F440067

General Info

Members Datasets Scaffolds Average Seq Length
421 249 391 196

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_000093|Ga0495617_000093_21500_22207
Length 235
Sequence MDSLFSQVQIGRHTLSNRMFMAPMTRSRSHRNPFLTARRIIMSYEKFSADNAALLLIDHQVGTMGWVKSIPFEELKRNALMLAKAASILKLPVVLTSSMEEYAQGPLLSELEQILPAEFASRIKRLGIVNAMDDEHFAAAVKATGRKKLIIAGVTNDVCTVYPALSLVREGYEVQVVADGGGSPSVMADDIALRRMDKGGVTLTTTNQLIAELAGSWATPQGGQLVQVLMEALQG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
15 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
16 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
17 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
18 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
19 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
20 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
21 2791355199
22 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
23 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
24 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
25 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
26 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
27 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
28 2928070936 Variovorax gossypii 1167 Isolate Unclassified
29 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
30 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
245 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
248 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
249 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 0
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.5
Nodule 3.56
Rhizoplane 2.38
Rhizosphere 69.83
Stem 0
Stem Tuber 0
Unclassified 14.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_338 2124908027 Bacteria 9063
2 MRS1b_contig_3203502 2162886011 Bacteria 1443
3 MBSR1b_contig_10475904 2162886012 Bacteria 965
4 JGI25160J50197_1001877 3300003354 Bacteria 10080
5 Ga0065714_10000604 3300005288 Bacteria 3506
6 Ga0065714_10170344 3300005288 Bacteria 1007
7 Ga0065712_10070640 3300005290 Bacteria 5811
8 Ga0065715_10004625 3300005293 Bacteria 3473
9 Ga0065707_10330287 3300005295 Bacteria 950
10 Ga0065707_10523848 3300005295 Bacteria 740
11 Ga0070668_100169522 3300005347 Bacteria 1776
12 Ga0070668_101396452 3300005347 Unclassified 638
13 Ga0070669_100274265 3300005353 Bacteria 1350
14 Ga0070671_100107000 3300005355 Unclassified 2348
15 Ga0070667_100018854 3300005367 Bacteria 5721
16 Ga0070713_101022863 3300005436 Unclassified 797
17 Ga0070711_100089845 3300005439 Bacteria 2211
18 Ga0070700_100039020 3300005441 Bacteria 2898
19 Ga0070694_100122757 3300005444 Bacteria 1866
20 Ga0070708_100720870 3300005445 Bacteria 938
21 Ga0070662_100064867 3300005457 Bacteria 2675
22 Ga0070662_100403820 3300005457 Bacteria 1128
23 Ga0070706_100452932 3300005467 Bacteria 1194
24 Ga0070698_100030884 3300005471 Bacteria 5555
25 Ga0070699_100079297 3300005518 Bacteria 2860
26 Ga0070696_100160090 3300005546 Bacteria 1658
27 Ga0070665_100331557 3300005548 Unclassified 1526
28 Ga0070704_100297422 3300005549 Bacteria 1344
29 Ga0068854_100184990 3300005578 Bacteria 1629
30 Ga0068859_100515486 3300005617 Bacteria 1291
31 Ga0068861_100043105 3300005719 Bacteria 3384
32 Ga0068858_100287535 3300005842 Bacteria 1566
33 Ga0068860_100047364 3300005843 Bacteria 4098
34 Ga0068862_100042538 3300005844 Bacteria 3870
35 Ga0068862_100090400 3300005844 Bacteria 2665
36 Ga0075365_10035509 3300006038 Bacteria 3226
37 Ga0075364_10021278 3300006051 Bacteria 4086
38 Ga0075364_10134088 3300006051 Bacteria 1663
39 Ga0075432_10000482 3300006058 Bacteria 11887
40 Ga0075432_10034798 3300006058 Bacteria 1750
41 Ga0075432_10037904 3300006058 Bacteria 1678
42 Ga0070712_100015748 3300006175 Bacteria 4876
43 Ga0075362_10019042 3300006177 Bacteria 2850
44 Ga0075367_10060635 3300006178 Bacteria 2256
45 Ga0075367_10505365 3300006178 Bacteria 767
46 Ga0075367_10577840 3300006178 Bacteria 714
47 Ga0075369_10008520 3300006186 Bacteria 3948
48 Ga0075369_10009038 3300006186 Bacteria 3857
