F440294

General Info

Members Datasets Scaffolds Average Seq Length
422 213 422 260

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10027447|Ga0207665_100274471
Length 296
Sequence VTAGFVQIAGSSTARAASSGSCTGMPDAVRAIAARCAFFWSLATYRTRAFGSPTTTVRQLRQFRVVFPEGFTRAQMVARVQTVAKIAEQESHRKVKLSGTAYAAATAKRRTFPGFGPEKLPLEGFLFPDTYDFDRKSTSAQLVDDQLAEFDSEWSRLNLYARSKNLTPYDVLTIASMVEGEAQVPSERPLVAAVIYNRLHARMPLGIDATLRYGLHVPPTESLTQSDLQNPTPYNTRLHDGLPPTPINNPGMAALEAAAHPAHVDYLYFVRKPDHRHHYFTANYQDFLQHEAQYGY

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.27
Rhizosphere 86.49
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002619 3300003320 Bacteria 1914
2 Ga0070658_10058099 3300005327 Bacteria 3147
3 Ga0070683_100092821 3300005329 Bacteria 2835
4 Ga0070690_100063794 3300005330 Bacteria 2378
5 Ga0070680_100074347 3300005336 Bacteria 2796
6 Ga0070680_100079913 3300005336 Bacteria 2696
7 Ga0070682_100238640 3300005337 Bacteria 1304
8 Ga0070660_100125699 3300005339 Bacteria 2049
9 Ga0070691_10090806 3300005341 Bacteria 1505
10 Ga0070661_100017193 3300005344 Bacteria 5127
11 Ga0070692_10024902 3300005345 Bacteria 2945
12 Ga0070671_100183284 3300005355 Bacteria 1773
13 Ga0070659_100039140 3300005366 Bacteria 3700
14 Ga0070709_10298768 3300005434 Bacteria 1175
15 Ga0070714_100034451 3300005435 Bacteria 4240
16 Ga0070714_100055274 3300005435 Bacteria 3392
17 Ga0070714_100179200 3300005435 Bacteria 1927
18 Ga0070714_100410554 3300005435 Bacteria 1281
19 Ga0070713_100041335 3300005436 Bacteria 3756
20 Ga0070713_100137901 3300005436 Bacteria 2157
21 Ga0070713_100579032 3300005436 Unclassified 1065
22 Ga0070711_100077703 3300005439 Bacteria 2356
23 Ga0070700_100028676 3300005441 Bacteria 3313
24 Ga0070694_100102647 3300005444 Bacteria 2025
25 Ga0070708_100128736 3300005445 Bacteria 2342
26 Ga0070663_100229809 3300005455 Bacteria 1460
27 Ga0068867_100103695 3300005459 Bacteria 2175
28 Ga0070707_100001273 3300005468 Bacteria 24807
29 Ga0070679_100223764 3300005530 Bacteria 1842
30 Ga0070679_100257226 3300005530 Bacteria 1701
31 Ga0070684_100159066 3300005535 Bacteria 2049
32 Ga0068853_100230672 3300005539 Bacteria 1694
33 Ga0070686_100024493 3300005544 Bacteria 3618
34 Ga0070695_100000023 3300005545 Bacteria 60293
35 Ga0070696_100037181 3300005546 Bacteria 3357
36 Ga0070704_100119001 3300005549 Bacteria 2025
37 Ga0068857_100479817 3300005577 Bacteria 1165
38 Ga0068854_100055808 3300005578 Bacteria 2845
39 Ga0068856_100068626 3300005614 Bacteria 3505
40 Ga0068856_100250734 3300005614 Bacteria 1785
41 Ga0070702_100012665 3300005615 Bacteria 4235
42 Ga0070702_100174825 3300005615 Bacteria 1400
43 Ga0068852_100136315 3300005616 Bacteria 2267
44 Ga0068866_10038763 3300005718 Bacteria 2349
45 Ga0068860_100408958 3300005843 Bacteria 1343
46 Ga0070717_10064835 3300006028 Bacteria 3035
47 Ga0070717_10068031 3300006028 Bacteria 2964
48 Ga0070717_10088244 3300006028 Bacteria 2613
49 Ga0070715_10001412 3300006163 Bacteria 6955
50 Ga0070716_100008206 3300006173 Bacteria 5174
51 Ga0070712_100259533 3300006175 Bacteria 1392
52 Ga0070712_100317097 3300006175 Bacteria 1267
53 Ga0070712_100318769 3300006175 Bacteria 1263
54 Ga0075433_10154539 3300006852 Unclassified 2041
55 Ga0075434_100000658 3300006871 Bacteria 26789
56 Ga0068865_100076856 3300006881 Bacteria 2384
57 Ga0075436_100209962 3300006914 Unclassified 1380
58 Ga0105240_10045268 3300009093 Bacteria 5584
59 Ga0111539_10622896 3300009094 Unclassified 1256
60 Ga0105245_10158544 3300009098 Bacteria 2146
61 Ga0105245_10449326 3300009098 Bacteria 1297
62 Ga0105245_10493637 3300009098 Bacteria 1239
63 Ga0105243_10118046 3300009148 Bacteria 2231
64 Ga0105242_10050771 3300009176 Bacteria 3378
65 Ga0105242_10071510 3300009176 Bacteria 2879
66 Ga0105248_10091316 3300009177 Bacteria 3430
67 Ga0105248_10235571 3300009177 Bacteria 2061
68 Ga0105238_10201435 3300009551 Bacteria 1966
69 Ga0157374_10077705 3300013296 Bacteria 3142
70 Ga0163162_10264906 3300013306 Bacteria 1850
71 Ga0157372_10214990 3300013307 Bacteria 2228
72 Ga0157375_10413009 3300013308 Bacteria 1516
73 Ga0157380_10101016 3300014326 Bacteria 2402
74 Ga0157377_10260167 3300014745 Bacteria 1129
75 Ga0182007_10032324 3300015262 Bacteria 1777
76 Ga0206356_10924052 3300020070 Bacteria 1300
77 Ga0224712_10147637 3300022467 Bacteria 1040
78 Ga0207692_10002750 3300025898 Bacteria 6778
79 Ga0207642_10051944 3300025899 Bacteria 1857
80 Ga0207680_10148306 3300025903 Bacteria 1562
81 Ga0207685_10006220 3300025905 Bacteria 3232
82 Ga0207699_10023919 3300025906 Bacteria 3332
83 Ga0207699_10142745 3300025906 Bacteria 1575
84 Ga0207699_10356722 3300025906 Bacteria 1033
85 Ga0207705_10222743 3300025909 Bacteria 1433
86 Ga0207707_10059662 3300025912 Bacteria 3319
87 Ga0207707_10408385 3300025912 Bacteria 1165
88 Ga0207693_10000198 3300025915 Bacteria 54576
89 Ga0207693_10002750 3300025915 Bacteria 15234
90 Ga0207693_10201662 3300025915 Bacteria 1564
91 Ga0207693_10229663 3300025915 Unclassified 1457
92 Ga0207663_10012568 3300025916 Bacteria 4581
93 Ga0207660_10092387 3300025917 Bacteria 2246
94 Ga0207657_10090975 3300025919 Bacteria 2546
95 Ga0207657_10100047 3300025919 Bacteria 2408
96 Ga0207652_10189191 3300025921 Bacteria 1851
97 Ga0207652_10189529 3300025921 Bacteria 1850
98 Ga0207652_10267078 3300025921 Bacteria 1543
99 Ga0207652_10306816 3300025921 Bacteria 1433
100 Ga0207646_10004655 3300025922 Bacteria 14797
101 Ga0207694_10138436 3300025924 Bacteria 1956
102 Ga0207687_10156559 3300025927 Bacteria 1744
103 Ga0207700_10251063 3300025928 Bacteria 1511
104 Ga0207700_10542943 3300025928 Unclassified 1031
105 Ga0207664_10005271 3300025929 Bacteria 8832
106 Ga0207664_10019721 3300025929 Bacteria 4989
107 Ga0207664_10062624 3300025929 Bacteria 2971
108 Ga0207664_10184350 3300025929 Bacteria 1793
109 Ga0207644_10306861 3300025931 Bacteria 1280
110 Ga0207706_10011285 3300025933 Bacteria 8142
111 Ga0207686_10139006 3300025934 Bacteria 1676
112 Ga0207686_10258693 3300025934 Bacteria 1275
113 Ga0207709_10078658 3300025935 Bacteria 2118
114 Ga0207704_10355403 3300025938 Bacteria 1142
115 Ga0207665_10000197 3300025939 Bacteria 40246
