100501777	Ga0070694_1005017771	224
101	3300005549	Ga0070704_100121908	Ga0070704_1001219083	224
102	3300006931	Ga0097620_100024919	Ga0097620_1000249195	224
103	3300009094	Ga0111539_10349945	Ga0111539_103499452	224
104	3300009094	Ga0111539_10408495	Ga0111539_104084952	224
105	3300009147	Ga0114129_10363071	Ga0114129_103630711	224
106	3300013308	Ga0157375_10379538	Ga0157375_103795382	224
107	3300014326	Ga0157380_10006546	Ga0157380_100065467	224
108	3300014326	Ga0157380_10028597	Ga0157380_100285973	224
109	3300025917	Ga0207660_10642791	Ga0207660_106427911	224
110	3300026075	Ga0207708_10065745	Ga0207708_100657452	224
111	3300026075	Ga0207708_10071966	Ga0207708_100719664	224
112	3300027907	Ga0207428_10188715	Ga0207428_101887152	224
113	3300027907	Ga0207428_10308934	Ga0207428_103089342	224
114	3300048911	Ga0496108_0192748	Ga0496108_0192748_107_826	224
115	3300049577	Ga0501041_0053221	Ga0501041_0053221_123_842	224
116	3300049577	Ga0501041_0159997	Ga0501041_0159997_607_1326	224
117	3300050511	nmdc:mga08y16_286990_c1	nmdc:mga08y16_286990_c1_471_1190	224
118	3300050513	nmdc:mga0rr50_181998_c1	nmdc:mga0rr50_181998_c1_340_1059	224
119	3300005329	Ga0070683_100084813	Ga0070683_1000848132	225
120	3300005354	Ga0070675_100000217	Ga0070675_1000002178	225
121	3300005356	Ga0070674_100441658	Ga0070674_1004416581	225
122	3300005364	Ga0070673_100506308	Ga0070673_1005063082	225
123	3300005440	Ga0070705_100617437	Ga0070705_1006174371	225
124	3300005543	Ga0070672_100018873	Ga0070672_1000188736	225
125	3300005719	Ga0068861_100194497	Ga0068861_1001944972	225
126	3300005985	Ga0081539_10011274	Ga0081539_100112742	225
127	3300006852	Ga0075433_10020505	Ga0075433_100205053	225
128	3300006852	Ga0075433_10169067	Ga0075433_101690672	225
129	3300006852	Ga0075433_10187942	Ga0075433_101879422	225
130	3300006871	Ga0075434_100025446	Ga0075434_1000254464	225
131	3300006871	Ga0075434_100208180	Ga0075434_1002081803	225
132	3300006914	Ga0075436_100251861	Ga0075436_1002518612	225
133	3300009094	Ga0111539_10029425	Ga0111539_100294254	225
134	3300009094	Ga0111539_10210025	Ga0111539_102100252	225
135	3300009147	Ga0114129_10037852	Ga0114129_100378525	225
136	3300009147	Ga0114129_10041548	Ga0114129_100415482	225
137	3300009147	Ga0114129_10045944	Ga0114129_100459442	225
138	3300009147	Ga0114129_10075928	Ga0114129_100759283	225
139	3300009147	Ga0114129_10106504	Ga0114129_101065045	225
140	3300009147	Ga0114129_10222529	Ga0114129_102225292	225
141	3300009176	Ga0105242_10620980	Ga0105242_106209802	225
142	3300009177	Ga0105248_10481793	Ga0105248_104817932	225
143	3300013296	Ga0157374_10006581	Ga0157374_100065819	225
144	3300013296	Ga0157374_10724792	Ga0157374_107247922	225
145	3300014745	Ga0157377_10029052	Ga0157377_100290522	225
146	3300025923	Ga0207681_10017521	Ga0207681_100175213	225
147	3300025926	Ga0207659_10006474	Ga0207659_100064744	225
148	3300025940	Ga0207691_10015543	Ga0207691_100155437	225
149	3300025941	Ga0207711_10057484	Ga0207711_100574842	225
150	3300025986	Ga0207658_10051027	Ga0207658_100510273	225
151	3300026088	Ga0207641_10030498	Ga0207641_100304983	225
152	3300026118	Ga0207675_100229645	Ga0207675_1002296452	225
153	3300027907	Ga0207428_10004476	Ga0207428_1000447611	225
154	3300035114	Ga0373939_0007595	Ga0373939_0007595_64_786	225
155	3300049571	Ga0501034_0022962	Ga0501034_0022962_5503_6225	225