49 Ga0097621_100003925 3300006237 Bacteria 10299
50 Ga0068871_100016391 3300006358 Bacteria 5580
51 Ga0075430_100102662 3300006846 Bacteria 2387
52 Ga0075430_100104792 3300006846 Bacteria 2361
53 Ga0075430_100252160 3300006846 Bacteria 1462
54 Ga0075430_100539060 3300006846 Bacteria 962
55 Ga0075436_100072308 3300006914 Bacteria 2386
56 Ga0075436_100077811 3300006914 Bacteria 2297
57 Ga0097620_100515537 3300006931 Bacteria 1291
58 Ga0099823_1000006 3300006944 Bacteria 135028
59 Ga0079104_1030356 3300006946 Bacteria 1350
60 Ga0099794_10108216 3300007265 Bacteria 1391
61 Ga0105251_10005580 3300009011 Bacteria 8185
62 Ga0105251_10014208 3300009011 Bacteria 4416
63 Ga0105251_10027370 3300009011 Bacteria 2891
64 Ga0105251_10031875 3300009011 Bacteria 2632
65 Ga0105251_10060609 3300009011 Bacteria 1781
66 Ga0105251_10097861 3300009011 Bacteria 1343
67 Ga0105244_10001696 3300009036 Bacteria 17393
68 Ga0105244_10013552 3300009036 Bacteria 4756
69 Ga0105244_10045041 3300009036 Bacteria 2270
70 Ga0105244_10095567 3300009036 Bacteria 1458
71 Ga0105250_10000172 3300009092 Bacteria 56485
72 Ga0105250_10002321 3300009092 Bacteria 9647
73 Ga0105250_10008055 3300009092 Bacteria 4494
74 Ga0105250_10039284 3300009092 Bacteria 1897
75 Ga0105250_10087472 3300009092 Bacteria 1265
76 Ga0105240_10060024 3300009093 Bacteria 4743
77 Ga0105245_10676321 3300009098 Unclassified 1064
78 Ga0114129_10437603 3300009147 Bacteria 1717
79 Ga0105242_10030883 3300009176 Bacteria 4279
80 Ga0105248_10053607 3300009177 Bacteria 4525
81 Ga0105237_10211488 3300009545 Bacteria 1939
82 Ga0105238_10592186 3300009551 Bacteria 1116
83 Ga0105249_10027754 3300009553 Bacteria 5108
84 Ga0105239_10140387 3300010375 Bacteria 2692
85 Ga0105239_10240379 3300010375 Bacteria 2032
86 Ga0105239_11419651 3300010375 Bacteria 801
87 Ga0105246_10123093 3300011119 Bacteria 1925
88 Ga0157371_10247696 3300013102 Bacteria 1282
89 Ga0157370_10039637 3300013104 Bacteria 4553
90 Ga0157370_10300853 3300013104 Bacteria 1481
91 Ga0157370_10565222 3300013104 Bacteria 1042
92 Ga0157374_10098425 3300013296 Bacteria 2801
93 Ga0157374_10419585 3300013296 Unclassified 1337
94 Ga0157378_10032773 3300013297 Bacteria 4592
95 Ga0163162_10001032 3300013306 Bacteria 25916
96 Ga0163162_10181419 3300013306 Bacteria 2231
97 Ga0163162_10869268 3300013306 Bacteria 1016
98 Ga0157375_10083847 3300013308 Bacteria 3233
99 Ga0182008_10010369 3300014497 Bacteria 4988
100 Ga0157376_10004542 3300014969 Bacteria 9664
101 Ga0157376_10008702 3300014969 Bacteria 7339
102 Ga0182006_1049060 3300015261 Bacteria 1631
103 Ga0182007_10062142 3300015262 Bacteria 1224
104 Ga0182005_1003810 3300015265 Bacteria 5010
105 Ga0182005_1004573 3300015265 Bacteria 4444
106 Ga0163161_10025379 3300017792 Bacteria 4194
107 Ga0163161_10067631 3300017792 Bacteria 2609
108 Ga0163161_10076241 3300017792 Bacteria 2461
109 Ga0163161_10084255 3300017792 Bacteria 2344
110 Ga0163161_10135989 3300017792 Bacteria 1858
111 Ga0163161_10292642 3300017792 Bacteria 1280
112 Ga0163161_10554304 3300017792 Bacteria 942
113 Ga0213872_10000185 3300021361 Bacteria 55707
114 Ga0213872_10041460 3300021361 Bacteria 2101
115 Ga0209563_100751 3300025230 Bacteria 9942
116 Ga0209759_1001198 3300025256 Bacteria 16134
117 Ga0209758_1010734 3300025297 Bacteria 5429
118 Ga0207426_1000278 3300025302 Bacteria 105775
119 Ga0209051_1006469 3300025303 Bacteria 6598
120 Ga0209051_1038681 3300025303 Bacteria 1733
121 Ga0209257_1020554 3300025304 Bacteria 2435
122 Ga0207696_1000038 3300025711 Bacteria 328221
123 Ga0207696_1001477 3300025711 Bacteria 12721
124 Ga0207696_1002798 3300025711 Bacteria 8281
125 Ga0207696_1004238 3300025711 Bacteria 6226
126 Ga0207696_1007785 3300025711 Bacteria 4154
127 Ga0207655_1000001 3300025728 Bacteria 1866413
128 Ga0207655_1000077 3300025728 Bacteria 219418
129 Ga0207655_1004053 3300025728 Bacteria 10547
130 Ga0207655_1011372 3300025728 Bacteria 5304
131 Ga0207655_1022912 3300025728 Bacteria 3112
132 Ga0207655_1067565 3300025728 Bacteria 1345