116 Ga0207665_10027447 3300025939 Bacteria 3762
117 Ga0207661_10053811 3300025944 Bacteria 3223
118 Ga0207661_10057121 3300025944 Bacteria 3137
119 Ga0207661_10591583 3300025944 Bacteria 1018
120 Ga0207667_10184611 3300025949 Bacteria 2141
121 Ga0207640_10067583 3300025981 Bacteria 2392
122 Ga0207677_10161246 3300026023 Bacteria 1742
123 Ga0207677_10307271 3300026023 Bacteria 1312
124 Ga0207639_10556947 3300026041 Bacteria 1053
125 Ga0207708_10009298 3300026075 Bacteria 7276
126 Ga0207702_10134650 3300026078 Unclassified 2228
127 Ga0207702_10175004 3300026078 Bacteria 1971
128 Ga0207676_10069295 3300026095 Bacteria 2824
129 Ga0207675_100031924 3300026118 Bacteria 4907
130 Ga0207698_10138311 3300026142 Bacteria 2093
131 Ga0207698_10417109 3300026142 Bacteria 1287
132 Ga0207428_10343976 3300027907 Bacteria 1098
133 Ga0268265_10131489 3300028380 Bacteria 2081
134 Ga0268264_10054982 3300028381 Bacteria 3326
135 Ga0265318_10028732 3300028577 Bacteria 2173
136 Ga0265336_10007899 3300028666 Bacteria 3758
137 Ga0265338_10015845 3300028800 Bacteria 8252
138 Ga0265338_10059001 3300028800 Bacteria 3382
139 Ga0265338_10060618 3300028800 Bacteria 3323
140 Ga0265338_10148475 3300028800 Bacteria 1825
141 Ga0265325_10147291 3300031241 Archaea 1116
142 Ga0265339_10004983 3300031249 Bacteria 8940
143 Ga0265327_10014374 3300031251 Bacteria 5183
144 Ga0265327_10036784 3300031251 Bacteria 2687
145 Ga0265313_10025024 3300031595 Bacteria 3174
146 Ga0265314_10005893 3300031711 Bacteria 10961
147 Ga0265342_10116591 3300031712 Bacteria 1507
148 Ga0373926_0022931 3300035083 Bacteria 2166
149 Ga0373944_0000745 3300035089 Bacteria 7920
150 Ga0373945_0022073 3300035116 Bacteria 2190
151 Ga0373943_0003173 3300035170 Bacteria 7463
152 Ga0373943_0008965 3300035170 Bacteria 4484
153 Ga0373946_0009349 3300035171 Bacteria 3609
154 Ga0373924_0081138 3300035410 Bacteria 1380
155 Ga0373927_0180868 3300035695 Bacteria 1383
156 Ga0373947_0001279 3300035725 Bacteria 15509
157 Ga0373947_0006134 3300035725 Bacteria 6992
158 Ga0373937_0006653 3300036401 Bacteria 9974
159 Ga0373925_0001456 3300037068 Bacteria 20442
160 Ga0373925_0031307 3300037068 Bacteria 3908
161 Ga0395899_0004144 3300037312 Bacteria 11391
162 Ga0395900_0002083 3300037418 Bacteria 22427
163 Ga0395900_0153060 3300037418 Bacteria 2356
164 Ga0395898_0007988 3300037466 Bacteria 11225
165 Ga0395898_0010279 3300037466 Bacteria 9794
166 Ga0395898_0017353 3300037466 Bacteria 7353
167 Ga0395898_0060783 3300037466 Bacteria 3671
168 Ga0395905_0006934 3300037471 Bacteria 11329
169 Ga0395901_0000793 3300038443 Bacteria 35158
170 Ga0395901_0550241 3300038443 Bacteria 1169
171 Ga0436360_0893357 3300039438 Bacteria 2166
172 Ga0466969_0001820 3300044656 Bacteria 11388
173 Ga0466969_0118409 3300044656 Bacteria 1235
174 Ga0466969_0188085 3300044656 Bacteria 944
175 Ga0466965_0011872 3300044683 Bacteria 4090
176 Ga0466965_0048549 3300044683 Bacteria 2103
177 Ga0466966_0032230 3300044684 Bacteria 3398
178 Ga0466966_0034581 3300044684 Bacteria 3267
179 Ga0466966_0076416 3300044684 Bacteria 2091
180 Ga0466966_0091299 3300044684 Bacteria 1890
181 Ga0466961_0006902 3300044693 Bacteria 7223
182 Ga0466961_0107592 3300044693 Bacteria 1755
183 Ga0466961_0142307 3300044693 Bacteria 1501
184 Ga0466961_0210161 3300044693 Bacteria 1201
185 Ga0466963_0000518 3300044694 Bacteria 18034
186 Ga0466963_0003671 3300044694 Bacteria 8831
187 Ga0466963_0007134 3300044694 Bacteria 6659
188 Ga0466963_0009767 3300044694 Bacteria 5788
189 Ga0466963_0010487 3300044694 Bacteria 5610
190 Ga0466963_0032715 3300044694 Bacteria 3369
191 Ga0466963_0042630 3300044694 Bacteria 2980
192 Ga0466963_0043332 3300044694 Bacteria 2958
193 Ga0466963_0053273 3300044694 Bacteria 2686
194 Ga0466963_0154148 3300044694 Bacteria 1596
195 Ga0466964_0001506 3300044706 Bacteria 8002
196 Ga0466964_0003774 3300044706 Bacteria 5556
197 Ga0466964_0006409 3300044706 Bacteria 4385
198 Ga0466964_0019584 3300044706 Bacteria 2602
199 Ga0466964_0052725 3300044706 Bacteria 1672
200 Ga0466971_0004434 3300044719 Bacteria 6058
201 Ga0466971_0046625 3300044719 Bacteria 1948
202 Ga0466971_0058221 3300044719 Bacteria 1744
203 Ga0466971_0099862 3300044719 Bacteria 1333
204 Ga0466968_0011483 3300044735 Bacteria 3451
205 Ga0466968_0012530 3300044735 Bacteria 3322
206 Ga0466968_0030579 3300044735 Bacteria 2231
207 Ga0466968_0032179 3300044735 Bacteria 2180
208 Ga0466968_0036551 3300044735 Bacteria 2058
209 Ga0466970_0005115 3300044765 Bacteria 6477
210 Ga0466970_0131420 3300044765 Bacteria 1375
211 Ga0466957_0005617 3300044842 Bacteria 7050
212 Ga0466957_0093703 3300044842 Bacteria 1885
213 Ga0466957_0187506 3300044842 Bacteria 1353
214 Ga0466957_0601925 3300044842 Bacteria 769
215 Ga0466959_0009634 3300045049 Bacteria 6873
216 Ga0466959_0013448 3300045049 Bacteria 5931
217 Ga0466959_0018185 3300045049 Bacteria 5159
218 Ga0466959_0032823 3300045049 Bacteria 3842
219 Ga0466959_0082043 3300045049 Bacteria 2323
220 Ga0466959_0204948 3300045049 Bacteria 1372
221 Ga0466958_0001119 3300045836 Bacteria 12370
222 Ga0466958_0005138 3300045836 Bacteria 6995
223 Ga0466958_0016400 3300045836 Bacteria 4265
224 Ga0466958_0020512 3300045836 Bacteria 3855
225 Ga0466958_0026055 3300045836 Bacteria 3453
226 Ga0466958_0108674 3300045836 Bacteria 1730
227 Ga0466958_0224978 3300045836 Bacteria 1197
228 Ga0466967_0002011 3300045976 Bacteria 12384
229 Ga0466967_0002633 3300045976 Bacteria 11303
230 Ga0466967_0003534 3300045976 Bacteria 10229
231 Ga0466967_0012538 3300045976 Bacteria 6490
232 Ga0466967_0021821 3300045976 Bacteria 5210
233 Ga0466967_0041075 3300045976 Bacteria 3985
234 Ga0466967_0048323 3300045976 Bacteria 3714
235 Ga0466967_0131348 3300045976 Bacteria 2325
236 Ga0466967_0135298 3300045976 Bacteria 2291
237 Ga0466967_0173359 3300045976 Bacteria 2031
238 Ga0466967_0356466 3300045976 Bacteria 1416
239 Ga0466967_0485727 3300045976 Bacteria 1210
240 Ga0466967_0583096 3300045976 Bacteria 1102
241 Ga0495592_0000597 3300046454 Bacteria 25448
242 Ga0495592_0005696 3300046454 Bacteria 9216
243 Ga0495592_0106460 3300046454 Bacteria 1990
244 Ga0495603_0000450 3300046455 Bacteria 22609