156	3300049742	Ga0501080_0279196	Ga0501080_0279196_535_1290	225
157	3300050507	nmdc:mga05p37_16542_c1	nmdc:mga05p37_16542_c1_1091_1810	225
158	3300050507	nmdc:mga05p37_200555_c1	nmdc:mga05p37_200555_c1_1009_1731	225
159	3300050507	nmdc:mga05p37_24959_c1	nmdc:mga05p37_24959_c1_3825_4547	225
160	3300050507	nmdc:mga05p37_78617_c1	nmdc:mga05p37_78617_c1_1469_2191	225
161	3300050511	nmdc:mga08y16_326260_c1	nmdc:mga08y16_326260_c1_329_1051	225
162	3300050511	nmdc:mga08y16_5842_c1	nmdc:mga08y16_5842_c1_9576_10298	225
163	3300050512	nmdc:mga0n895_18243_c1	nmdc:mga0n895_18243_c1_5443_6165	225
164	3300050512	nmdc:mga0n895_294171_c1	nmdc:mga0n895_294171_c1_259_981	225
165	3300050513	nmdc:mga0rr50_156895_c1	nmdc:mga0rr50_156895_c1_873_1595	225
166	3300050514	nmdc:mga08x19_19735_c1	nmdc:mga08x19_19735_c1_1633_2355	225
167	3300050514	nmdc:mga08x19_4551_c1	nmdc:mga08x19_4551_c1_7197_7916	225
168	3300050515	nmdc:mga0a205_180220_c1	nmdc:mga0a205_180220_c1_672_1391	225
169	3300050515	nmdc:mga0a205_299172_c1	nmdc:mga0a205_299172_c1_499_1221	225
170	3300050515	nmdc:mga0a205_47717_c1	nmdc:mga0a205_47717_c1_1520_2242	225
171	3300005340	Ga0070689_100077651	Ga0070689_1000776511	226
172	3300005356	Ga0070674_100066585	Ga0070674_1000665853	226
173	3300005365	Ga0070688_100091027	Ga0070688_1000910272	226
174	3300005440	Ga0070705_100119493	Ga0070705_1001194932	226
175	3300005468	Ga0070707_100082581	Ga0070707_1000825812	226
176	3300005545	Ga0070695_100032704	Ga0070695_1000327042	226
177	3300005546	Ga0070696_100076587	Ga0070696_1000765872	226
178	3300005549	Ga0070704_100011603	Ga0070704_1000116036	226
179	3300005617	Ga0068859_100386756	Ga0068859_1003867562	226
180	3300005844	Ga0068862_100218629	Ga0068862_1002186292	226
181	3300006058	Ga0075432_10015607	Ga0075432_100156074	226
182	3300006852	Ga0075433_10019401	Ga0075433_100194014	226
183	3300006880	Ga0075429_100211868	Ga0075429_1002118682	226
184	3300006880	Ga0075429_100234971	Ga0075429_1002349712	226
185	3300006914	Ga0075436_100365920	Ga0075436_1003659202	226
186	3300006931	Ga0097620_100386746	Ga0097620_1003867462	226
187	3300007076	Ga0075435_100010135	Ga0075435_1000101354	226
188	3300009094	Ga0111539_10001132	Ga0111539_1000113222	226
189	3300009094	Ga0111539_10413914	Ga0111539_104139142	226
190	3300009094	Ga0111539_10841139	Ga0111539_108411391	226
191	3300009174	Ga0105241_10169380	Ga0105241_101693802	226
192	3300014745	Ga0157377_10263761	Ga0157377_102637612	226
193	3300025315	Ga0207697_10002592	Ga0207697_100025923	226
194	3300025901	Ga0207688_10008851	Ga0207688_100088514	226
195	3300025922	Ga0207646_10055444	Ga0207646_100554442	226
196	3300025925	Ga0207650_10065292	Ga0207650_100652922	226
197	3300025926	Ga0207659_10184617	Ga0207659_101846172	226
198	3300025931	Ga0207644_10111181	Ga0207644_101111812	226
199	3300025937	Ga0207669_10010527	Ga0207669_100105274	226
200	3300025937	Ga0207669_10103421	Ga0207669_101034212	226
201	3300025937	Ga0207669_10401124	Ga0207669_104011241	226
202	3300026023	Ga0207677_10024218	Ga0207677_100242183	226
203	3300026121	Ga0207683_10295543	Ga0207683_102955432	226
204	3300028380	Ga0268265_10437566	Ga0268265_104375662	226
205	3300031235	Ga0265330_10084734	Ga0265330_100847342	226
206	3300031548	Ga0307408_100088758	Ga0307408_1000887583	226
207	3300031731	Ga0307405_10041586	Ga0307405_100415864	226