133 Ga0207655_1071043 3300025728 Bacteria 1293
134 Ga0207655_1087676 3300025728 Bacteria 1103
135 Ga0207713_1002310 3300025735 Bacteria 14016
136 Ga0207713_1006978 3300025735 Bacteria 6771
137 Ga0207713_1020449 3300025735 Bacteria 3206
138 Ga0207713_1024117 3300025735 Bacteria 2844
139 Ga0207713_1030951 3300025735 Bacteria 2375
140 Ga0207713_1050460 3300025735 Bacteria 1660
141 Ga0207680_10044158 3300025903 Unclassified 2619
142 Ga0207684_10632190 3300025910 Bacteria 913
143 Ga0207671_10093143 3300025914 Bacteria 2272
144 Ga0207671_10435084 3300025914 Bacteria 1044
145 Ga0207693_10037687 3300025915 Unclassified 3810
146 Ga0207663_10112713 3300025916 Unclassified 1848
147 Ga0207681_10179434 3300025923 Bacteria 1612
148 Ga0207706_10163108 3300025933 Bacteria 1959
149 Ga0207706_10296913 3300025933 Bacteria 1408
150 Ga0207686_10038908 3300025934 Unclassified 2882
151 Ga0207711_10156133 3300025941 Bacteria 2062
152 Ga0207689_10033290 3300025942 Bacteria 4283
153 Ga0207667_10083262 3300025949 Bacteria 3313
154 Ga0207712_10048184 3300025961 Bacteria 2963
155 Ga0207668_10011403 3300025972 Bacteria 5398
156 Ga0207658_10048924 3300025986 Bacteria 3103
157 Ga0207703_10773648 3300026035 Bacteria 915
158 Ga0207708_10120929 3300026075 Bacteria 2040
159 Ga0207702_10332980 3300026078 Bacteria 1449
160 Ga0207675_100040598 3300026118 Bacteria 4346
161 Ga0209389_1000030 3300027296 Bacteria 139329
162 Ga0207428_10028891 3300027907 Bacteria 4602
163 Ga0207428_10065027 3300027907 Bacteria 2879
164 Ga0207428_10095644 3300027907 Bacteria 2301
165 Ga0207428_10127369 3300027907 Bacteria 1950
166 Ga0268265_10012342 3300028380 Bacteria 5788
167 Ga0268264_10092062 3300028381 Bacteria 2616
168 Ga0307517_10016705 3300028786 Bacteria 9623
169 Ga0307511_10082716 3300030521 Bacteria 2242
170 Ga0307509_10505202 3300031507 Bacteria 892
171 Ga0307508_10092717 3300031616 Bacteria 2610
172 Ga0307508_10158140 3300031616 Bacteria 1869
173 Ga0307412_10084253 3300031911 Bacteria 2206
174 Ga0307507_10010483 3300033179 Bacteria 11967
175 Ga0373946_0120114 3300035171 Bacteria 1199
176 Ga0373935_0297710 3300035692 Bacteria 1139
177 Ga0373927_0011247 3300035695 Bacteria 5959
178 Ga0373927_0021468 3300035695 Bacteria 4232
179 Ga0373925_0017860 3300037068 Bacteria 5148
180 Ga0373925_0024737 3300037068 Bacteria 4386
181 Ga0436361_0245698 3300039447 Bacteria 3903
182 Ga0436361_1000817 3300039447 Bacteria 7047
183 Ga0439456_014175 3300042013 Bacteria 1662
184 Ga0451576_0013698 3300045051 Bacteria 9059
185 Ga0495617_000093 3300046452 Bacteria 62985
186 Ga0495617_002639 3300046452 Bacteria 6999
187 Ga0495603_0261756 3300046455 Bacteria 995
188 Ga0495638_0000112 3300046460 Bacteria 130876
189 Ga0495638_0002552 3300046460 Bacteria 14762
190 Ga0495638_0012520 3300046460 Bacteria 5809
191 Ga0495638_0025425 3300046460 Bacteria 3849
192 Ga0495650_0000675 3300046471 Bacteria 44329
193 Ga0495580_0286232 3300046472 Bacteria 1124
194 Ga0495605_0000211 3300046474 Bacteria 71871
195 Ga0495605_0008393 3300046474 Bacteria 5840
196 Ga0495605_0016671 3300046474 Bacteria 3972
197 Ga0495584_0000063 3300046491 Bacteria 76679
198 Ga0495584_0039934 3300046491 Bacteria 2370
199 Ga0495585_0004519 3300046492 Bacteria 9013
200 Ga0495594_0000547 3300046499 Bacteria 19213
201 Ga0495594_0039977 3300046499 Bacteria 2565
202 Ga0495607_0000091 3300046501 Bacteria 93971
203 Ga0495607_0000293 3300046501 Bacteria 52757
204 Ga0495607_0009586 3300046501 Bacteria 6543
205 Ga0495607_0153451 3300046501 Bacteria 1176
206 Ga0495583_0002334 3300046506 Bacteria 16490
207 Ga0495583_0009985 3300046506 Bacteria 5597
208 Ga0495616_0015558 3300046513 Bacteria 4229
209 Ga0495630_0000514 3300046517 Bacteria 28617
210 Ga0495631_0030396 3300046518 Bacteria 2451
211 Ga0495631_0054472 3300046518 Bacteria 1744
212 Ga0495632_0004522 3300046519 Bacteria 9429
213 Ga0495632_0036496 3300046519 Bacteria 2500
214 Ga0495637_0000331 3300046520 Bacteria 36572
215 Ga0495643_0001324 3300046522 Bacteria 23435