245 Ga0495603_0013278 3300046455 Bacteria 4980
246 Ga0495629_0007112 3300046459 Bacteria 8244
247 Ga0495629_0265586 3300046459 Bacteria 1179
248 Ga0495641_0001513 3300046461 Bacteria 19794
249 Ga0495641_0005148 3300046461 Bacteria 8947
250 Ga0495641_0158417 3300046461 Bacteria 1012
251 Ga0495651_0000008 3300046462 Bacteria 156989
252 Ga0495651_0022741 3300046462 Bacteria 4873
253 Ga0495653_0000725 3300046463 Bacteria 25130
254 Ga0495653_0018297 3300046463 Bacteria 5693
255 Ga0495580_0006863 3300046472 Bacteria 9209
256 Ga0495580_0210642 3300046472 Bacteria 1337
257 Ga0495582_0000711 3300046473 Bacteria 18383
258 Ga0495582_0006254 3300046473 Bacteria 6636
259 Ga0495582_0010487 3300046473 Bacteria 5097
260 Ga0495639_0000520 3300046475 Bacteria 18060
261 Ga0495662_0006328 3300046476 Bacteria 5918
262 Ga0495662_0101936 3300046476 Bacteria 1404
263 Ga0495664_0002367 3300046477 Bacteria 10105
264 Ga0495664_0117524 3300046477 Bacteria 1607
265 Ga0495584_0031793 3300046491 Bacteria 2671
266 Ga0495594_0001436 3300046499 Bacteria 12355
267 Ga0495594_0019684 3300046499 Bacteria 3590
268 Ga0495607_0074846 3300046501 Bacteria 1878
269 Ga0495608_0000957 3300046511 Bacteria 20357
270 Ga0495608_0021667 3300046511 Bacteria 4411
271 Ga0495608_0214018 3300046511 Bacteria 1211
272 Ga0495618_0002854 3300046514 Bacteria 10943
273 Ga0495618_0088297 3300046514 Bacteria 1983
274 Ga0495628_0000105 3300046516 Bacteria 68159
275 Ga0495628_0030882 3300046516 Bacteria 4335
276 Ga0495628_0266475 3300046516 Bacteria 1275
277 Ga0495630_0001692 3300046517 Bacteria 15385
278 Ga0495630_0105121 3300046517 Bacteria 2137
279 Ga0495630_0411189 3300046517 Bacteria 1037
280 Ga0495644_0003055 3300046523 Bacteria 6626
281 Ga0495663_0011608 3300046525 Bacteria 2451
282 Ga0495666_0000272 3300046526 Bacteria 22361
283 Ga0495666_0015797 3300046526 Bacteria 3761
284 Ga0495652_0001221 3300046529 Bacteria 28813
285 Ga0495652_0052130 3300046529 Bacteria 3491
286 Ga0495652_0178785 3300046529 Bacteria 1630
287 Ga0495665_0001436 3300046531 Bacteria 12777
288 Ga0495640_0019015 3300046533 Bacteria 5079
289 Ga0495640_0023975 3300046533 Bacteria 4439
290 Ga0495587_0000048 3300046536 Bacteria 105358
291 Ga0495645_0000029 3300046543 Bacteria 113119
292 Ga0495645_0049780 3300046543 Bacteria 3051
293 Ga0495645_0068402 3300046543 Unclassified 2564
294 Ga0495645_0131449 3300046543 Bacteria 1753
295 Ga0495656_0072590 3300046615 Bacteria 1532
296 Ga0495634_0014004 3300046642 Bacteria 5790
297 Ga0495635_0012512 3300046663 Bacteria 5944
298 Ga0495635_0017299 3300046663 Bacteria 5036
299 Ga0495635_0033068 3300046663 Bacteria 3588
300 Ga0495635_0158161 3300046663 Bacteria 1542
301 Ga0495661_0069750 3300046665 Bacteria 2059
302 Ga0495588_0000857 3300046674 Bacteria 13453
303 Ga0495657_0089314 3300046675 Bacteria 1980
304 Ga0495657_0109638 3300046675 Bacteria 1750
305 Ga0495599_0000110 3300046678 Bacteria 55240
306 Ga0495599_0003982 3300046678 Bacteria 8700
307 Ga0495599_0104400 3300046678 Bacteria 1765
308 Ga0495623_0000379 3300046679 Bacteria 29118
309 Ga0495623_0052484 3300046679 Bacteria 2576
310 Ga0495646_0002891 3300046680 Bacteria 10637
311 Ga0495646_0021855 3300046680 Bacteria 4041
312 Ga0495646_0055229 3300046680 Unclassified 2386
313 Ga0495646_0134063 3300046680 Unclassified 1392
314 Ga0495647_0000245 3300046681 Bacteria 14888
315 Ga0495658_0000675 3300046683 Bacteria 18488
316 Ga0495658_0005244 3300046683 Bacteria 6380
317 Ga0495658_0173671 3300046683 Bacteria 1335
318 Ga0495658_0334604 3300046683 Bacteria 961
319 Ga0495613_0006283 3300046689 Bacteria 8885
320 Ga0495613_0061151 3300046689 Bacteria 2758
321 Ga0495624_0008345 3300046690 Bacteria 7232
322 Ga0495670_0084327 3300046691 Bacteria 1621
323 Ga0495589_0231088 3300046794 Bacteria 867
324 Ga0495600_0115302 3300046809 Bacteria 1749
325 Ga0495600_0127944 3300046809 Bacteria 1651
326 Ga0495581_0002214 3300047315 Bacteria 10948
327 Ga0495604_0000687 3300047317 Bacteria 28670
328 Ga0495604_0110332 3300047317 Bacteria 2007
329 Ga0495636_0123016 3300047318 Bacteria 1149
330 Ga0495674_0019362 3300047319 Bacteria 6316
331 Ga0495674_0752078 3300047319 Bacteria 761
332 Ga0495676_0000602 3300047321 Bacteria 29783
333 Ga0495676_0019704 3300047321 Bacteria 5930
334 Ga0495676_0173647 3300047321 Bacteria 1515
335 Ga0495676_0308307 3300047321 Bacteria 1066
336 Ga0495680_0016904 3300047322 Bacteria 6247
337 Ga0495680_0054513 3300047322 Bacteria 3104
338 Ga0495680_0080700 3300047322 Bacteria 2458
339 Ga0495680_0268779 3300047322 Bacteria 1204
340 Ga0495675_0000419 3300047444 Bacteria 28791
341 Ga0495675_0159486 3300047444 Bacteria 1389
342 Ga0495684_0033445 3300047471 Bacteria 3942
343 Ga0495593_0000863 3300047673 Bacteria 17564
344 Ga0495602_0001409 3300048088 Bacteria 23791
345 Ga0495602_0107451 3300048088 Bacteria 2274
346 Ga0495602_0158333 3300048088 Bacteria 1771
347 Ga0495602_0244323 3300048088 Bacteria 1341
348 Ga0495614_0000132 3300048089 Bacteria 26286
349 Ga0496100_0015416 3300048903 Bacteria 4463
350 Ga0496100_0178555 3300048903 Bacteria 1534
351 Ga0496101_0023909 3300048904 Bacteria 4224
352 Ga0496101_0060651 3300048904 Bacteria 2745
353 Ga0496101_0076021 3300048904 Bacteria 2473
354 Ga0496101_0105705 3300048904 Unclassified 2113
355 Ga0496102_0005223 3300048905 Bacteria 11027
356 Ga0496102_0031913 3300048905 Bacteria 4729
357 Ga0496102_0393602 3300048905 Bacteria 1303
358 Ga0496102_0707407 3300048905 Unclassified 930
359 Ga0496103_0011456 3300048906 Bacteria 5256
360 Ga0496103_0082527 3300048906 Bacteria 2023
361 Ga0496104_0000977 3300048907 Bacteria 24462
362 Ga0496104_0183359 3300048907 Bacteria 2003
363 Ga0496104_0199570 3300048907 Unclassified 1912
364 Ga0496104_0214751 3300048907 Unclassified 1835
365 Ga0496104_0450847 3300048907 Bacteria 1198
366 Ga0496105_0000926 3300048908 Bacteria 19982
367 Ga0496105_0002654 3300048908 Bacteria 13026
368 Ga0496105_0006724 3300048908 Bacteria 8845
369 Ga0496105_0044751 3300048908 Bacteria 3651
370 Ga0496105_0250294 3300048908 Bacteria 1436
371 Ga0496106_0015040 3300048909 Bacteria 5726
372 Ga0496106_0021116 3300048909 Bacteria 4834