208	3300031824	Ga0307413_10010456	Ga0307413_100104565	226
209	3300031824	Ga0307413_10036496	Ga0307413_100364963	226
210	3300031852	Ga0307410_10076225	Ga0307410_100762253	226
211	3300031852	Ga0307410_10107233	Ga0307410_101072332	226
212	3300031901	Ga0307406_10019573	Ga0307406_100195734	226
213	3300031903	Ga0307407_10006321	Ga0307407_100063215	226
214	3300031903	Ga0307407_10042785	Ga0307407_100427853	226
215	3300031911	Ga0307412_10148882	Ga0307412_101488822	226
216	3300031995	Ga0307409_100001175	Ga0307409_1000011757	226
217	3300031995	Ga0307409_100024959	Ga0307409_1000249594	226
218	3300032002	Ga0307416_100061477	Ga0307416_1000614772	226
219	3300032004	Ga0307414_10016146	Ga0307414_100161463	226
220	3300032004	Ga0307414_10033596	Ga0307414_100335962	226
221	3300032005	Ga0307411_10020242	Ga0307411_100202422	226
222	3300032005	Ga0307411_10025055	Ga0307411_100250553	226
223	3300042876	Ga0451577_0061815	Ga0451577_0061815_1152_1979	226
224	3300044712	Ga0453684_0526656	Ga0453684_0526656_243_1070	226
225	3300045051	Ga0451576_0436615	Ga0451576_0436615_201_926	226
226	3300048909	Ga0496106_0352254	Ga0496106_0352254_253_978	226
227	3300048912	Ga0496109_0392823	Ga0496109_0392823_400_1185	226
228	3300048913	Ga0496110_0105532	Ga0496110_0105532_1191_1922	226
229	3300048915	Ga0496112_0430554	Ga0496112_0430554_340_1065	226
230	3300049741	Ga0501079_0616049	Ga0501079_0616049_57_776	226
231	3300050507	nmdc:mga05p37_12967_c1	nmdc:mga05p37_12967_c1_1156_1881	226
232	3300050507	nmdc:mga05p37_212978_c1	nmdc:mga05p37_212978_c1_1579_2301	226
233	3300050507	nmdc:mga05p37_342101_c1	nmdc:mga05p37_342101_c1_664_1389	226
234	3300050508	nmdc:mga09592_234108_c1	nmdc:mga09592_234108_c1_575_1300	226
235	3300050511	nmdc:mga08y16_121687_c1	nmdc:mga08y16_121687_c1_1090_1812	226
236	3300050512	nmdc:mga0n895_36143_c1	nmdc:mga0n895_36143_c1_1738_2463	226
237	3300050513	nmdc:mga0rr50_3952_c1	nmdc:mga0rr50_3952_c1_6009_6734	226
238	3300050515	nmdc:mga0a205_17910_c1	nmdc:mga0a205_17910_c1_396_1121	226
239	3300050515	nmdc:mga0a205_64368_c1	nmdc:mga0a205_64368_c1_1598_2323	226
240	3300005290	Ga0065712_10146084	Ga0065712_101460841	227
241	3300005340	Ga0070689_100114328	Ga0070689_1001143283	227
242	3300005343	Ga0070687_100227935	Ga0070687_1002279351	227
243	3300005347	Ga0070668_100362897	Ga0070668_1003628972	227
244	3300005364	Ga0070673_100050250	Ga0070673_1000502503	227
245	3300005364	Ga0070673_100433260	Ga0070673_1004332601	227
246	3300005445	Ga0070708_100078166	Ga0070708_1000781661	227
247	3300005456	Ga0070678_100175428	Ga0070678_1001754282	227
248	3300005459	Ga0068867_100288455	Ga0068867_1002884551	227
249	3300005468	Ga0070707_100268025	Ga0070707_1002680251	227
250	3300005468	Ga0070707_100481183	Ga0070707_1004811831	227
251	3300005471	Ga0070698_100521516	Ga0070698_1005215162	227
252	3300005518	Ga0070699_100311683	Ga0070699_1003116832	227
253	3300005546	Ga0070696_100009618	Ga0070696_1000096182	227
254	3300005616	Ga0068852_100010895	Ga0068852_1000108954	227
255	3300005842	Ga0068858_100040705	Ga0068858_1000407055	227
256	3300006051	Ga0075364_10248834	Ga0075364_102488342	227
257	3300006195	Ga0075366_10102333	Ga0075366_101023332	227
258	3300006237	Ga0097621_100045067	Ga0097621_1000450673	227
259	3300006358	Ga0068871_100137646	Ga0068871_1001376462	227