216 Ga0495644_0118738 3300046523 Bacteria 1005
217 Ga0495648_0000428 3300046524 Bacteria 46098
218 Ga0495648_0010086 3300046524 Bacteria 7235
219 Ga0495648_0017316 3300046524 Bacteria 5156
220 Ga0495648_0028242 3300046524 Bacteria 3740
221 Ga0495666_0038926 3300046526 Bacteria 2311
222 Ga0495642_0043026 3300046528 Bacteria 1842
223 Ga0495654_0007210 3300046530 Bacteria 6236
224 Ga0495609_0000131 3300046538 Bacteria 80952
225 Ga0495609_0015212 3300046538 Bacteria 3604
226 Ga0495609_0042362 3300046538 Bacteria 2044
227 Ga0495597_0010339 3300046542 Bacteria 4565
228 Ga0495622_0001174 3300046557 Bacteria 13560
229 Ga0495622_0011010 3300046557 Bacteria 4173
230 Ga0495622_0025609 3300046557 Bacteria 2755
231 Ga0495656_0072168 3300046615 Bacteria 1536
232 Ga0495668_0150075 3300046616 Bacteria 1276
233 Ga0495611_0000366 3300046648 Bacteria 29212
234 Ga0495611_0004339 3300046648 Bacteria 6147
235 Ga0495625_0022404 3300046660 Bacteria 4843
236 Ga0495625_0070176 3300046660 Bacteria 2460
237 Ga0495625_0078178 3300046660 Bacteria 2310
238 Ga0495625_0202520 3300046660 Bacteria 1309
239 Ga0495625_0231173 3300046660 Bacteria 1208
240 Ga0495625_0351627 3300046660 Bacteria 931
241 Ga0495659_0006228 3300046664 Bacteria 3771
242 Ga0495659_0029035 3300046664 Bacteria 1918
243 Ga0495661_0003347 3300046665 Bacteria 11881
244 Ga0495661_0127313 3300046665 Bacteria 1400
245 Ga0495588_0061177 3300046674 Bacteria 1950
246 Ga0495669_0053727 3300046684 Bacteria 1812
247 Ga0495613_0108773 3300046689 Bacteria 1999
248 Ga0495670_0006095 3300046691 Bacteria 5914
249 Ga0495670_0028044 3300046691 Bacteria 2791
250 Ga0495671_0000137 3300046692 Bacteria 64587
251 Ga0495671_0005908 3300046692 Bacteria 7121
252 Ga0495671_0124539 3300046692 Bacteria 1257
253 Ga0495649_0060131 3300046694 Bacteria 2044
254 Ga0495649_0214329 3300046694 Bacteria 997
255 Ga0495589_0000498 3300046794 Bacteria 27819
256 Ga0495589_0044247 3300046794 Bacteria 2215
257 Ga0495660_0004884 3300046810 Bacteria 8074
258 Ga0495660_0072162 3300046810 Bacteria 1829
259 Ga0495604_0122566 3300047317 Bacteria 1880
260 Ga0495636_0000604 3300047318 Bacteria 13191
261 Ga0495636_0011584 3300047318 Bacteria 3492
262 Ga0495636_0014331 3300047318 Bacteria 3150
263 Ga0495636_0022708 3300047318 Bacteria 2538
264 Ga0495636_0024747 3300047318 Bacteria 2436
265 Ga0495672_0000210 3300047320 Bacteria 83349
266 Ga0495672_0012924 3300047320 Bacteria 5788
267 Ga0495672_0017597 3300047320 Bacteria 4777
268 Ga0495672_0019130 3300047320 Bacteria 4527
269 Ga0495683_0005114 3300047323 Bacteria 7319
270 Ga0495683_0020509 3300047323 Bacteria 3409
271 Ga0495687_001370 3300047443 Bacteria 22513
272 Ga0495687_016841 3300047443 Bacteria 3665
273 Ga0495687_041559 3300047443 Bacteria 2016
274 Ga0495675_0017700 3300047444 Bacteria 4517
275 Ga0495677_0022500 3300047445 Bacteria 2287
276 Ga0495679_138854 3300047446 Bacteria 657
277 Ga0495685_000382 3300047447 Bacteria 14063
278 Ga0495673_0001031 3300047469 Bacteria 24543
279 Ga0495673_0010080 3300047469 Bacteria 5168
280 Ga0495673_0013592 3300047469 Bacteria 4268
281 Ga0495681_0239548 3300047470 Bacteria 721
282 Ga0495684_0329979 3300047471 Bacteria 1088
283 Ga0495626_0005553 3300048091 Bacteria 7324
284 Ga0495626_0017897 3300048091 Bacteria 3572
285 Ga0495626_0037259 3300048091 Bacteria 2312
286 Ga0496102_0655401 3300048905 Unclassified 973
287 Ga0496102_0658346 3300048905 Bacteria 970
288 Ga0496104_0288914 3300048907 Unclassified 1552
289 Ga0496105_0048780 3300048908 Bacteria 3495
290 Ga0496110_0054191 3300048913 Bacteria 3527
291 Ga0496111_0503912 3300048914 Bacteria 891
292 Ga0496113_0234281 3300048916 Bacteria 1464
293 Ga0496114_0001183 3300048917 Bacteria 19768
294 Ga0496115_0048419 3300048918 Unclassified 3400
295 Ga0496116_0008429 3300048919 Bacteria 8945
296 Ga0496116_0221792 3300048919 Bacteria 968
297 Ga0496117_0001546 3300048920 Bacteria 32720
298 Ga0496117_0005414 3300048920 Bacteria 13429
299 Ga0496117_0011748 3300048920 Bacteria 7806