373 Ga0496107_0002059 3300048910 Bacteria 12861
374 Ga0496107_0054403 3300048910 Bacteria 2888
375 Ga0496107_0155304 3300048910 Bacteria 1694
376 Ga0496108_0000272 3300048911 Bacteria 44414
377 Ga0496108_0009090 3300048911 Bacteria 8046
378 Ga0496108_0026913 3300048911 Bacteria 4746
379 Ga0496109_0000857 3300048912 Bacteria 25402
380 Ga0496109_0001789 3300048912 Bacteria 17869
381 Ga0496109_0033432 3300048912 Bacteria 4626
382 Ga0496109_0101175 3300048912 Bacteria 2674
383 Ga0496109_0164918 3300048912 Bacteria 2077
384 Ga0496109_0350589 3300048912 Bacteria 1394
385 Ga0496110_0001545 3300048913 Bacteria 16749
386 Ga0496110_0043887 3300048913 Bacteria 3904
387 Ga0496110_0136621 3300048913 Unclassified 2216
388 Ga0496111_0001182 3300048914 Bacteria 14531
389 Ga0496111_0036168 3300048914 Bacteria 3530
390 Ga0496112_0104556 3300048915 Bacteria 2801
391 Ga0496112_0446193 3300048915 Bacteria 1232
392 Ga0496113_0000040 3300048916 Bacteria 55517
393 Ga0496113_0024226 3300048916 Bacteria 4310
394 Ga0496113_0087826 3300048916 Bacteria 2391
395 Ga0496114_0005892 3300048917 Bacteria 9631
396 Ga0496114_0007326 3300048917 Bacteria 8714
397 Ga0496114_0018200 3300048917 Bacteria 5677
398 Ga0496114_0045607 3300048917 Bacteria 3642
399 Ga0496114_0162039 3300048917 Bacteria 1945
400 Ga0496115_0003551 3300048918 Bacteria 11223
401 Ga0496115_0010558 3300048918 Bacteria 6905
402 Ga0496115_0068569 3300048918 Bacteria 2872
403 Ga0496115_0177084 3300048918 Bacteria 1763
404 Ga0496115_0341672 3300048918 Bacteria 1222
405 Ga0501067_0043622 3300049583 Bacteria 2491
406 Ga0501069_0030406 3300049585 Bacteria 2965
407 Ga0501069_0086386 3300049585 Unclassified 1771
408 Ga0501070_0001183 3300049586 Bacteria 23311
409 nmdc:mga0n895_7957_c1 3300050512 Bacteria 9142
410 nmdc:mga0a205_190057_c1 3300050515 Unclassified 1946
411 Ga0495601_0000340 3300053077 Bacteria 24567
412 Ga0495601_0021067 3300053077 Bacteria 3988
413 Ga0495612_0010731 3300053078 Bacteria 3699
414 Ga0495612_0014591 3300053078 Bacteria 3158
415 Ga0495612_0026566 3300053078 Unclassified 2326
416 Ga0495595_0008985 3300053084 Bacteria 4123
417 Ga0495619_0001752 3300053085 Bacteria 14426
418 Ga0495619_0009906 3300053085 Bacteria 6004
419 Ga0466962_0003363 3300061719 Bacteria 7608
420 Ga0466962_0007664 3300061719 Bacteria 5172
421 Ga0466962_0041062 3300061719 Bacteria 2214
422 Ga0466962_0081444 3300061719 Bacteria 1548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0752078 Ga0495674_0752078_49_717 222
2 3300044842 Ga0466957_0601925 Ga0466957_0601925_21_692 223
3 3300009098 Ga0105245_10449326 Ga0105245_104493262 234
4 3300025915 Ga0207693_10229663 Ga0207693_102296631 235
5 3300028800 Ga0265338_10015845 Ga0265338_100158456 235
6 3300037466 Ga0395898_0007988 Ga0395898_0007988_2099_3001 235
7 3300044684 Ga0466966_0076416 Ga0466966_0076416_745_1635 235
8 3300044693 Ga0466961_0107592 Ga0466961_0107592_188_1078 235
9 3300044706 Ga0466964_0006409 Ga0466964_0006409_285_1175 235
10 3300044719 Ga0466971_0058221 Ga0466971_0058221_368_1258 235
11 3300044765 Ga0466970_0131420 Ga0466970_0131420_358_1248 235
12 3300044842 Ga0466957_0093703 Ga0466957_0093703_337_1227 235
13 3300045049 Ga0466959_0082043 Ga0466959_0082043_1254_2144 235
14 3300045836 Ga0466958_0005138 Ga0466958_0005138_5240_6130 235
15 3300045836 Ga0466958_0108674 Ga0466958_0108674_107_997 235
16 3300045976 Ga0466967_0135298 Ga0466967_0135298_920_1810 235
17 3300045976 Ga0466967_0173359 Ga0466967_0173359_266_1141 235
18 3300047321 Ga0495676_0173647 Ga0495676_0173647_540_1388 235
19 3300048907 Ga0496104_0450847 Ga0496104_0450847_222_1106 235
20 3300061719 Ga0466962_0041062 Ga0466962_0041062_71_961 235
21 3300046794 Ga0495589_0231088 Ga0495589_0231088_17_808 236
22 3300005327 Ga0070658_10058099 Ga0070658_100580993 237
23 3300009176 Ga0105242_10071510 Ga0105242_100715103 237
24 3300015262 Ga0182007_10032324 Ga0182007_100323242 237
25 3300025934 Ga0207686_10258693 Ga0207686_102586932 237
26 3300028577 Ga0265318_10028732 Ga0265318_100287323 237
27 3300031241 Ga0265325_10147291 Ga0265325_101472912 237
28 3300031712 Ga0265342_10116591 Ga0265342_101165912 237
29 3300037418 Ga0395900_0153060 Ga0395900_0153060_17_844 237
30 3300037466 Ga0395898_0060783 Ga0395898_0060783_1058_1885 237
31 3300046491 Ga0495584_0031793 Ga0495584_0031793_844_1668 237
32 3300046501 Ga0495607_0074846 Ga0495607_0074846_315_1139 237
33 3300046615 Ga0495656_0072590 Ga0495656_0072590_319_1143 237
34 3300048904 Ga0496101_0060651 Ga0496101_0060651_1220_2131 237
35 3300048905 Ga0496102_0031913 Ga0496102_0031913_2405_3316 237
36 3300048909 Ga0496106_0021116 Ga0496106_0021116_2980_3891 237
37 3300048910 Ga0496107_0054403 Ga0496107_0054403_1033_1944 237
38 3300048917 Ga0496114_0007326 Ga0496114_0007326_3292_4203 237
39 3300014326 Ga0157380_10101016 Ga0157380_101010162 238
40 3300025944 Ga0207661_10053811 Ga0207661_100538113 238
41 3300028800 Ga0265338_10060618 Ga0265338_100606183 238
42 3300037068 Ga0373925_0031307 Ga0373925_0031307_3089_3898 238
43 3300049586 Ga0501070_0001183 Ga0501070_0001183_3091_3999 238
44 3300031595 Ga0265313_10025024 Ga0265313_100250243 239
45 3300044684 Ga0466966_0091299 Ga0466966_0091299_25_912 239
46 3300044694 Ga0466963_0009767 Ga0466963_0009767_3010_3834 239
47 3300044706 Ga0466964_0019584 Ga0466964_0019584_325_1149 239
48 3300045049 Ga0466959_0032823 Ga0466959_0032823_1243_2130 239
49 3300045836 Ga0466958_0016400 Ga0466958_0016400_3314_4201 239
50 3300048088 Ga0495602_0244323 Ga0495602_0244323_143_955 239
51 3300061719 Ga0466962_0003363 Ga0466962_0003363_6036_6923 239
52 3300005330 Ga0070690_100063794 Ga0070690_1000637943 240
53 3300005336 Ga0070680_100079913 Ga0070680_1000799132 240
54 3300005339 Ga0070660_100125699 Ga0070660_1001256993 240
55 3300005341 Ga0070691_10090806 Ga0070691_100908062 240
56 3300005345 Ga0070692_10024902 Ga0070692_100249022 240
57 3300005441 Ga0070700_100028676 Ga0070700_1000286763 240
58 3300005455 Ga0070663_100229809 Ga0070663_1002298093 240
59 3300005459 Ga0068867_100103695 Ga0068867_1001036952 240
60 3300005539 Ga0068853_100230672 Ga0068853_1002306722 240
61 3300005544 Ga0070686_100024493 Ga0070686_1000244933 240