260	3300006852	Ga0075433_10353716	Ga0075433_103537162	227
261	3300009098	Ga0105245_10330357	Ga0105245_103303572	227
262	3300009147	Ga0114129_10051521	Ga0114129_100515215	227
263	3300009176	Ga0105242_10083068	Ga0105242_100830683	227
264	3300009177	Ga0105248_10090276	Ga0105248_100902763	227
265	3300009177	Ga0105248_10533409	Ga0105248_105334091	227
266	3300013296	Ga0157374_10016820	Ga0157374_100168202	227
267	3300013308	Ga0157375_10101383	Ga0157375_101013833	227
268	3300014325	Ga0163163_10016181	Ga0163163_100161812	227
269	3300014968	Ga0157379_10034837	Ga0157379_100348374	227
270	3300014969	Ga0157376_10121304	Ga0157376_101213042	227
271	3300014969	Ga0157376_10146435	Ga0157376_101464352	227
272	3300017792	Ga0163161_10016387	Ga0163161_100163874	227
273	3300025907	Ga0207645_10074579	Ga0207645_100745792	227
274	3300025907	Ga0207645_10133537	Ga0207645_101335372	227
275	3300025922	Ga0207646_10153034	Ga0207646_101530343	227
276	3300025922	Ga0207646_10280299	Ga0207646_102802992	227
277	3300025927	Ga0207687_10535717	Ga0207687_105357171	227
278	3300025936	Ga0207670_10153415	Ga0207670_101534152	227
279	3300025941	Ga0207711_10025112	Ga0207711_100251122	227
280	3300025941	Ga0207711_10130646	Ga0207711_101306462	227
281	3300025941	Ga0207711_10534080	Ga0207711_105340802	227
282	3300025942	Ga0207689_10093473	Ga0207689_100934731	227
283	3300025942	Ga0207689_10479166	Ga0207689_104791661	227
284	3300025960	Ga0207651_10003845	Ga0207651_100038452	227
285	3300025961	Ga0207712_10139960	Ga0207712_101399602	227
286	3300025972	Ga0207668_10261075	Ga0207668_102610751	227
287	3300025986	Ga0207658_10133022	Ga0207658_101330222	227
288	3300026089	Ga0207648_10065068	Ga0207648_100650682	227
289	3300026142	Ga0207698_10186805	Ga0207698_101868051	227
290	3300028380	Ga0268265_10325031	Ga0268265_103250311	227
291	3300031995	Ga0307409_100421060	Ga0307409_1004210602	227
292	3300035170	Ga0373943_0039502	Ga0373943_0039502_124_861	227
293	3300041507	Ga0451851_1255796	Ga0451851_1255796_112_840	227
294	3300042876	Ga0451577_0633463	Ga0451577_0633463_73_891	227
295	3300044712	Ga0453684_0474529	Ga0453684_0474529_479_1297	227
296	3300048904	Ga0496101_0185922	Ga0496101_0185922_864_1592	227
297	3300048904	Ga0496101_0408211	Ga0496101_0408211_215_1018	227
298	3300048905	Ga0496102_0599428	Ga0496102_0599428_123_851	227
299	3300048907	Ga0496104_0069016	Ga0496104_0069016_25_753	227
300	3300048911	Ga0496108_0035939	Ga0496108_0035939_2166_2894	227
301	3300048912	Ga0496109_0256504	Ga0496109_0256504_116_844	227
302	3300048913	Ga0496110_0471651	Ga0496110_0471651_22_750	227
303	3300048917	Ga0496114_0088861	Ga0496114_0088861_669_1397	227
304	3300048917	Ga0496114_0092006	Ga0496114_0092006_674_1402	227
305	3300048918	Ga0496115_0171199	Ga0496115_0171199_832_1560	227
306	3300049581	Ga0501047_0014486	Ga0501047_0014486_3447_4223	227
307	3300049823	Ga0501044_0021367	Ga0501044_0021367_5168_5944	227
308	3300050491	nmdc:mga00v17_250234_c1	nmdc:mga00v17_250234_c1_94_831	227
309	3300050507	nmdc:mga05p37_240686_c1	nmdc:mga05p37_240686_c1_1331_2101	227
310	3300050514	nmdc:mga08x19_149174_c1	nmdc:mga08x19_149174_c1_172_909	227
311	3300059421	Ga0590071_000385	Ga0590071_000385_2753_3475	227
312	3300059424	Ga0590075_002015	Ga0590075_002015_2052_2774	227
313	3300059426	Ga0590077_001693	Ga0590077_001693_3390_4112	227
