F440132

General Info

Members Datasets Scaffolds Average Seq Length
421 366 842 135

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237086|2513583676
Length 146
Sequence PPSAPAMRQRLDKWLFFARLIKSRSLAQKAIEAGHVAVNGKRETQSSAQIKAGDMLEVSLERRDLVVRVLLPGSRRGPYEEARLLYEDLTPAVPAGRPTLFEQATRDRGAGRPTKRDRRETDRLRPGPDRLRPGPDRLRPGDLEDD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
26 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
27 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
28 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
29 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
31 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
58 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
61 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
62 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
69 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
72 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
103 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
106 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
107 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
108 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
109 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
110 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
116 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
117 2509276019 Ensifer aridi TW10 Isolate Nodule
118 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
119 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
120 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
121 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
122 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
123 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
124 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
125 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
126 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
127 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
128 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
129 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
130 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
131 2516143018 Ensifer sp. BR816 Isolate Nodule
132 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
133 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
134 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
135 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
136 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
137 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
138 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
139 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
140 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
141 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
142 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
143 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
144 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
145 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
146 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
147 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
148 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
149 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
150 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
151 2643221607 Rhizobium sp. Root73 Isolate Unclassified
152 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
153 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
154 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
155 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
156 2643221719 Rhizobium sp. Root274 Isolate Unclassified
157 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
158 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
159 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
160 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
161 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
162 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
163 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
164 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
165 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
166 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
167 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
168 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
169 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
170 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
171 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
172 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
173 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
174 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
175 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
176 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
177 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
178 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
179 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
180 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
181 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
182 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
183 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
184 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
185 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
186 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
187 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