300 Ga0496117_0044768 3300048920 Bacteria 3203
301 Ga0496118_0001161 3300048921 Bacteria 40611
302 Ga0496118_0003581 3300048921 Bacteria 19339
303 Ga0496118_0011827 3300048921 Bacteria 8466
304 Ga0496118_0013330 3300048921 Bacteria 7786
305 Ga0496118_0088728 3300048921 Bacteria 2138
306 Ga0496118_0409689 3300048921 Bacteria 701
307 Ga0496119_0055803 3300048922 Bacteria 2397
308 Ga0496121_0000556 3300048924 Bacteria 70392
309 Ga0496121_0017646 3300048924 Bacteria 7270
310 Ga0496121_0019579 3300048924 Bacteria 6759
311 Ga0496121_0050962 3300048924 Bacteria 3490
312 Ga0496122_0000005 3300048925 Bacteria 630659
313 Ga0496122_0000394 3300048925 Bacteria 92780
314 Ga0496122_0002240 3300048925 Bacteria 28103
315 Ga0496122_0005898 3300048925 Bacteria 14346
316 Ga0496122_0044061 3300048925 Bacteria 3488
317 Ga0496123_0000008 3300048926 Bacteria 630628
318 Ga0496123_0000055 3300048926 Bacteria 233626
319 Ga0496123_0000668 3300048926 Bacteria 56721
320 Ga0496123_0001070 3300048926 Bacteria 41381
321 Ga0496123_0003370 3300048926 Bacteria 18067
322 Ga0496124_0013906 3300048927 Bacteria 7824
323 Ga0496124_0017681 3300048927 Bacteria 6712
324 Ga0496124_0020180 3300048927 Bacteria 6168
325 Ga0496124_0025224 3300048927 Bacteria 5388
326 Ga0496124_0053227 3300048927 Bacteria 3433
327 Ga0496124_0154937 3300048927 Bacteria 1793
328 Ga0496124_0199386 3300048927 Bacteria 1523
329 Ga0496125_0009655 3300048928 Bacteria 9865
330 Ga0496125_0010907 3300048928 Bacteria 9137
331 Ga0496125_0028523 3300048928 Bacteria 5039
332 Ga0496125_0035772 3300048928 Bacteria 4349
333 Ga0496125_0050806 3300048928 Bacteria 3428
334 Ga0496126_0115755 3300048929 Bacteria 2331
335 Ga0496126_0117660 3300048929 Bacteria 2308
336 Ga0496126_0236640 3300048929 Bacteria 1527
337 Ga0496126_0603841 3300048929 Bacteria 864
338 Ga0496126_0783828 3300048929 Bacteria 733
339 Ga0495678_001336 3300049459 Bacteria 19760
340 Ga0495682_0000270 3300049460 Bacteria 40668
341 Ga0495682_0001865 3300049460 Bacteria 10529
342 Ga0495682_0002969 3300049460 Bacteria 7743
343 Ga0495682_0024122 3300049460 Bacteria 2269
344 Ga0495682_0042778 3300049460 Bacteria 1660
345 Ga0495682_0122181 3300049460 Bacteria 932
346 Ga0501032_0000059 3300049569 Bacteria 96399
347 Ga0501033_0000048 3300049570 Bacteria 120958
348 Ga0501034_0000452 3300049571 Bacteria 67967
349 Ga0501034_0011141 3300049571 Bacteria 9331
350 Ga0501036_0000092 3300049572 Bacteria 56405
351 Ga0501036_0560140 3300049572 Bacteria 949
352 Ga0501037_0000197 3300049573 Bacteria 54709
353 Ga0501038_0000123 3300049574 Bacteria 65136
354 Ga0501039_0006649 3300049575 Bacteria 8785
355 Ga0501043_0000303 3300049579 Bacteria 44666
356 Ga0501046_0178470 3300049580 Bacteria 1589
357 Ga0501047_0045183 3300049581 Bacteria 4258
358 Ga0501035_0000076 3300049822 Bacteria 121548
359 Ga0501044_0000075 3300049823 Bacteria 120819
360 Ga0501044_0191103 3300049823 Bacteria 2010
361 nmdc:mga03683_159003_c1 3300050489 Bacteria 1023
362 nmdc:mga00v17_2479_c1 3300050491 Bacteria 9433
363 nmdc:mga00v17_304747_c1 3300050491 Bacteria 1035
364 nmdc:mga00v17_45122_c1 3300050491 Bacteria 2662
365 nmdc:mga00v17_70341_c1 3300050491 Bacteria 2167
366 nmdc:mga0yw44_66494_c1 3300050492 Bacteria 2224
367 nmdc:mga0k408_23691_c1 3300050493 Bacteria 3466
368 nmdc:mga06z11_508605_c1 3300050494 Bacteria 730
369 nmdc:mga07m45_18265_c1 3300050496 Bacteria 3782
370 nmdc:mga05p37_361237_c1 3300050507 Bacteria 1707
371 nmdc:mga0qj67_140821_c1 3300050509 Bacteria 1956
372 nmdc:mga0qj67_16877_c1 3300050509 Bacteria 5545
373 nmdc:mga0qj67_177541_c1 3300050509 Bacteria 1730
374 nmdc:mga0qj67_470969_c1 3300050509 Bacteria 1011
375 nmdc:mga08x19_145803_c1 3300050514 Bacteria 1601
376 nmdc:mga08x19_61352_c1 3300050514 Bacteria 2436
377 nmdc:mga0sz30_166430_c1 3300050516 Bacteria 977
378 nmdc:mga0sz30_17952_c1 3300050516 Bacteria 2827
379 nmdc:mga0sz30_6745_c1 3300050516 Bacteria 4280
380 Ga0500635_0007037 3300053080 Bacteria 3034
381 Ga0500578_0111842 3300053086 Bacteria 1721
382 Ga0500647_0084318 3300053091 Bacteria 1524