314	3300005353	Ga0070669_100259571	Ga0070669_1002595712	228
315	3300005354	Ga0070675_100007246	Ga0070675_1000072468	228
316	3300005354	Ga0070675_100599110	Ga0070675_1005991101	228
317	3300005367	Ga0070667_100215493	Ga0070667_1002154932	228
318	3300005545	Ga0070695_100067944	Ga0070695_1000679443	228
319	3300005844	Ga0068862_100032692	Ga0068862_1000326922	228
320	3300006237	Ga0097621_100247898	Ga0097621_1002478982	228
321	3300006931	Ga0097620_100050473	Ga0097620_1000504734	228
322	3300009553	Ga0105249_10302789	Ga0105249_103027892	228
323	3300025923	Ga0207681_10025150	Ga0207681_100251504	228
324	3300025925	Ga0207650_10176078	Ga0207650_101760782	228
325	3300025926	Ga0207659_10005077	Ga0207659_100050772	228
326	3300025940	Ga0207691_10072131	Ga0207691_100721313	228
327	3300025960	Ga0207651_10279058	Ga0207651_102790582	228
328	3300025981	Ga0207640_10669598	Ga0207640_106695981	228
329	3300026142	Ga0207698_10376140	Ga0207698_103761402	228
330	3300028380	Ga0268265_10216319	Ga0268265_102163192	228
331	3300032002	Ga0307416_100674263	Ga0307416_1006742631	228
332	3300041503	Ga0451847_0159406	Ga0451847_0159406_395_1126	228
333	3300041512	Ga0451853_0342525	Ga0451853_0342525_86_817	228
334	3300042156	Ga0439446_0019382	Ga0439446_0019382_824_1555	228
335	3300042436	Ga0439435_0002276	Ga0439435_0002276_1108_1839	228
336	3300046535	Ga0495586_0191721	Ga0495586_0191721_147_881	228
337	3300048915	Ga0496112_0332468	Ga0496112_0332468_457_1254	228
338	3300049576	Ga0501040_0376199	Ga0501040_0376199_149_880	228
339	3300049741	Ga0501079_0236865	Ga0501079_0236865_73_894	228
340	3300049824	Ga0501045_0522592	Ga0501045_0522592_134_865	228
341	3300061734	Ga0530510_0020356	Ga0530510_0020356_3586_4359	228
342	3300005288	Ga0065714_10101768	Ga0065714_101017681	229
343	3300005290	Ga0065712_10021174	Ga0065712_100211741	229
344	3300005293	Ga0065715_10263191	Ga0065715_102631911	229
345	3300005327	Ga0070658_10324614	Ga0070658_103246142	229
346	3300005330	Ga0070690_100005501	Ga0070690_1000055017	229
347	3300005331	Ga0070670_100019041	Ga0070670_1000190414	229
348	3300005340	Ga0070689_100005638	Ga0070689_1000056387	229
349	3300005340	Ga0070689_100299228	Ga0070689_1002992282	229
350	3300005344	Ga0070661_100108975	Ga0070661_1001089752	229
351	3300005347	Ga0070668_100210549	Ga0070668_1002105491	229
352	3300005354	Ga0070675_100060937	Ga0070675_1000609372	229
353	3300005356	Ga0070674_100048185	Ga0070674_1000481853	229
354	3300005364	Ga0070673_100044339	Ga0070673_1000443394	229
355	3300005365	Ga0070688_100027303	Ga0070688_1000273032	229
356	3300005455	Ga0070663_100017166	Ga0070663_1000171663	229
357	3300005456	Ga0070678_100195904	Ga0070678_1001959041	229
358	3300005543	Ga0070672_100104342	Ga0070672_1001043422	229
359	3300005543	Ga0070672_100213740	Ga0070672_1002137402	229
360	3300005544	Ga0070686_100013002	Ga0070686_1000130021	229
361	3300005548	Ga0070665_100935725	Ga0070665_1009357251	229
362	3300005564	Ga0070664_100026969	Ga0070664_1000269694	229
363	3300005577	Ga0068857_100179140	Ga0068857_1001791402	229
364	3300005617	Ga0068859_100013189	Ga0068859_1000131894	229
365	3300005617	Ga0068859_100793178	Ga0068859_1007931782	229
366	3300005618	Ga0068864_100005986	Ga0068864_1000059864	229
367	3300005840	Ga0068870_10168216	Ga0068870_101682162	229
368	3300005841	Ga0068863_100399664	Ga0068863_1003996641	229