62 3300005546 Ga0070696_100037181 Ga0070696_1000371813 240
63 3300005578 Ga0068854_100055808 Ga0068854_1000558083 240
64 3300005615 Ga0070702_100012665 Ga0070702_1000126653 240
65 3300005616 Ga0068852_100136315 Ga0068852_1001363153 240
66 3300005718 Ga0068866_10038763 Ga0068866_100387633 240
67 3300005843 Ga0068860_100408958 Ga0068860_1004089582 240
68 3300006175 Ga0070712_100259533 Ga0070712_1002595332 240
69 3300006175 Ga0070712_100318769 Ga0070712_1003187692 240
70 3300006881 Ga0068865_100076856 Ga0068865_1000768563 240
71 3300009098 Ga0105245_10158544 Ga0105245_101585441 240
72 3300009148 Ga0105243_10118046 Ga0105243_101180463 240
73 3300009176 Ga0105242_10050771 Ga0105242_100507712 240
74 3300013306 Ga0163162_10264906 Ga0163162_102649062 240
75 3300013308 Ga0157375_10413009 Ga0157375_104130092 240
76 3300025899 Ga0207642_10051944 Ga0207642_100519442 240
77 3300025903 Ga0207680_10148306 Ga0207680_101483062 240
78 3300025906 Ga0207699_10142745 Ga0207699_101427452 240
79 3300025915 Ga0207693_10000198 Ga0207693_1000019813 240
80 3300025919 Ga0207657_10090975 Ga0207657_100909752 240
81 3300025921 Ga0207652_10267078 Ga0207652_102670782 240
82 3300025927 Ga0207687_10156559 Ga0207687_101565593 240
83 3300025933 Ga0207706_10011285 Ga0207706_100112853 240
84 3300025934 Ga0207686_10139006 Ga0207686_101390062 240
85 3300025935 Ga0207709_10078658 Ga0207709_100786583 240
86 3300025938 Ga0207704_10355403 Ga0207704_103554032 240
87 3300025981 Ga0207640_10067583 Ga0207640_100675832 240
88 3300026023 Ga0207677_10161246 Ga0207677_101612462 240
89 3300026041 Ga0207639_10556947 Ga0207639_105569472 240
90 3300026075 Ga0207708_10009298 Ga0207708_100092983 240
91 3300026118 Ga0207675_100031924 Ga0207675_1000319243 240
92 3300026142 Ga0207698_10417109 Ga0207698_104171091 240
93 3300028380 Ga0268265_10131489 Ga0268265_101314892 240
94 3300028381 Ga0268264_10054982 Ga0268264_100549822 240
95 3300028800 Ga0265338_10059001 Ga0265338_100590014 240
96 3300031249 Ga0265339_10004983 Ga0265339_100049839 240
97 3300031711 Ga0265314_10005893 Ga0265314_100058939 240
98 3300035089 Ga0373944_0000745 Ga0373944_0000745_19_867 240
99 3300035116 Ga0373945_0022073 Ga0373945_0022073_165_1013 240
100 3300035170 Ga0373943_0008965 Ga0373943_0008965_3568_4416 240
101 3300035171 Ga0373946_0009349 Ga0373946_0009349_1344_2192 240
102 3300035725 Ga0373947_0006134 Ga0373947_0006134_5071_5919 240
103 3300039438 Ga0436360_0893357 Ga0436360_0893357_14_835 240
104 3300044656 Ga0466969_0001820 Ga0466969_0001820_4851_5684 240
105 3300044684 Ga0466966_0034581 Ga0466966_0034581_1909_2742 240
106 3300044693 Ga0466961_0210161 Ga0466961_0210161_297_1130 240
107 3300044694 Ga0466963_0000518 Ga0466963_0000518_16334_17167 240
108 3300044694 Ga0466963_0003671 Ga0466963_0003671_7148_8041 240
109 3300044719 Ga0466971_0099862 Ga0466971_0099862_31_864 240
110 3300044735 Ga0466968_0012530 Ga0466968_0012530_1494_2327 240
111 3300044765 Ga0466970_0005115 Ga0466970_0005115_526_1359 240
112 3300044842 Ga0466957_0005617 Ga0466957_0005617_6271_7038 240
113 3300045049 Ga0466959_0018185 Ga0466959_0018185_2035_2868 240
114 3300045836 Ga0466958_0020512 Ga0466958_0020512_20_907 240
115 3300045976 Ga0466967_0002011 Ga0466967_0002011_4768_5661 240
116 3300045976 Ga0466967_0041075 Ga0466967_0041075_2881_3774 240
117 3300046455 Ga0495603_0000450 Ga0495603_0000450_5202_6050 240
118 3300046461 Ga0495641_0005148 Ga0495641_0005148_6349_7197 240
119 3300046472 Ga0495580_0210642 Ga0495580_0210642_402_1250 240
120 3300046473 Ga0495582_0006254 Ga0495582_0006254_932_1780 240
121 3300046499 Ga0495594_0001436 Ga0495594_0001436_6197_7045 240
122 3300046526 Ga0495666_0015797 Ga0495666_0015797_1286_2134 240
123 3300046674 Ga0495588_0000857 Ga0495588_0000857_6474_7322 240
124 3300046683 Ga0495658_0005244 Ga0495658_0005244_571_1419 240
125 3300047321 Ga0495676_0000602 Ga0495676_0000602_5525_6373 240
126 3300048906 Ga0496103_0082527 Ga0496103_0082527_70_918 240
127 3300048918 Ga0496115_0341672 Ga0496115_0341672_87_920 240
128 3300061719 Ga0466962_0081444 Ga0466962_0081444_119_952 240
129 3300005329 Ga0070683_100092821 Ga0070683_1000928213 241
130 3300005355 Ga0070671_100183284 Ga0070671_1001832842 241
131 3300005434 Ga0070709_10298768 Ga0070709_102987681 241
132 3300005435 Ga0070714_100055274 Ga0070714_1000552742 241
133 3300005436 Ga0070713_100041335 Ga0070713_1000413352 241
134 3300005439 Ga0070711_100077703 Ga0070711_1000777032 241
135 3300005445 Ga0070708_100128736 Ga0070708_1001287363 241
136 3300005535 Ga0070684_100159066 Ga0070684_1001590662 241
137 3300005549 Ga0070704_100119001 Ga0070704_1001190012 241
138 3300005614 Ga0068856_100068626 Ga0068856_1000686263 241
139 3300006028 Ga0070717_10064835 Ga0070717_100648352 241
140 3300006163 Ga0070715_10001412 Ga0070715_100014124 241
141 3300006173 Ga0070716_100008206 Ga0070716_1000082063 241
142 3300009177 Ga0105248_10091316 Ga0105248_100913162 241
143 3300013296 Ga0157374_10077705 Ga0157374_100777052 241
144 3300020070 Ga0206356_10924052 Ga0206356_109240522 241
145 3300025898 Ga0207692_10002750 Ga0207692_100027504 241
146 3300025905 Ga0207685_10006220 Ga0207685_100062203 241
147 3300025906 Ga0207699_10023919 Ga0207699_100239193 241
148 3300025915 Ga0207693_10002750 Ga0207693_1000275018 241
149 3300025916 Ga0207663_10012568 Ga0207663_100125683 241
150 3300025919 Ga0207657_10100047 Ga0207657_101000474 241
151 3300025924 Ga0207694_10138436 Ga0207694_101384361 241
152 3300025928 Ga0207700_10251063 Ga0207700_102510632 241
153 3300025929 Ga0207664_10019721 Ga0207664_100197213 241
154 3300025931 Ga0207644_10306861 Ga0207644_103068612 241
155 3300025939 Ga0207665_10000197 Ga0207665_1000019735 241
156 3300025949 Ga0207667_10184611 Ga0207667_101846112 241
157 3300026078 Ga0207702_10175004 Ga0207702_101750042 241
158 3300028800 Ga0265338_10148475 Ga0265338_101484752 241
159 3300031251 Ga0265327_10014374 Ga0265327_100143744 241
160 3300036401 Ga0373937_0006653 Ga0373937_0006653_2596_3486 241
161 3300037466 Ga0395898_0017353 Ga0395898_0017353_539_1429 241
162 3300044656 Ga0466969_0188085 Ga0466969_0188085_59_877 241