383 Ga0500566_0149792 3300053094 Bacteria 1228
384 Ga0500595_049662 3300053119 Bacteria 1306
385 Ga0500597_174046 3300053120 Bacteria 916
386 Ga0500590_073758 3300053148 Bacteria 1691
387 Ga0500634_0001100 3300053161 Bacteria 10019
388 Ga0500638_145437 3300053162 Bacteria 1060
389 Ga0500636_0031853 3300053177 Bacteria 3119
390 Ga0500637_0229626 3300053178 Bacteria 1045
391 Ga0500657_070680 3300053728 Bacteria 1530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0044247 Ga0495589_0044247_1134_1721 187
2 iso_pu_bacteria 2884693830 2884693941 188
3 iso_pu_bacteria 2895442618 2895448224 188
4 iso_pu_bacteria 8005314921 8005316242 188
5 iso_pu_bacteria 2939568625 2939569045 189
6 iso_pu_bacteria 2939642701 2939643906 189
7 3300025728 Ga0207655_1071043 Ga0207655_10710432 190
8 3300048919 Ga0496116_0221792 Ga0496116_0221792_365_937 190
9 3300048925 Ga0496122_0005898 Ga0496122_0005898_7108_7680 190
10 3300048926 Ga0496123_0003370 Ga0496123_0003370_7108_7680 190
11 iso_pu_bacteria 2510917022 2511131497 190
12 iso_pu_bacteria 2511231004 2511257026 190
13 iso_pu_bacteria 2511231007 2511274791 190
14 iso_pu_bacteria 2511231011 2511298373 190
15 iso_pu_bacteria 2511231014 2511313367 190
16 iso_pu_bacteria 2511231015 2511319078 190
17 iso_pu_bacteria 2511231015 2511320138 190
18 iso_pu_bacteria 2511231016 2511324288 190
19 iso_pu_bacteria 2511231017 2511331874 190
20 iso_pu_bacteria 2511231017 2511332923 190
21 iso_pu_bacteria 2511231018 2511338588 190
22 iso_pu_bacteria 2511231022 2511361045 190
23 iso_pu_bacteria 2558860112 2558911100 190
24 iso_pu_bacteria 2602042107 2603859652 190
25 iso_pu_bacteria 2740892503 2743738676 190
26 iso_pu_bacteria 2791355199 2793078754 190
27 iso_pu_bacteria 2870782633 2870784686 190
28 iso_pu_bacteria 2876761206 2876764717 190
29 iso_pu_bacteria 2901300506 2901305802 190
30 iso_pu_bacteria 2923153595 2923157741 190
31 iso_pu_bacteria 2928070936 2928071526 190
32 3300035695 Ga0373927_0021468 Ga0373927_0021468_3472_4047 191
33 3300037068 Ga0373925_0024737 Ga0373925_0024737_2341_2916 191
34 iso_pu_bacteria 2585428058 2587732304 191
35 iso_pu_bacteria 2738541272 2738697247 192
36 iso_pu_bacteria 2738543027 2739326853 192
37 3300006846 Ga0075430_100102662 Ga0075430_1001026623 193
38 3300006846 Ga0075430_100539060 Ga0075430_1005390601 193
39 3300006946 Ga0079104_1030356 Ga0079104_10303562 193
40 3300009011 Ga0105251_10060609 Ga0105251_100606092 193
41 3300009011 Ga0105251_10097861 Ga0105251_100978612 193
42 3300009092 Ga0105250_10000172 Ga0105250_1000017224 193
43 3300011119 Ga0105246_10123093 Ga0105246_101230932 193
44 3300017792 Ga0163161_10084255 Ga0163161_100842552 193
45 3300025711 Ga0207696_1000038 Ga0207696_100003824 193
46 3300025711 Ga0207696_1002798 Ga0207696_10027987 193
47 3300025728 Ga0207655_1000001 Ga0207655_10000011277 193
48 3300025728 Ga0207655_1004053 Ga0207655_10040535 193
49 3300025735 Ga0207713_1024117 Ga0207713_10241172 193
50 3300025735 Ga0207713_1050460 Ga0207713_10504602 193
51 3300047446 Ga0495679_138854 Ga0495679_138854_53_634 193
52 3300048908 Ga0496105_0048780 Ga0496105_0048780_2797_3378 193
53 3300048919 Ga0496116_0008429 Ga0496116_0008429_6525_7106 193
54 3300048920 Ga0496117_0001546 Ga0496117_0001546_1348_1929 193
55 3300048921 Ga0496118_0001161 Ga0496118_0001161_2563_3144 193
56 3300048921 Ga0496118_0011827 Ga0496118_0011827_5222_5803 193
57 3300048922 Ga0496119_0055803 Ga0496119_0055803_594_1175 193
58 3300048924 Ga0496121_0050962 Ga0496121_0050962_2481_3062 193
59 3300048925 Ga0496122_0000005 Ga0496122_0000005_170008_170589 193
60 3300048926 Ga0496123_0000008 Ga0496123_0000008_460040_460621 193
61 3300048927 Ga0496124_0025224 Ga0496124_0025224_3022_3603 193
62 3300048927 Ga0496124_0053227 Ga0496124_0053227_976_1557 193
63 3300048927 Ga0496124_0199386 Ga0496124_0199386_443_1024 193
64 3300048928 Ga0496125_0009655 Ga0496125_0009655_4752_5333 193
65 3300048928 Ga0496125_0035772 Ga0496125_0035772_3485_4066 193
66 3300048929 Ga0496126_0236640 Ga0496126_0236640_895_1476 193