188 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
189 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
190 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
191 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
192 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
193 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
194 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
195 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
196 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
197 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
198 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
199 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
200 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
201 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
202 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
203 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
204 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
205 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
206 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
207 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
208 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
209 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
210 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
211 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
212 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
213 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
214 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
215 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
216 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
217 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
218 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
219 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
220 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
221 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
222 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
223 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
224 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
225 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
226 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
227 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
228 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
229 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
230 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
231 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
232 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
233 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
234 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
235 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
236 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
237 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
238 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
239 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
240 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
241 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
242 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
243 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
244 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
245 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
246 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
247 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
248 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
249 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
250 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
251 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
252 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
253 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
254 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
255 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
256 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
257 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
258 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
259 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
260 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
261 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
262 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
263 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
264 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
265 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
266 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
267 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
268 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
269 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
270 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
271 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
272 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
273 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
274 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
275 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
276 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
277 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
278 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
279 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
280 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
281 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
282 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
283 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
284 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
285 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
286 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
287 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
288 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
289 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
290 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
291 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
292 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
293 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
294 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
295 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
296 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
297 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
298 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
299 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
300 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
301 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
302 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
303 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
304 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
305 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
306 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
307 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
308 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
309 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
310 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
311 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
312 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
313 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
314 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
315 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
316 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
317 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
318 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
319 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
320 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
321 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
322 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
323 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
324 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
325 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
326 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
327 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
328 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
329 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
330 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
331 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
332 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
333 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
334 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
335 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
336 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
337 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
338 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
339 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
340 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
341 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
342 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
343 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
344 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
345 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
346 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
347 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
348 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
349 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
350 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
351 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
352 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
353 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
354 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
355 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
356 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
357 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
358 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
359 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
360 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
361 8005382845 Rhizobium sp. R634 Isolate Nodule
362 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
363 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
364 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
365 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
366 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.19
Metatranscriptomes 0.71
Isolates 60.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.25
Nodule 52.73
Rhizoplane 0.95
Rhizosphere 22.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000313 3300001979 Bacteria 20685
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25158J39367_1000004 3300002739 Bacteria 69006
4 JGI25152J39213_1002747 3300002773 Bacteria 6407
5 JGI25152J39213_1004565 3300002773 Bacteria 4316
6 JGI25152J39213_1007486 3300002773 Bacteria 2822
7 JGI25152J39213_1015097 3300002773 Bacteria 1535
8 JGI25152J39213_1020776 3300002773 Bacteria 1166