163 3300044683 Ga0466965_0048549 Ga0466965_0048549_10_828 241
164 3300044684 Ga0466966_0032230 Ga0466966_0032230_1553_2371 241
165 3300044693 Ga0466961_0006902 Ga0466961_0006902_826_1644 241
166 3300044694 Ga0466963_0043332 Ga0466963_0043332_2000_2836 241
167 3300044694 Ga0466963_0053273 Ga0466963_0053273_1588_2475 241
168 3300044735 Ga0466968_0036551 Ga0466968_0036551_384_1202 241
169 3300045049 Ga0466959_0009634 Ga0466959_0009634_5660_6478 241
170 3300045976 Ga0466967_0356466 Ga0466967_0356466_270_1088 241
171 3300046454 Ga0495592_0000597 Ga0495592_0000597_15471_16361 241
172 3300046455 Ga0495603_0013278 Ga0495603_0013278_1622_2446 241
173 3300046461 Ga0495641_0158417 Ga0495641_0158417_56_880 241
174 3300046462 Ga0495651_0000008 Ga0495651_0000008_146991_147881 241
175 3300046463 Ga0495653_0000725 Ga0495653_0000725_15414_16304 241
176 3300046511 Ga0495608_0000957 Ga0495608_0000957_10685_11575 241
177 3300046514 Ga0495618_0002854 Ga0495618_0002854_374_1264 241
178 3300046514 Ga0495618_0088297 Ga0495618_0088297_1079_1894 241
179 3300046516 Ga0495628_0000105 Ga0495628_0000105_9463_10353 241
180 3300046529 Ga0495652_0001221 Ga0495652_0001221_12462_13352 241
181 3300046533 Ga0495640_0019015 Ga0495640_0019015_2085_2909 241
182 3300046536 Ga0495587_0000048 Ga0495587_0000048_12463_13353 241
183 3300046543 Ga0495645_0000029 Ga0495645_0000029_99767_100657 241
184 3300046675 Ga0495657_0109638 Ga0495657_0109638_685_1575 241
185 3300046678 Ga0495599_0000110 Ga0495599_0000110_12462_13352 241
186 3300046679 Ga0495623_0000379 Ga0495623_0000379_15799_16689 241
187 3300046680 Ga0495646_0002891 Ga0495646_0002891_5633_6523 241
188 3300046683 Ga0495658_0334604 Ga0495658_0334604_31_855 241
189 3300046689 Ga0495613_0061151 Ga0495613_0061151_1844_2668 241
190 3300046809 Ga0495600_0127944 Ga0495600_0127944_276_1166 241
191 3300047317 Ga0495604_0000687 Ga0495604_0000687_15337_16227 241
192 3300047322 Ga0495680_0080700 Ga0495680_0080700_648_1472 241
193 3300047444 Ga0495675_0000419 Ga0495675_0000419_12448_13338 241
194 3300048088 Ga0495602_0001409 Ga0495602_0001409_8805_9695 241
195 3300048903 Ga0496100_0015416 Ga0496100_0015416_367_1173 241
196 3300048903 Ga0496100_0178555 Ga0496100_0178555_600_1391 241
197 3300048904 Ga0496101_0023909 Ga0496101_0023909_2151_2957 241
198 3300048905 Ga0496102_0005223 Ga0496102_0005223_8566_9372 241
199 3300048906 Ga0496103_0011456 Ga0496103_0011456_1444_2250 241
200 3300048907 Ga0496104_0183359 Ga0496104_0183359_916_1722 241
201 3300048907 Ga0496104_0199570 Ga0496104_0199570_62_910 241
202 3300048908 Ga0496105_0006724 Ga0496105_0006724_4789_5595 241
203 3300048909 Ga0496106_0015040 Ga0496106_0015040_1835_2641 241
204 3300048910 Ga0496107_0002059 Ga0496107_0002059_9679_10485 241
205 3300048911 Ga0496108_0009090 Ga0496108_0009090_3033_3839 241
206 3300048912 Ga0496109_0101175 Ga0496109_0101175_1076_1882 241
207 3300048913 Ga0496110_0043887 Ga0496110_0043887_2929_3735 241
208 3300048914 Ga0496111_0036168 Ga0496111_0036168_863_1747 241
209 3300048915 Ga0496112_0104556 Ga0496112_0104556_474_1280 241
210 3300048916 Ga0496113_0024226 Ga0496113_0024226_1875_2681 241
211 3300048917 Ga0496114_0045607 Ga0496114_0045607_2617_3423 241
212 3300048918 Ga0496115_0010558 Ga0496115_0010558_4805_5611 241
213 3300053077 Ga0495601_0000340 Ga0495601_0000340_14590_15480 241
214 3300053078 Ga0495612_0014591 Ga0495612_0014591_73_963 241
215 3300053085 Ga0495619_0001752 Ga0495619_0001752_8973_9863 241
216 3300005436 Ga0070713_100137901 Ga0070713_1001379013 242
217 3300005577 Ga0068857_100479817 Ga0068857_1004798172 242
218 3300006914 Ga0075436_100209962 Ga0075436_1002099622 242
219 3300025906 Ga0207699_10356722 Ga0207699_103567222 242
220 3300025929 Ga0207664_10005271 Ga0207664_100052718 242
221 3300025939 Ga0207665_10027447 Ga0207665_100274471 242
222 3300026023 Ga0207677_10307271 Ga0207677_103072713 242
223 3300028666 Ga0265336_10007899 Ga0265336_100078994 242
224 3300031251 Ga0265327_10036784 Ga0265327_100367843 242
225 3300035083 Ga0373926_0022931 Ga0373926_0022931_1067_1957 242
226 3300035170 Ga0373943_0003173 Ga0373943_0003173_5274_6164 242
227 3300035695 Ga0373927_0180868 Ga0373927_0180868_300_1190 242
228 3300035725 Ga0373947_0001279 Ga0373947_0001279_9453_10343 242
229 3300037068 Ga0373925_0001456 Ga0373925_0001456_7925_8815 242
230 3300038443 Ga0395901_0550241 Ga0395901_0550241_15_902 242
231 3300044656 Ga0466969_0118409 Ga0466969_0118409_95_988 242
232 3300044683 Ga0466965_0011872 Ga0466965_0011872_1236_2129 242
233 3300044694 Ga0466963_0007134 Ga0466963_0007134_2264_3157 242
234 3300044694 Ga0466963_0154148 Ga0466963_0154148_637_1464 242
235 3300044706 Ga0466964_0052725 Ga0466964_0052725_173_1066 242
236 3300044719 Ga0466971_0004434 Ga0466971_0004434_2962_3855 242
237 3300044735 Ga0466968_0011483 Ga0466968_0011483_354_1241 242
238 3300044735 Ga0466968_0032179 Ga0466968_0032179_231_1124 242
239 3300045049 Ga0466959_0013448 Ga0466959_0013448_40_933 242
240 3300045836 Ga0466958_0026055 Ga0466958_0026055_922_1815 242
241 3300046459 Ga0495629_0007112 Ga0495629_0007112_6778_7668 242
242 3300046461 Ga0495641_0001513 Ga0495641_0001513_13179_14069 242
243 3300046463 Ga0495653_0018297 Ga0495653_0018297_3325_4215 242
244 3300046472 Ga0495580_0006863 Ga0495580_0006863_4716_5606 242
245 3300046473 Ga0495582_0000711 Ga0495582_0000711_8326_9216 242
246 3300046475 Ga0495639_0000520 Ga0495639_0000520_8751_9641 242
247 3300046476 Ga0495662_0006328 Ga0495662_0006328_4109_4999 242
248 3300046477 Ga0495664_0002367 Ga0495664_0002367_8296_9186 242
249 3300046499 Ga0495594_0019684 Ga0495594_0019684_905_1795 242
250 3300046517 Ga0495630_0001692 Ga0495630_0001692_5346_6236 242
251 3300046526 Ga0495666_0000272 Ga0495666_0000272_11983_12873 242
252 3300046531 Ga0495665_0001436 Ga0495665_0001436_7612_8502 242
253 3300046642 Ga0495634_0014004 Ga0495634_0014004_3981_4871 242
254 3300046663 Ga0495635_0012512 Ga0495635_0012512_1048_1938 242
255 3300046680 Ga0495646_0055229 Ga0495646_0055229_209_1099 242
256 3300046681 Ga0495647_0000245 Ga0495647_0000245_10053_10943 242
257 3300046683 Ga0495658_0000675 Ga0495658_0000675_7155_8045 242