67 3300050491 nmdc:mga00v17_2479_c1 nmdc:mga00v17_2479_c1_728_1309 193
68 3300050509 nmdc:mga0qj67_140821_c1 nmdc:mga0qj67_140821_c1_1019_1600 193
69 3300050509 nmdc:mga0qj67_177541_c1 nmdc:mga0qj67_177541_c1_252_833 193
70 2124908027 MRS2a_Contig_338 MRS2a_00235440 194
71 2162886011 MRS1b_contig_3203502 MRS1b_0301.00001100 194
72 2162886012 MBSR1b_contig_10475904 MBSR1b_0727.00003760 194
73 3300003354 JGI25160J50197_1001877 JGI25160J50197_10018778 194
74 3300005288 Ga0065714_10000604 Ga0065714_100006041 194
75 3300005288 Ga0065714_10170344 Ga0065714_101703441 194
76 3300005290 Ga0065712_10070640 Ga0065712_100706406 194
77 3300005293 Ga0065715_10004625 Ga0065715_100046252 194
78 3300005295 Ga0065707_10330287 Ga0065707_103302872 194
79 3300005295 Ga0065707_10523848 Ga0065707_105238481 194
80 3300005347 Ga0070668_100169522 Ga0070668_1001695222 194
81 3300005347 Ga0070668_101396452 Ga0070668_1013964521 194
82 3300005353 Ga0070669_100274265 Ga0070669_1002742652 194
83 3300005355 Ga0070671_100107000 Ga0070671_1001070003 194
84 3300005367 Ga0070667_100018854 Ga0070667_1000188541 194
85 3300005436 Ga0070713_101022863 Ga0070713_1010228631 194
86 3300005439 Ga0070711_100089845 Ga0070711_1000898454 194
87 3300005441 Ga0070700_100039020 Ga0070700_1000390203 194
88 3300005444 Ga0070694_100122757 Ga0070694_1001227572 194
89 3300005445 Ga0070708_100720870 Ga0070708_1007208701 194
90 3300005457 Ga0070662_100064867 Ga0070662_1000648672 194
91 3300005457 Ga0070662_100403820 Ga0070662_1004038202 194
92 3300005467 Ga0070706_100452932 Ga0070706_1004529322 194
93 3300005471 Ga0070698_100030884 Ga0070698_1000308844 194
94 3300005518 Ga0070699_100079297 Ga0070699_1000792972 194
95 3300005546 Ga0070696_100160090 Ga0070696_1001600902 194
96 3300005548 Ga0070665_100331557 Ga0070665_1003315572 194
97 3300005549 Ga0070704_100297422 Ga0070704_1002974222 194
98 3300005578 Ga0068854_100184990 Ga0068854_1001849902 194
99 3300005617 Ga0068859_100515486 Ga0068859_1005154862 194
100 3300005719 Ga0068861_100043105 Ga0068861_1000431052 194
101 3300005842 Ga0068858_100287535 Ga0068858_1002875351 194
102 3300005843 Ga0068860_100047364 Ga0068860_1000473642 194
103 3300005844 Ga0068862_100042538 Ga0068862_1000425384 194
104 3300005844 Ga0068862_100090400 Ga0068862_1000904004 194
105 3300006038 Ga0075365_10035509 Ga0075365_100355095 194
106 3300006051 Ga0075364_10021278 Ga0075364_100212784 194
107 3300006051 Ga0075364_10134088 Ga0075364_101340883 194
108 3300006058 Ga0075432_10000482 Ga0075432_100004825 194
109 3300006058 Ga0075432_10034798 Ga0075432_100347983 194
110 3300006058 Ga0075432_10037904 Ga0075432_100379042 194
111 3300006175 Ga0070712_100015748 Ga0070712_1000157484 194
112 3300006177 Ga0075362_10019042 Ga0075362_100190422 194
113 3300006178 Ga0075367_10060635 Ga0075367_100606353 194
114 3300006178 Ga0075367_10505365 Ga0075367_105053651 194
115 3300006178 Ga0075367_10577840 Ga0075367_105778402 194
116 3300006186 Ga0075369_10008520 Ga0075369_100085203 194
117 3300006186 Ga0075369_10009038 Ga0075369_100090383 194
118 3300006237 Ga0097621_100003925 Ga0097621_1000039256 194
119 3300006358 Ga0068871_100016391 Ga0068871_1000163913 194
120 3300006846 Ga0075430_100104792 Ga0075430_1001047922 194
121 3300006846 Ga0075430_100252160 Ga0075430_1002521602 194
122 3300006914 Ga0075436_100072308 Ga0075436_1000723082 194
123 3300006914 Ga0075436_100077811 Ga0075436_1000778112 194
124 3300006931 Ga0097620_100515537 Ga0097620_1005155372 194
125 3300006944 Ga0099823_1000006 Ga0099823_100000640 194
126 3300007265 Ga0099794_10108216 Ga0099794_101082162 194
127 3300009011 Ga0105251_10005580 Ga0105251_100055803 194
128 3300009011 Ga0105251_10014208 Ga0105251_100142085 194
129 3300009011 Ga0105251_10027370 Ga0105251_100273703 194
130 3300009011 Ga0105251_10031875 Ga0105251_100318752 194
131 3300009036 Ga0105244_10001696 Ga0105244_100016963 194
132 3300009036 Ga0105244_10013552 Ga0105244_100135526 194
133 3300009036 Ga0105244_10045041 Ga0105244_100450412 194