9 JGI25150J39212_1002862 3300002774 Bacteria 4178
10 JGI25159J45721_1000318 3300002987 Bacteria 22509
11 JGI25159J45721_1001678 3300002987 Bacteria 8974
12 JGI25151J46595_10030702 3300003187 Bacteria 2109
13 JGI25153J46596_10015576 3300003215 Bacteria 3088
14 JGI25153J46596_10039078 3300003215 Bacteria 1487
15 JGI25153J46596_10051985 3300003215 Bacteria 1169
16 JGI25153J46596_10052150 3300003215 Bacteria 1166
17 rootL2_10219984 3300003322 Bacteria 1931
18 rootL2_10279325 3300003322 Bacteria 1500
19 JGI25160J50197_1000022 3300003354 Bacteria 201071
20 JGI25160J50197_1002405 3300003354 Bacteria 8723
21 JGI25161J50226_1000024 3300003374 Bacteria 152176
22 JGI25161J50226_1000367 3300003374 Bacteria 23061
23 Ga0055526_1000919 3300003771 Bacteria 21894
24 Ga0055524_1003999 3300003775 Bacteria 6953
25 Ga0055524_1025081 3300003775 Bacteria 1874
26 Ga0055528_1002838 3300003790 Bacteria 9056
27 Ga0055540_1004966 3300003792 Bacteria 5794
28 Ga0055543_1000025 3300004625 Bacteria 137886
29 Ga0055543_1000062 3300004625 Bacteria 98034
30 Ga0065165_1000200 3300005262 Bacteria 103564
31 Ga0065165_1007324 3300005262 Bacteria 5466
32 Ga0070670_100000061 3300005331 Bacteria 113254
33 Ga0070663_100792692 3300005455 Bacteria 812
34 Ga0070665_100067242 3300005548 Bacteria 3594
35 Ga0070665_101667709 3300005548 Bacteria 645
36 Ga0075366_10063229 3300006195 Bacteria 2200
37 Ga0075366_10514905 3300006195 Bacteria 740
38 Ga0105247_10552969 3300009101 Bacteria 847
39 Ga0105239_10396769 3300010375 Bacteria 1561
40 Ga0105239_11185647 3300010375 Bacteria 880
41 Ga0163162_10800016 3300013306 Bacteria 1060
42 Ga0214544_1000079 3300021320 Bacteria 121742
43 Ga0214542_1000064 3300021321 Bacteria 127681
44 Ga0214543_1000015 3300021327 Bacteria 305679
45 Ga0214543_1000063 3300021327 Bacteria 127694
46 Ga0209436_100018 3300025208 Bacteria 113499
47 Ga0209563_104823 3300025230 Bacteria 2526
48 Ga0207425_1008262 3300025245 Bacteria 2679
49 Ga0209148_1005782 3300025254 Bacteria 2769
50 Ga0209129_1000565 3300025258 Bacteria 25563
51 Ga0209129_1003112 3300025258 Bacteria 7462
52 Ga0209129_1003589 3300025258 Bacteria 6638
53 Ga0209673_1003963 3300025273 Bacteria 8267
54 Ga0209130_1000009 3300025284 Bacteria 498952
55 Ga0209130_1000164 3300025284 Bacteria 97595
56 Ga0209025_1014943 3300025294 Bacteria 4728
57 Ga0209564_1003968 3300025295 Bacteria 9412
58 Ga0209758_1001072 3300025297 Bacteria 35613
59 Ga0209758_1001088 3300025297 Bacteria 35264
60 Ga0209758_1001212 3300025297 Bacteria 32452
61 Ga0209256_1006127 3300025299 Bacteria 6521
62 Ga0207426_1000041 3300025302 Bacteria 433536
63 Ga0207426_1000082 3300025302 Bacteria 298939
64 Ga0209051_1012633 3300025303 Bacteria 4072
65 Ga0209257_1030745 3300025304 Bacteria 1728
66 Ga0207650_10000630 3300025925 Bacteria 28133
67 Ga0207658_11381828 3300025986 Bacteria 644
68 Ga0207678_10621349 3300026067 Bacteria 948
69 Ga0268266_10052193 3300028379 Bacteria 3511
70 Ga0268266_11616628 3300028379 Bacteria 623
71 Ga0307515_10014738 3300028794 Bacteria 14464
72 Ga0307515_10143551 3300028794 Bacteria 2544
73 Ga0307408_101629158 3300031548 Bacteria 613
74 Ga0307405_10174231 3300031731 Bacteria 1538
75 Ga0307410_10037063 3300031852 Bacteria 3182
76 Ga0307406_10079917 3300031901 Bacteria 2170
77 Ga0307407_10994034 3300031903 Bacteria 648
78 Ga0307412_10755764 3300031911 Bacteria 840
79 Ga0307409_100082679 3300031995 Bacteria 2601
80 Ga0307414_10056552 3300032004 Bacteria 2752
81 Ga0307414_11067472 3300032004 Bacteria 745
82 Ga0395900_0306363 3300037418 Bacteria 1573
83 Ga0395905_0005430 3300037471 Bacteria 13023
84 Ga0395905_0007626 3300037471 Bacteria 10746
85 Ga0395905_0163388 3300037471 Bacteria 2092
86 Ga0395905_0713100 3300037471 Bacteria 905
87 Ga0395905_1018859 3300037471 Bacteria 731
88 Ga0439466_0248303 3300041411 Bacteria 539
89 Ga0439465_0077259 3300041413 Bacteria 1124
90 Ga0466970_0297539 3300044765 Bacteria 910
91 Ga0495650_0116569 3300046471 Bacteria 986
92 Ga0495607_0056536 3300046501 Bacteria 2252
93 Ga0495583_0253980 3300046506 Bacteria 704
94 Ga0495583_0275269 3300046506 Bacteria 672
95 Ga0495606_0022371 3300046507 Bacteria 4607
96 Ga0495606_0026732 3300046507 Bacteria 4107
97 Ga0495606_0162934 3300046507 Bacteria 1299
98 Ga0495606_0165934 3300046507 Bacteria 1285
99 Ga0495606_0193866 3300046507 Bacteria 1163
100 Ga0495606_0262584 3300046507 Bacteria 952
101 Ga0495606_0430910 3300046507 Bacteria 680
102 Ga0495610_0076867 3300046512 Bacteria 1543
103 Ga0495610_0162361 3300046512 Bacteria 943
104 Ga0495643_0325714 3300046522 Bacteria 693
105 Ga0495609_0129667 3300046538 Bacteria 1080
106 Ga0495625_0143219 3300046660 Bacteria 1611
107 Ga0495588_0062590 3300046674 Bacteria 1929
108 Ga0495588_0429351 3300046674 Bacteria 693
109 Ga0495649_0111966 3300046694 Bacteria 1447
110 Ga0495604_0016114 3300047317 Bacteria 5970
111 Ga0495687_061296 3300047443 Bacteria 1547
112 Ga0495681_0076670 3300047470 Bacteria 1502
113 Ga0495681_0174093 3300047470 Bacteria 888
114 Ga0495681_0344640 3300047470 Bacteria 568
115 Ga0495686_0030534 3300047472 Bacteria 3499
116 Ga0495686_0040914 3300047472 Bacteria 2953
117 Ga0495686_0140590 3300047472 Bacteria 1425
118 Ga0495626_0401572 3300048091 Bacteria 530
119 Ga0496106_0000194 3300048909 Bacteria 42793
120 Ga0496106_0067476 3300048909 Bacteria 2727
121 Ga0496110_1270372 3300048913 Bacteria 645
122 Ga0496114_0392057 3300048917 Bacteria 1230
123 Ga0496117_0305706 3300048920 Bacteria 840
124 Ga0496119_0074561 3300048922 Bacteria 1975