258 3300046689 Ga0495613_0006283 Ga0495613_0006283_4109_4999 242
259 3300046690 Ga0495624_0008345 Ga0495624_0008345_1048_1938 242
260 3300047315 Ga0495581_0002214 Ga0495581_0002214_1048_1938 242
261 3300047319 Ga0495674_0019362 Ga0495674_0019362_3540_4430 242
262 3300047321 Ga0495676_0019704 Ga0495676_0019704_1300_2190 242
263 3300047673 Ga0495593_0000863 Ga0495593_0000863_9018_9908 242
264 3300048089 Ga0495614_0000132 Ga0495614_0000132_15794_16684 242
265 3300048912 Ga0496109_0164918 Ga0496109_0164918_604_1422 242
266 3300053078 Ga0495612_0026566 Ga0495612_0026566_1022_1912 242
267 3300053085 Ga0495619_0009906 Ga0495619_0009906_1390_2280 242
268 3300005336 Ga0070680_100074347 Ga0070680_1000743474 243
269 3300005337 Ga0070682_100238640 Ga0070682_1002386402 243
270 3300005344 Ga0070661_100017193 Ga0070661_1000171932 243
271 3300005366 Ga0070659_100039140 Ga0070659_1000391405 243
272 3300005435 Ga0070714_100034451 Ga0070714_1000344514 243
273 3300005435 Ga0070714_100179200 Ga0070714_1001792002 243
274 3300005435 Ga0070714_100410554 Ga0070714_1004105542 243
275 3300005468 Ga0070707_100001273 Ga0070707_1000012733 243
276 3300005530 Ga0070679_100257226 Ga0070679_1002572262 243
277 3300005614 Ga0068856_100250734 Ga0068856_1002507342 243
278 3300005615 Ga0070702_100174825 Ga0070702_1001748252 243
279 3300006028 Ga0070717_10068031 Ga0070717_100680313 243
280 3300006175 Ga0070712_100317097 Ga0070712_1003170972 243
281 3300006852 Ga0075433_10154539 Ga0075433_101545393 243
282 3300006871 Ga0075434_100000658 Ga0075434_1000006582 243
283 3300009094 Ga0111539_10622896 Ga0111539_106228962 243
284 3300009098 Ga0105245_10493637 Ga0105245_104936371 243
285 3300009551 Ga0105238_10201435 Ga0105238_102014352 243
286 3300013307 Ga0157372_10214990 Ga0157372_102149904 243
287 3300014745 Ga0157377_10260167 Ga0157377_102601672 243
288 3300025909 Ga0207705_10222743 Ga0207705_102227432 243
289 3300025912 Ga0207707_10059662 Ga0207707_100596623 243
290 3300025912 Ga0207707_10408385 Ga0207707_104083852 243
291 3300025915 Ga0207693_10201662 Ga0207693_102016622 243
292 3300025917 Ga0207660_10092387 Ga0207660_100923873 243
293 3300025921 Ga0207652_10189191 Ga0207652_101891913 243
294 3300025921 Ga0207652_10306816 Ga0207652_103068162 243
295 3300025922 Ga0207646_10004655 Ga0207646_100046558 243
296 3300025929 Ga0207664_10062624 Ga0207664_100626243 243
297 3300025929 Ga0207664_10184350 Ga0207664_101843502 243
298 3300025944 Ga0207661_10591583 Ga0207661_105915832 243
299 3300026078 Ga0207702_10134650 Ga0207702_101346503 243
300 3300026142 Ga0207698_10138311 Ga0207698_101383112 243
301 3300027907 Ga0207428_10343976 Ga0207428_103439762 243
302 3300035410 Ga0373924_0081138 Ga0373924_0081138_316_1137 243
303 3300044693 Ga0466961_0142307 Ga0466961_0142307_54_881 243
304 3300044694 Ga0466963_0042630 Ga0466963_0042630_879_1703 243
305 3300044735 Ga0466968_0030579 Ga0466968_0030579_831_1655 243
306 3300045049 Ga0466959_0204948 Ga0466959_0204948_360_1187 243
307 3300045836 Ga0466958_0224978 Ga0466958_0224978_16_840 243
308 3300045976 Ga0466967_0012538 Ga0466967_0012538_682_1506 243
309 3300045976 Ga0466967_0021821 Ga0466967_0021821_3555_4379 243
310 3300045976 Ga0466967_0131348 Ga0466967_0131348_1086_1910 243
311 3300046454 Ga0495592_0106460 Ga0495592_0106460_767_1588 243
312 3300046459 Ga0495629_0265586 Ga0495629_0265586_118_939 243
313 3300046473 Ga0495582_0010487 Ga0495582_0010487_2236_3126 243
314 3300046476 Ga0495662_0101936 Ga0495662_0101936_366_1187 243
315 3300046477 Ga0495664_0117524 Ga0495664_0117524_446_1267 243
316 3300046511 Ga0495608_0021667 Ga0495608_0021667_364_1185 243
317 3300046516 Ga0495628_0266475 Ga0495628_0266475_44_865 243
318 3300046517 Ga0495630_0105121 Ga0495630_0105121_691_1512 243
319 3300046517 Ga0495630_0411189 Ga0495630_0411189_102_965 243
320 3300046523 Ga0495644_0003055 Ga0495644_0003055_863_1687 243
321 3300046525 Ga0495663_0011608 Ga0495663_0011608_1218_2042 243
322 3300046529 Ga0495652_0052130 Ga0495652_0052130_90_914 243
323 3300046529 Ga0495652_0178785 Ga0495652_0178785_337_1158 243
324 3300046533 Ga0495640_0023975 Ga0495640_0023975_1115_2005 243
325 3300046543 Ga0495645_0049780 Ga0495645_0049780_1797_2618 243
326 3300046543 Ga0495645_0068402 Ga0495645_0068402_1381_2271 243
327 3300046663 Ga0495635_0017299 Ga0495635_0017299_1782_2672 243
328 3300046663 Ga0495635_0158161 Ga0495635_0158161_193_1014 243
329 3300046665 Ga0495661_0069750 Ga0495661_0069750_781_1605 243
330 3300046675 Ga0495657_0089314 Ga0495657_0089314_812_1633 243
331 3300046678 Ga0495599_0104400 Ga0495599_0104400_446_1336 243
332 3300046680 Ga0495646_0134063 Ga0495646_0134063_348_1169 243
333 3300046683 Ga0495658_0173671 Ga0495658_0173671_427_1248 243
334 3300046691 Ga0495670_0084327 Ga0495670_0084327_303_1127 243
335 3300047317 Ga0495604_0110332 Ga0495604_0110332_341_1162 243
336 3300047318 Ga0495636_0123016 Ga0495636_0123016_100_924 243
337 3300047321 Ga0495676_0308307 Ga0495676_0308307_119_940 243
338 3300047322 Ga0495680_0016904 Ga0495680_0016904_3022_3912 243
339 3300047322 Ga0495680_0268779 Ga0495680_0268779_315_1136 243
340 3300047444 Ga0495675_0159486 Ga0495675_0159486_294_1118 243
341 3300047471 Ga0495684_0033445 Ga0495684_0033445_2089_2979 243
342 3300048088 Ga0495602_0158333 Ga0495602_0158333_588_1409 243
343 3300048904 Ga0496101_0076021 Ga0496101_0076021_371_1195 243
344 3300048905 Ga0496102_0393602 Ga0496102_0393602_357_1181 243
345 3300048907 Ga0496104_0000977 Ga0496104_0000977_17269_18090 243
346 3300048907 Ga0496104_0214751 Ga0496104_0214751_909_1736 243
347 3300048908 Ga0496105_0000926 Ga0496105_0000926_1203_2024 243
348 3300048908 Ga0496105_0044751 Ga0496105_0044751_861_1688 243
349 3300048908 Ga0496105_0250294 Ga0496105_0250294_587_1411 243
350 3300048910 Ga0496107_0155304 Ga0496107_0155304_272_1096 243
351 3300048911 Ga0496108_0026913 Ga0496108_0026913_399_1223 243
352 3300048912 Ga0496109_0001789 Ga0496109_0001789_1429_2250 243
353 3300048912 Ga0496109_0033432 Ga0496109_0033432_3177_4001 243
354 3300048912 Ga0496109_0350589 Ga0496109_0350589_482_1306 243
355 3300048913 Ga0496110_0136621 Ga0496110_0136621_928_1749 243