369	3300005843	Ga0068860_100909441	Ga0068860_1009094411	229
370	3300005844	Ga0068862_100167721	Ga0068862_1001677212	229
371	3300006237	Ga0097621_100519716	Ga0097621_1005197161	229
372	3300006844	Ga0075428_100016389	Ga0075428_1000163894	229
373	3300006931	Ga0097620_100013189	Ga0097620_1000131896	229
374	3300006931	Ga0097620_100793317	Ga0097620_1007933172	229
375	3300009094	Ga0111539_10002890	Ga0111539_1000289020	229
376	3300009094	Ga0111539_10137553	Ga0111539_101375532	229
377	3300009147	Ga0114129_10083502	Ga0114129_100835025	229
378	3300013296	Ga0157374_10425646	Ga0157374_104256462	229
379	3300013306	Ga0163162_11294932	Ga0163162_112949321	229
380	3300013308	Ga0157375_10371873	Ga0157375_103718731	229
381	3300014325	Ga0163163_10018559	Ga0163163_100185595	229
382	3300014325	Ga0163163_10178313	Ga0163163_101783132	229
383	3300014745	Ga0157377_10081484	Ga0157377_100814842	229
384	3300025315	Ga0207697_10055689	Ga0207697_100556892	229
385	3300025908	Ga0207643_10126557	Ga0207643_101265572	229
386	3300025925	Ga0207650_10164012	Ga0207650_101640122	229
387	3300025925	Ga0207650_10169090	Ga0207650_101690902	229
388	3300025932	Ga0207690_10085049	Ga0207690_100850492	229
389	3300025936	Ga0207670_10258418	Ga0207670_102584182	229
390	3300025937	Ga0207669_10299759	Ga0207669_102997592	229
391	3300025940	Ga0207691_10001785	Ga0207691_100017856	229
392	3300025940	Ga0207691_10079503	Ga0207691_100795032	229
393	3300025940	Ga0207691_10121896	Ga0207691_101218963	229
394	3300025945	Ga0207679_10271114	Ga0207679_102711141	229
395	3300025960	Ga0207651_10007404	Ga0207651_100074043	229
396	3300026023	Ga0207677_10218676	Ga0207677_102186762	229
397	3300026067	Ga0207678_10048374	Ga0207678_100483743	229
398	3300026116	Ga0207674_10194634	Ga0207674_101946342	229
399	3300026118	Ga0207675_100489318	Ga0207675_1004893182	229
400	3300026121	Ga0207683_10701432	Ga0207683_107014321	229
401	3300027907	Ga0207428_10016438	Ga0207428_100164387	229
402	3300028380	Ga0268265_10070650	Ga0268265_100706503	229
403	3300028380	Ga0268265_10144213	Ga0268265_101442132	229
404	3300031548	Ga0307408_100013074	Ga0307408_1000130745	229
405	3300031548	Ga0307408_100071009	Ga0307408_1000710093	229
406	3300031731	Ga0307405_10089836	Ga0307405_100898362	229
407	3300031852	Ga0307410_10080106	Ga0307410_100801062	229
408	3300031903	Ga0307407_10022280	Ga0307407_100222803	229
409	3300031911	Ga0307412_10006209	Ga0307412_100062097	229
410	3300031911	Ga0307412_10308449	Ga0307412_103084492	229
411	3300031995	Ga0307409_100020189	Ga0307409_1000201893	229
412	3300032002	Ga0307416_100094808	Ga0307416_1000948082	229
413	3300032004	Ga0307414_10052238	Ga0307414_100522382	229
414	3300032126	Ga0307415_100000697	Ga0307415_1000006977	229
415	3300041486	Ga0451807_0859993	Ga0451807_0859993_19_756	229
416	3300046537	Ga0495598_0050939	Ga0495598_0050939_172_900	229
417	3300049578	Ga0501042_0381877	Ga0501042_0381877_231_959	229
418	3300050507	nmdc:mga05p37_260374_c2	nmdc:mga05p37_260374_c2_650_1384	229
419	3300050507	nmdc:mga05p37_3535_c2	nmdc:mga05p37_3535_c2_11129_11926	229
420	3300050509	nmdc:mga0qj67_549422_c1	nmdc:mga0qj67_549422_c1_180_914	229
421	3300050511	nmdc:mga08y16_1619_c1	nmdc:mga08y16_1619_c1_1149_1877	229
422	3300050511	nmdc:mga08y16_228026_c1	nmdc:mga08y16_228026_c1_522_1250	229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