125 Ga0496120_0119511 3300048923 Bacteria 1364
126 Ga0496121_0019639 3300048924 Bacteria 6748
127 Ga0496121_0097782 3300048924 Bacteria 2273
128 Ga0496121_0154629 3300048924 Bacteria 1684
129 Ga0496121_0220543 3300048924 Bacteria 1336
130 Ga0496122_0000074 3300048925 Bacteria 219900
131 Ga0496123_0000062 3300048926 Bacteria 219882
132 Ga0496124_0122080 3300048927 Bacteria 2080
133 Ga0496125_0137810 3300048928 Bacteria 1703
134 Ga0496126_0172548 3300048929 Bacteria 1841
135 Ga0496126_0290214 3300048929 Bacteria 1353
136 Ga0501032_0083024 3300049569 Bacteria 2131
137 Ga0501032_0119794 3300049569 Bacteria 1740
138 Ga0501033_0000456 3300049570 Bacteria 38936
139 Ga0501033_0527054 3300049570 Bacteria 816
140 Ga0501034_0378567 3300049571 Bacteria 1341
141 Ga0501036_1255378 3300049572 Bacteria 603
142 Ga0501043_0165149 3300049579 Bacteria 1729
143 Ga0501046_0151366 3300049580 Bacteria 1750
144 Ga0501047_0177340 3300049581 Bacteria 1998
145 Ga0501047_1297042 3300049581 Bacteria 542
146 Ga0501068_0101554 3300049584 Bacteria 1783
147 Ga0501072_1439962 3300049588 Bacteria 532
148 Ga0501073_0157544 3300049589 Bacteria 1573
149 Ga0501083_0017662 3300049744 Bacteria 4973
150 Ga0501083_0182036 3300049744 Bacteria 1372
151 Ga0501280_010724 3300049776 Bacteria 1278
152 Ga0501035_0000551 3300049822 Bacteria 41644
153 nmdc:mga0k408_10139_c1 3300050493 Bacteria 5091
154 nmdc:mga0k408_402726_c1 3300050493 Bacteria 814
155 Ga0500651_0292367 3300053093 Bacteria 936
156 Ga0500560_172610 3300053107 Bacteria 711
157 Ga0500658_0043723 3300053134 Bacteria 1804
158 Ga0500559_0009847 3300053136 Bacteria 4120
159 Ga0500568_0019759 3300053139 Bacteria 2921
160 Ga0500604_0021901 3300053151 Bacteria 1810
161 Ga0500620_071698 3300053155 Bacteria 1192
162 Ga0500624_016636 3300053157 Bacteria 1138
163 Ga0500633_0015284 3300053160 Bacteria 2199
164 Ga0590074_103962 3300059423 Bacteria 556
165 Ga0587080_086695 3300059503 Bacteria 651
166 Ga0587076_031947 3300059645 Bacteria 938
167 Ga0587114_073285 3300059655 Bacteria 624
168 Ga0501082_0145238 3300060353 Bacteria 2059
169 2513583676 2513237086 Bacteria 7265287
170 2509109617 2508501122 Bacteria 6292184
171 2509378059 2509276019 Bacteria 6802256
172 2510306745 2510065057 Bacteria 6649661
173 2511133136 2510917022 Bacteria 6504556
174 2511498514 2511231052 Bacteria 6974333
175 2512534656 2512047086 Bacteria 6850303
176 2512973536 2512875026 Bacteria 6861065
177 2513601945 2513237089 Bacteria 6553624
178 2513615750 2513237091 Bacteria 6900273
179 2513884954 2513237140 Bacteria 7076289
180 2513905164 2513237143 Bacteria 6664116
181 2513983400 2513237156 Bacteria 6402557
182 2513998340 2513237159 Bacteria 6810126
183 2514003455 2513237160 Bacteria 6650282
184 2515611089 2515154107 Bacteria 6795637
185 2516205607 2516143018 Bacteria 6951533
186 2516894795 2516653046 Bacteria 6989037
187 2517571460 2517487022 Bacteria 7227575
188 2524450394 2524023207 Bacteria 6813453
189 2524458657 2524023209 Bacteria 6679728
190 2551676649 2551306084 Bacteria 8942552
191 2551680273 2551306084 Bacteria 8942552
192 2551685103 2551306085 Bacteria 7347181
193 2551694538 2551306086 Bacteria 6843938
194 2551715611 2551306089 Bacteria 7162724
195 2551717636 2551306090 Bacteria 7953713
196 2558867441 2558860100 Bacteria 8458965
197 2585166668 2582581283 Bacteria 6030556
198 2585266992 2582581306 Bacteria 6450535
199 2585271876 2582581307 Bacteria 6597605
200 2585388033 2582581865 Bacteria 6644329
201 2585563761 2585427531 Bacteria 6992870
202 2585897043 2585427608 Bacteria 6544331
203 2585907100 2585427609 Bacteria 6667127
204 2587982906 2585428125 Bacteria 6662905
205 2616551191 2615840698 Bacteria 7319877
206 2644052274 2643221607 Bacteria 6314006
207 2644201343 2643221636 Bacteria 6583769
208 2644299902 2643221653 Bacteria 4569637
209 2644484552 2643221686 Bacteria 6310811
210 2644499340 2643221689 Bacteria 6042950
211 2644658129 2643221719 Bacteria 4568197
212 2692319915 2690316117 Bacteria 6800650
213 2753458555 2751185821 Bacteria 6189929
214 2792582271 2791355082 Bacteria 5973319
215 2792621877 2791355091 Bacteria 6135441
216 2792628866 2791355092 Bacteria 6248105
217 2792639954 2791355094 Bacteria 7011481
218 2793280977 2791355253 Bacteria 5171699
219 2802717172 2802428858 Bacteria 6636079
220 2802724839 2802428859 Bacteria 6667919
221 2802729590 2802428860 Bacteria 6525526
222 2802736936 2802428861 Bacteria 6534206
223 2802743341 2802428862 Bacteria 6633353
224 2802749533 2802428863 Bacteria 6410669
225 2819244685 2818991272 Bacteria 4622173
226 2819686972 2818991461 Bacteria 7026071
227 2838078136 2838074704 Bacteria 6785777
228 2842300080 2842298080 Bacteria 6123127
229 2842358991 2842357229 Bacteria 6485165
230 2842524633 2842521101 Bacteria 6569494
231 2847420861 2847417321 Bacteria 6913799
232 2848995689 2848992105 Bacteria 6810864
233 2850082681 2850079185 Bacteria 6848280
234 2852391948 2852387548 Bacteria 8025568
235 2855827426 2855825444 Bacteria 6785811
236 2855842802 2855839649 Bacteria 7135830
237 2855878225 2855872281 Bacteria 6964271
238 2858802140 2858800743 Bacteria 6603254
239 2896390164 2896384573 Bacteria 7700774
240 2913300270 2913295892 Bacteria 6333755
241 2915982383 2915980308 Bacteria 6624279
242 2915988795 2915986958 Bacteria 6739310
243 2915999363 2915993759 Bacteria 7016183
244 2916003812 2916000859 Bacteria 6865702
245 2916009030 2916007675 Bacteria 6898660
246 2916018182 2916014648 Bacteria 6946486
247 2916023858 2916021584 Bacteria 6854472