356 3300048915 Ga0496112_0446193 Ga0496112_0446193_215_1039 243
357 3300048916 Ga0496113_0087826 Ga0496113_0087826_1437_2261 243
358 3300048917 Ga0496114_0005892 Ga0496114_0005892_541_1368 243
359 3300048917 Ga0496114_0162039 Ga0496114_0162039_980_1801 243
360 3300048918 Ga0496115_0068569 Ga0496115_0068569_1676_2497 243
361 3300048918 Ga0496115_0177084 Ga0496115_0177084_491_1318 243
362 3300050512 nmdc:mga0n895_7957_c1 nmdc:mga0n895_7957_c1_96_920 243
363 3300050515 nmdc:mga0a205_190057_c1 nmdc:mga0a205_190057_c1_366_1190 243
364 3300061719 Ga0466962_0007664 Ga0466962_0007664_2770_3597 243
365 3300003320 rootH2_10002619 rootH2_100026193 244
366 3300005436 Ga0070713_100579032 Ga0070713_1005790321 244
367 3300005444 Ga0070694_100102647 Ga0070694_1001026473 244
368 3300005530 Ga0070679_100223764 Ga0070679_1002237641 244
369 3300005545 Ga0070695_100000023 Ga0070695_10000002310 244
370 3300006028 Ga0070717_10088244 Ga0070717_100882443 244
371 3300009093 Ga0105240_10045268 Ga0105240_100452685 244
372 3300009177 Ga0105248_10235571 Ga0105248_102355712 244
373 3300022467 Ga0224712_10147637 Ga0224712_101476371 244
374 3300025921 Ga0207652_10189529 Ga0207652_101895292 244
375 3300025928 Ga0207700_10542943 Ga0207700_105429431 244
376 3300025944 Ga0207661_10057121 Ga0207661_100571214 244
377 3300026095 Ga0207676_10069295 Ga0207676_100692953 244
378 3300037312 Ga0395899_0004144 Ga0395899_0004144_4162_5013 244
379 3300037418 Ga0395900_0002083 Ga0395900_0002083_1956_2807 244
380 3300037466 Ga0395898_0010279 Ga0395898_0010279_6025_6876 244
381 3300037471 Ga0395905_0006934 Ga0395905_0006934_6023_6874 244
382 3300038443 Ga0395901_0000793 Ga0395901_0000793_3231_4082 244
383 3300044694 Ga0466963_0010487 Ga0466963_0010487_1516_2307 244
384 3300044694 Ga0466963_0032715 Ga0466963_0032715_1521_2348 244
385 3300044706 Ga0466964_0001506 Ga0466964_0001506_4880_5671 244
386 3300044706 Ga0466964_0003774 Ga0466964_0003774_1225_2118 244
387 3300044719 Ga0466971_0046625 Ga0466971_0046625_900_1721 244
388 3300044842 Ga0466957_0187506 Ga0466957_0187506_98_925 244
389 3300045836 Ga0466958_0001119 Ga0466958_0001119_3174_4001 244
390 3300045976 Ga0466967_0002633 Ga0466967_0002633_6492_7319 244
391 3300045976 Ga0466967_0003534 Ga0466967_0003534_5920_6711 244
392 3300045976 Ga0466967_0048323 Ga0466967_0048323_1630_2469 244
393 3300045976 Ga0466967_0485727 Ga0466967_0485727_332_1156 244
394 3300045976 Ga0466967_0583096 Ga0466967_0583096_108_1001 244
395 3300046454 Ga0495592_0005696 Ga0495592_0005696_7348_8238 244
396 3300046462 Ga0495651_0022741 Ga0495651_0022741_1741_2631 244
397 3300046511 Ga0495608_0214018 Ga0495608_0214018_204_1094 244
398 3300046516 Ga0495628_0030882 Ga0495628_0030882_1818_2708 244
399 3300046543 Ga0495645_0131449 Ga0495645_0131449_475_1365 244
400 3300046663 Ga0495635_0033068 Ga0495635_0033068_1840_2730 244
401 3300046678 Ga0495599_0003982 Ga0495599_0003982_4390_5280 244
402 3300046679 Ga0495623_0052484 Ga0495623_0052484_1389_2279 244
403 3300046680 Ga0495646_0021855 Ga0495646_0021855_1793_2683 244
404 3300046809 Ga0495600_0115302 Ga0495600_0115302_420_1310 244
405 3300047322 Ga0495680_0054513 Ga0495680_0054513_54_944 244
406 3300048088 Ga0495602_0107451 Ga0495602_0107451_1104_1994 244
407 3300048904 Ga0496101_0105705 Ga0496101_0105705_257_1105 244
408 3300048905 Ga0496102_0707407 Ga0496102_0707407_31_879 244
409 3300048908 Ga0496105_0002654 Ga0496105_0002654_116_964 244
410 3300048911 Ga0496108_0000272 Ga0496108_0000272_12388_13236 244
411 3300048912 Ga0496109_0000857 Ga0496109_0000857_12389_13237 244
412 3300048913 Ga0496110_0001545 Ga0496110_0001545_13303_14151 244
413 3300048914 Ga0496111_0001182 Ga0496111_0001182_5738_6586 244
414 3300048916 Ga0496113_0000040 Ga0496113_0000040_22332_23180 244
415 3300048917 Ga0496114_0018200 Ga0496114_0018200_397_1245 244
416 3300048918 Ga0496115_0003551 Ga0496115_0003551_6080_6928 244
417 3300049583 Ga0501067_0043622 Ga0501067_0043622_962_1753 244
418 3300049585 Ga0501069_0030406 Ga0501069_0030406_1441_2232 244
419 3300049585 Ga0501069_0086386 Ga0501069_0086386_65_892 244
420 3300053077 Ga0495601_0021067 Ga0495601_0021067_2986_3876 244
421 3300053078 Ga0495612_0010731 Ga0495612_0010731_35_925 244
422 3300053084 Ga0495595_0008985 Ga0495595_0008985_1233_2123 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02618

YceG

YceG-like family

31

293

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.8094 7 243
4iiw-assembly1.cif.gz_B 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.8059 10 238
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.7997 10 236
4iiw-assembly1.cif.gz_B 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.7557 10 238
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.7473 7 243
ID Description Score Start End Superfamily
4iiwB01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase 0.7018 5 95 3.30.1490.480
4iiwB01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase 0.6494 5 95 3.30.1490.480
3op6B00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.4833 6 41 3.90.960.10
af_Q6JDV7_338_444_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.3617 1 99 3.30.1490.100
af_Q6JDV7_338_444_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.2955 1 99 3.30.1490.100
ID Description Score Start End GO Terms
AF-A0A538GVF3-F1-model_v4 Endolytic transglycosylase MltG 0.9926 120 242 GO:0005886
GO:0016829
GO:0071555
AF-A0A537WED6-F1-model_v4 Endolytic murein transglycosylase (EC 4.2.2.29) (Peptidoglycan lytic transglycosylase) (Peptidoglycan polymerization terminase) 0.9748 7 244 GO:0005886
GO:0008932
GO:0009252
GO:0071555
AF-A0A538A2G2-F1-model_v4 Endolytic transglycosylase MltG 0.9742 90 244 GO:0005886
GO:0016829
GO:0071555
AF-A0A7V9SUW7-F1-model_v4 Endolytic murein transglycosylase (EC 4.2.2.29) (Peptidoglycan lytic transglycosylase) (Peptidoglycan polymerization terminase) 0.972 2 236 GO:0005886
GO:0008932
GO:0009252
GO:0071555
AF-A0A538CJ54-F1-model_v4 Endolytic transglycosylase MltG 0.9718 57 244 GO:0005886
GO:0016829
GO:0071555

Feature Viewer

pLDDT pTM Quality
95.04 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map