101

228

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5kym-assembly2.cif.gz_B	crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima	0.8355	10	224
5kym-assembly1.cif.gz_A	crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima	0.7915	10	221
5kym-assembly2.cif.gz_B	crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima	0.7558	10	224
5kym-assembly1.cif.gz_A	crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima	0.7361	10	221
8e50-assembly1.cif.gz_A	cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa	0.6858	26	209

ID	Description	Score	Start	End	Superfamily
af_Q22267_77_205_3.40.50.2000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B;	0.8857	47	171	3.40.50.2000
af_P33333_55_242_3.40.1130.10	Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase	0.8791	39	221	3.40.1130.10
af_Q93841_73_201_3.40.50.620	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.8645	45	171	3.40.50.620
af_D4AC45_64_192_3.40.50.620	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.8623	45	171	3.40.50.620
af_Q8GXU8_180_307_3.40.50.2000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B;	0.8596	47	169	3.40.50.2000

ID	Description	Score	Start	End	GO Terms
AF-A0A1W9PYA0-F1-model_v4	1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)	0.9379	28	220	GO:0003841 GO:0006654 GO:0016020 GO:0016024
AF-A0A4R3L6U1-F1-model_v4	1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)	0.9317	12	225	GO:0003841 GO:0006654 GO:0016020 GO:0016024
AF-A0A7X4J0I2-F1-model_v4	1-acyl-sn-glycerol-3-phosphate acyltransferase	0.9268	15	224	GO:0003841 GO:0006654 GO:0016020
AF-A0A7C4EX89-F1-model_v4	1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)	0.9193	27	220	GO:0003841 GO:0006654 GO:0016020 GO:0016024
AF-A0A7C1SSD5-F1-model_v4	1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)	0.9184	12	225	GO:0003841 GO:0006654 GO:0016020 GO:0016024

Feature Viewer

pLDDT	pTM	Quality
84.69	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F440297

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01553

Acyltransferase

Acyltransferase

101

228

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map