248 2916031035 2916028427 Bacteria 6748433
249 2916040425 2916035215 Bacteria 6755766
250 2916045379 2916041962 Bacteria 6820487
251 2916050715 2916048683 Bacteria 6543552
252 2916056788 2916055098 Bacteria 6758838
253 2916064969 2916061851 Bacteria 6737736
254 2916075883 2916068649 Bacteria 6943657
255 2916080578 2916076590 Bacteria 6596108
256 2920760291 2920760137 Bacteria 7427611
257 2921207968 2921201388 Bacteria 6926299
258 2921209878 2921208531 Bacteria 6745326
259 2921239781 2921237296 Bacteria 6876710
260 2921249066 2921244191 Bacteria 6568419
261 2921252893 2921250672 Bacteria 6677771
262 2921260202 2921257292 Bacteria 6808382
263 2921266311 2921263974 Bacteria 6864552
264 2921286966 2921282425 Bacteria 6826397
265 2921295938 2921289301 Bacteria 7316391
266 2921303869 2921296804 Bacteria 7176999
267 2924149511 2924144063 Bacteria 6883928
268 2924157588 2924150972 Bacteria 7169444
269 2924163202 2924158325 Bacteria 7188855
270 2924169894 2924165586 Bacteria 7260590
271 2924174235 2924172951 Bacteria 6749356
272 2924181884 2924179722 Bacteria 6843264
273 2924187815 2924186466 Bacteria 6876637
274 2924193557 2924193448 Bacteria 6955718
275 2924201741 2924200457 Bacteria 6757188
276 2924207718 2924207177 Bacteria 6917007
277 2924219364 2924214083 Bacteria 7080103
278 2924223468 2924221636 Bacteria 7113495
279 2924234108 2924228884 Bacteria 6633132
280 2936998925 2936996657 Bacteria 6298727
281 2937006651 2937002841 Bacteria 6934057
282 2937010289 2937009748 Bacteria 6746052
283 2937017794 2937016420 Bacteria 6782579
284 2937023250 2937023124 Bacteria 6815156
285 2937031814 2937029754 Bacteria 6424026
286 2937036254 2937036028 Bacteria 6846469
287 2937048401 2937042894 Bacteria 6741576
288 2937053412 2937049772 Bacteria 6757901
289 2937059821 2937056579 Bacteria 7107896
290 2937068180 2937063883 Bacteria 7199456
291 2937077365 2937071275 Bacteria 6984483
292 2937082091 2937078374 Bacteria 6610289
293 2937090028 2937084907 Bacteria 6618516
294 2937097129 2937091812 Bacteria 6979387
295 2937101306 2937098957 Bacteria 7249374
296 2937112568 2937106411 Bacteria 6947143
297 2937114171 2937113482 Bacteria 6505872
298 2937120171 2937119839 Bacteria 6597547
299 2937128613 2937126314 Bacteria 6771275
300 2957381783 2957375807 Bacteria 6425588
301 2957384561 2957382221 Bacteria 6737050
302 2957395267 2957388812 Bacteria 6778072
303 2957398096 2957395598 Bacteria 6822399
304 2957405161 2957402308 Bacteria 6741770
305 2957411784 2957408893 Bacteria 6558585
306 2957417541 2957415311 Bacteria 6991633
307 2957423299 2957422303 Bacteria 7172205
308 2957431987 2957430029 Bacteria 7022557
309 2957443050 2957437181 Bacteria 6568994
310 2957450333 2957443900 Bacteria 6869977
311 2957454557 2957450854 Bacteria 6765715
312 2957460928 2957457609 Bacteria 6967680
313 2957470960 2957464669 Bacteria 6568877
314 2957471340 2957471148 Bacteria 6797643
315 2957479396 2957478035 Bacteria 6756658
316 2957489700 2957484790 Bacteria 6703082
317 2957494507 2957491536 Bacteria 6695180
318 2957505001 2957498199 Bacteria 7126688
319 2957512249 2957505466 Bacteria 7253085
320 2960584880 2960584000 Bacteria 6864594
321 2960592279 2960591022 Bacteria 6622873
322 2960597969 2960597568 Bacteria 6550735
323 2960606561 2960603979 Bacteria 6898737
324 2960613344 2960610863 Bacteria 6691244
325 2960618344 2960617483 Bacteria 6727748
326 2960629403 2960624210 Bacteria 6875384
327 2960633768 2960631154 Bacteria 6732508
328 2960643753 2960637947 Bacteria 7296468
329 2960647531 2960645483 Bacteria 7211087
330 2960654641 2960652885 Bacteria 7083688
331 2960666871 2960660292 Bacteria 7041660
332 2960673218 2960667422 Bacteria 6763020
333 2960674580 2960674078 Bacteria 6609048
334 2960682386 2960680706 Bacteria 6624464
335 2960693278 2960687367 Bacteria 6535474
336 2960698187 2960693952 Bacteria 6749742
337 2964612453 2964607997 Bacteria 7101408
338 2964617039 2964615318 Bacteria 6809089
339 2964623560 2964621998 Bacteria 6834995
340 2964633273 2964628898 Bacteria 7083044
341 2964641570 2964636051 Bacteria 7091832
342 2964643681 2964643177 Bacteria 6820887
343 2964655283 2964649959 Bacteria 6675118
344 2964659629 2964656573 Bacteria 7100150
345 2964669329 2964663802 Bacteria 7019362
346 2964675397 2964670856 Bacteria 6851364
347 2964679149 2964678106 Bacteria 6792020
348 2964691737 2964685014 Bacteria 6839111
349 2964695071 2964691889 Bacteria 6802758
350 2964702471 2964698721 Bacteria 6765331
351 2964705954 2964705432 Bacteria 7114648
352 2964712732 2964712639 Bacteria 6695970
353 2964719508 2964719344 Bacteria 7286602
354 2967664790 2967664464 Bacteria 6948836
355 2967672289 2967671571 Bacteria 7021409
356 2967681752 2967678726 Bacteria 7264382
357 2967690203 2967686174 Bacteria 6678622
358 2967699328 2967693043 Bacteria 6804451
359 2967700887 2967699805 Bacteria 6854538
360 2967713266 2967706974 Bacteria 7186053
361 2967719017 2967714385 Bacteria 7000047
362 2967723864 2967721400 Bacteria 7073753
363 2967730869 2967728569 Bacteria 6641507
364 2967738392 2967735183 Bacteria 6827012
365 2967748596 2967742019 Bacteria 6794534
366 2967753987 2967748971 Bacteria 6733771
367 2967757465 2967755722 Bacteria 6814706
368 2967767876 2967762386 Bacteria 6923502
369 2967775145 2967769361 Bacteria 6587838
370 2967776988 2967775926 Bacteria 6738189
371 2970023596 2970019648 Bacteria 7072033
372 2970028767 2970026789 Bacteria 6785236
373 2970040533 2970033650 Bacteria 7118744
374 2970044947 2970040964 Bacteria 6731123
375 2970048766 2970047711 Bacteria 7088379
376 2970058908 2970054988 Bacteria 6611507
377 2970068454 2970061556 Bacteria 7099761
378 2970070288 2970068827 Bacteria 7123112
379 2970076791 2970076120 Bacteria 6697332
380 2970084045 2970082768 Bacteria 6183754
381 2970092815 2970088815 Bacteria 6933825
382 2970099908 2970095765 Bacteria 6936963
383 2970106990 2970102677 Bacteria 6812532
384 2970111134 2970109326 Bacteria 6863976
385 2970116867 2970116247 Bacteria 6501857
386 2970124594 2970122695 Bacteria 6625855
387 2970133593 2970129317 Bacteria 6806560
388 2970142269 2970136068 Bacteria 7207982
389 2970143557 2970143518 Bacteria 6446480
390 2970151679 2970149975 Bacteria 6779706
391 2970163160 2970156795 Bacteria 7168044
392 2970170826 2970164137 Bacteria 6861252
393 2970176091 2970170962 Bacteria 6876229
394 2970181265 2970177841 Bacteria 6768001
395 2970185493 2970184632 Bacteria 7054431
396 2970197986 2970191845 Bacteria 7032787
397 2977519753 2977516862 Bacteria 6940108
398 2977525174 2977523885 Bacteria 6960446
399 2977535038 2977530762 Bacteria 6951399
400 2977544542 2977537788 Bacteria 6929320
401 2977550582 2977544691 Bacteria 6875412
402 2977553160 2977551784 Bacteria 7125765
403 2977565792 2977558990 Bacteria 6863948
404 2977571239 2977565890 Bacteria 6901543
405 2977573762 2977572785 Bacteria 6763888
406 2977582963 2977579622 Bacteria 6772100
407 2989771502 2989771324 Bacteria 5605128
408 2989780056 2989776772 Bacteria 4843317
409 3003930972 3003930520 Bacteria 5667563
410 3005449733 3005445848 Bacteria 6906074
411 643827454 643692032 Bacteria 6891900
412 648737238 648276728 Bacteria 6968865
413 8003995382 8003992118 Bacteria 7266902
414 8004003125 8003999396 Bacteria 7063185
415 8005249200 8005246636 Bacteria 4933972
416 8005387712 8005382845 Bacteria 6732062
417 8024490913 8024486573 Bacteria 6540512
418 8049296326 8049293176 Bacteria 6128433
419 8054561638 8054558443 Bacteria 5204801
420 8055432932 8055431914 Bacteria 4551896
421 8057580314 8057575449 Bacteria 7367519
422 JGI24740J21852_10000313
423 JGI25155J39150_1000004
424 JGI25158J39367_1000004
425 JGI25152J39213_1002747
426 JGI25152J39213_1004565
427 JGI25152J39213_1007486
428 JGI25152J39213_1015097
429 JGI25152J39213_1020776
430 JGI25150J39212_1002862
431 JGI25159J45721_1000318
432 JGI25159J45721_1001678
433 JGI25151J46595_10030702
434 JGI25153J46596_10015576
435 JGI25153J46596_10039078
436 JGI25153J46596_10051985
437 JGI25153J46596_10052150
438 rootL2_10219984
439 rootL2_10279325
440 JGI25160J50197_1000022
441 JGI25160J50197_1002405
442 JGI25161J50226_1000024
443 JGI25161J50226_1000367
444 Ga0055526_1000919
445 Ga0055524_1003999
446 Ga0055524_1025081
447 Ga0055528_1002838
448 Ga0055540_1004966
449 Ga0055543_1000025
450 Ga0055543_1000062
451 Ga0065165_1000200
452 Ga0065165_1007324
453 Ga0070670_100000061
454 Ga0070663_100792692
455 Ga0070665_100067242
456 Ga0070665_101667709
457 Ga0075366_10063229
458 Ga0075366_10514905
459 Ga0105247_10552969
460 Ga0105239_10396769
461 Ga0105239_11185647
462 Ga0163162_10800016
463 Ga0214544_1000079
464 Ga0214542_1000064
465 Ga0214543_1000015
466 Ga0214543_1000063
467 Ga0209436_100018
468 Ga0209563_104823
469 Ga0207425_1008262
470 Ga0209148_1005782
471 Ga0209129_1000565
472 Ga0209129_1003112
473 Ga0209129_1003589
474 Ga0209673_1003963
475 Ga0209130_1000009
476 Ga0209130_1000164
477 Ga0209025_1014943
478 Ga0209564_1003968
479 Ga0209758_1001072
480 Ga0209758_1001088
481 Ga0209758_1001212
482 Ga0209256_1006127
483 Ga0207426_1000041
484 Ga0207426_1000082
485 Ga0209051_1012633
486 Ga0209257_1030745
487 Ga0207650_10000630
488 Ga0207658_11381828
489 Ga0207678_10621349
490 Ga0268266_10052193
491 Ga0268266_11616628
492 Ga0307515_10014738
493 Ga0307515_10143551
494 Ga0307408_101629158
495 Ga0307405_10174231
496 Ga0307410_10037063
497 Ga0307406_10079917
498 Ga0307407_10994034
499 Ga0307412_10755764
500 Ga0307409_100082679
501 Ga0307414_10056552
502 Ga0307414_11067472
503 Ga0395900_0306363
504 Ga0395905_0005430
505 Ga0395905_0007626
506 Ga0395905_0163388
507 Ga0395905_0713100
508 Ga0395905_1018859
509 Ga0439466_0248303
510 Ga0439465_0077259
511 Ga0466970_0297539
512 Ga0495650_0116569
513 Ga0495607_0056536
514 Ga0495583_0253980
515 Ga0495583_0275269
516 Ga0495606_0022371
517 Ga0495606_0026732
518 Ga0495606_0162934
519 Ga0495606_0165934
520 Ga0495606_0193866
521 Ga0495606_0262584
522 Ga0495606_0430910
523 Ga0495610_0076867
524 Ga0495610_0162361
525 Ga0495643_0325714
526 Ga0495609_0129667
527 Ga0495625_0143219
528 Ga0495588_0062590
529 Ga0495588_0429351
530 Ga0495649_0111966
531 Ga0495604_0016114
532 Ga0495687_061296
533 Ga0495681_0076670
534 Ga0495681_0174093
535 Ga0495681_0344640
536 Ga0495686_0030534
537 Ga0495686_0040914
538 Ga0495686_0140590
539 Ga0495626_0401572
540 Ga0496106_0000194
541 Ga0496106_0067476
542 Ga0496110_1270372
543 Ga0496114_0392057
544 Ga0496117_0305706
545 Ga0496119_0074561
546 Ga0496120_0119511
547 Ga0496121_0019639
548 Ga0496121_0097782
549 Ga0496121_0154629
550 Ga0496121_0220543
551 Ga0496122_0000074
552 Ga0496123_0000062
553 Ga0496124_0122080
554 Ga0496125_0137810
555 Ga0496126_0172548
556 Ga0496126_0290214
557 Ga0501032_0083024
558 Ga0501032_0119794
559 Ga0501033_0000456
560 Ga0501033_0527054
561 Ga0501034_0378567
562 Ga0501036_1255378
563 Ga0501043_0165149
564 Ga0501046_0151366
565 Ga0501047_0177340
566 Ga0501047_1297042
567 Ga0501068_0101554
568 Ga0501072_1439962
569 Ga0501073_0157544
570 Ga0501083_0017662
571 Ga0501083_0182036
572 Ga0501280_010724
573 Ga0501035_0000551
574 nmdc:mga0k408_10139_c1
575 nmdc:mga0k408_402726_c1
576 Ga0500651_0292367
577 Ga0500560_172610
578 Ga0500658_0043723
579 Ga0500559_0009847
580 Ga0500568_0019759
581 Ga0500604_0021901
582 Ga0500620_071698
583 Ga0500624_016636
584 Ga0500633_0015284
585 Ga0590074_103962
586 Ga0587080_086695
587 Ga0587076_031947
588 Ga0587114_073285
589 Ga0501082_0145238
590 2513583676
591 2509109617
592 2509378059
593 2510306745
594 2511133136
595 2511498514
596 2512534656
597 2512973536
598 2513601945
599 2513615750
600 2513884954
601 2513905164
602 2513983400
603 2513998340
604 2514003455
605 2515611089
606 2516205607
607 2516894795
608 2517571460
609 2524450394
610 2524458657
611 2551676649
612 2551680273
613 2551685103
614 2551694538
615 2551715611
616 2551717636
617 2558867441
618 2585166668
619 2585266992
620 2585271876
621 2585388033
622 2585563761
623 2585897043
624 2585907100
625 2587982906
626 2616551191
627 2644052274
628 2644201343
629 2644299902
630 2644484552
631 2644499340
632 2644658129
633 2692319915
634 2753458555
635 2792582271
636 2792621877
637 2792628866
638 2792639954
639 2793280977
640 2802717172
641 2802724839
642 2802729590
643 2802736936
644 2802743341
645 2802749533
646 2819244685
647 2819686972
648 2838078136
649 2842300080
650 2842358991
651 2842524633
652 2847420861
653 2848995689
654 2850082681
655 2852391948
656 2855827426
657 2855842802
658 2855878225
659 2858802140
660 2896390164
661 2913300270
662 2915982383
663 2915988795
664 2915999363
665 2916003812
666 2916009030
667 2916018182
668 2916023858
669 2916031035
670 2916040425
671 2916045379
672 2916050715
673 2916056788
674 2916064969
675 2916075883
676 2916080578
677 2920760291
678 2921207968
679 2921209878
680 2921239781
681 2921249066
682 2921252893
683 2921260202
684 2921266311
685 2921286966
686 2921295938
687 2921303869
688 2924149511
689 2924157588
690 2924163202
691 2924169894
692 2924174235
693 2924181884
694 2924187815
695 2924193557
696 2924201741
697 2924207718
698 2924219364
699 2924223468
700 2924234108
701 2936998925
702 2937006651
703 2937010289
704 2937017794
705 2937023250
706 2937031814
707 2937036254
708 2937048401
709 2937053412
710 2937059821
711 2937068180
712 2937077365
713 2937082091
714 2937090028
715 2937097129
716 2937101306
717 2937112568
718 2937114171
719 2937120171
720 2937128613
721 2957381783
722 2957384561
723 2957395267
724 2957398096
725 2957405161
726 2957411784
727 2957417541
728 2957423299
729 2957431987
730 2957443050
731 2957450333
732 2957454557
733 2957460928
734 2957470960
735 2957471340
736 2957479396
737 2957489700
738 2957494507
739 2957505001
740 2957512249
741 2960584880
742 2960592279
743 2960597969
744 2960606561
745 2960613344
746 2960618344
747 2960629403
748 2960633768
749 2960643753
750 2960647531
751 2960654641
752 2960666871
753 2960673218
754 2960674580
755 2960682386
756 2960693278
757 2960698187
758 2964612453
759 2964617039
760 2964623560
761 2964633273
762 2964641570
763 2964643681
764 2964655283
765 2964659629
766 2964669329
767 2964675397
768 2964679149
769 2964691737
770 2964695071
771 2964702471
772 2964705954
773 2964712732
774 2964719508
775 2967664790
776 2967672289
777 2967681752
778 2967690203
779 2967699328
780 2967700887
781 2967713266
782 2967719017
783 2967723864
784 2967730869
785 2967738392
786 2967748596
787 2967753987
788 2967757465
789 2967767876
790 2967775145
791 2967776988
792 2970023596
793 2970028767
794 2970040533
795 2970044947
796 2970048766
797 2970058908
798 2970068454
799 2970070288
800 2970076791
801 2970084045
802 2970092815
803 2970099908
804 2970106990
805 2970111134
806 2970116867
807 2970124594
808 2970133593
809 2970142269
810 2970143557
811 2970151679
812 2970163160
813 2970170826
814 2970176091
815 2970181265
816 2970185493
817 2970197986
818 2977519753
819 2977525174
820 2977535038
821 2977544542
822 2977550582
823 2977553160
824 2977565792
825 2977571239
826 2977573762
827 2977582963
828 2989771502
829 2989780056
830 3003930972
831 3005449733
832 643827454
833 648737238
834 8003995382
835 8004003125
836 8005249200
837 8005387712
838 8024490913
839 8049296326
840 8054561638
841 8055432932
842 8057580314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

9

56

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9633 13 55
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.948 13 63
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9461 13 62
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9451 13 94
7aqc-assembly1.cif.gz_Y structure of the bacterial rqc complex (decoding state) 0.9441 13 94
ID Description Score Start End Superfamily
af_Q4D8U8_345_395_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9669 15 62 3.10.290.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.964 13 55 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9626 13 60 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.962 14 58 1.10.1050.10
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.955 13 93 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A525IT70-F1-model_v4 RNA-binding S4 domain-containing protein 0.9956 12 93 GO:0003723
AF-A0A4U8Z5Q1-F1-model_v4 RNA-binding S4 domain protein 0.9951 12 94 GO:0003723
AF-A0A0D7QDP5-F1-model_v4 RNA-binding protein S4 0.9878 11 93 GO:0003723
AF-A0A435FLK4-F1-model_v4 RNA-binding S4 domain-containing protein 0.9874 12 91 GO:0003723
AF-A0A537U8D8-F1-model_v4 RNA-binding S4 domain-containing protein 0.9867 11 93 GO:0003723

Map