134 3300009036 Ga0105244_10095567 Ga0105244_100955672 194
135 3300009092 Ga0105250_10002321 Ga0105250_100023214 194
136 3300009092 Ga0105250_10008055 Ga0105250_100080552 194
137 3300009092 Ga0105250_10039284 Ga0105250_100392843 194
138 3300009092 Ga0105250_10087472 Ga0105250_100874722 194
139 3300009093 Ga0105240_10060024 Ga0105240_100600246 194
140 3300009098 Ga0105245_10676321 Ga0105245_106763211 194
141 3300009147 Ga0114129_10437603 Ga0114129_104376032 194
142 3300009176 Ga0105242_10030883 Ga0105242_100308832 194
143 3300009177 Ga0105248_10053607 Ga0105248_100536073 194
144 3300009545 Ga0105237_10211488 Ga0105237_102114882 194
145 3300009551 Ga0105238_10592186 Ga0105238_105921862 194
146 3300009553 Ga0105249_10027754 Ga0105249_100277545 194
147 3300010375 Ga0105239_10140387 Ga0105239_101403873 194
148 3300010375 Ga0105239_10240379 Ga0105239_102403792 194
149 3300010375 Ga0105239_11419651 Ga0105239_114196511 194
150 3300013102 Ga0157371_10247696 Ga0157371_102476962 194
151 3300013104 Ga0157370_10039637 Ga0157370_100396375 194
152 3300013104 Ga0157370_10300853 Ga0157370_103008532 194
153 3300013104 Ga0157370_10565222 Ga0157370_105652222 194
154 3300013296 Ga0157374_10098425 Ga0157374_100984251 194
155 3300013296 Ga0157374_10419585 Ga0157374_104195852 194
156 3300013297 Ga0157378_10032773 Ga0157378_100327738 194
157 3300013306 Ga0163162_10001032 Ga0163162_1000103227 194
158 3300013306 Ga0163162_10181419 Ga0163162_101814192 194
159 3300013306 Ga0163162_10869268 Ga0163162_108692681 194
160 3300013308 Ga0157375_10083847 Ga0157375_100838473 194
161 3300014497 Ga0182008_10010369 Ga0182008_100103695 194
162 3300014969 Ga0157376_10004542 Ga0157376_100045429 194
163 3300014969 Ga0157376_10008702 Ga0157376_100087026 194
164 3300015261 Ga0182006_1049060 Ga0182006_10490602 194
165 3300015262 Ga0182007_10062142 Ga0182007_100621422 194
166 3300015265 Ga0182005_1003810 Ga0182005_10038102 194
167 3300015265 Ga0182005_1004573 Ga0182005_10045735 194
168 3300017792 Ga0163161_10025379 Ga0163161_100253793 194
169 3300017792 Ga0163161_10067631 Ga0163161_100676311 194
170 3300017792 Ga0163161_10076241 Ga0163161_100762413 194
171 3300017792 Ga0163161_10135989 Ga0163161_101359892 194
172 3300017792 Ga0163161_10292642 Ga0163161_102926422 194
173 3300017792 Ga0163161_10554304 Ga0163161_105543041 194
174 3300021361 Ga0213872_10000185 Ga0213872_1000018538 194
175 3300021361 Ga0213872_10041460 Ga0213872_100414603 194
176 3300025230 Ga0209563_100751 Ga0209563_1007516 194
177 3300025256 Ga0209759_1001198 Ga0209759_100119813 194
178 3300025297 Ga0209758_1010734 Ga0209758_10107342 194
179 3300025302 Ga0207426_1000278 Ga0207426_10002787 194
180 3300025303 Ga0209051_1006469 Ga0209051_10064695 194
181 3300025303 Ga0209051_1038681 Ga0209051_10386812 194
182 3300025304 Ga0209257_1020554 Ga0209257_10205542 194
183 3300025711 Ga0207696_1001477 Ga0207696_100147711 194
184 3300025711 Ga0207696_1004238 Ga0207696_10042385 194
185 3300025711 Ga0207696_1007785 Ga0207696_10077855 194
186 3300025728 Ga0207655_1000077 Ga0207655_1000077113 194
187 3300025728 Ga0207655_1011372 Ga0207655_10113726 194
188 3300025728 Ga0207655_1022912 Ga0207655_10229122 194
189 3300025728 Ga0207655_1067565 Ga0207655_10675652 194
190 3300025728 Ga0207655_1087676 Ga0207655_10876762 194
191 3300025735 Ga0207713_1002310 Ga0207713_10023105 194
192 3300025735 Ga0207713_1006978 Ga0207713_10069782 194
193 3300025735 Ga0207713_1020449 Ga0207713_10204492 194
194 3300025735 Ga0207713_1030951 Ga0207713_10309512 194
195 3300025903 Ga0207680_10044158 Ga0207680_100441581 194
196 3300025910 Ga0207684_10632190 Ga0207684_106321902 194
197 3300025914 Ga0207671_10093143 Ga0207671_100931432 194
198 3300025914 Ga0207671_10435084 Ga0207671_104350841 194
199 3300025915 Ga0207693_10037687 Ga0207693_100376878 194
200 3300025916 Ga0207663_10112713 Ga0207663_101127132 194
201 3300025923 Ga0207681_10179434 Ga0207681_101794343 194
202 3300025933 Ga0207706_10163108 Ga0207706_101631082 194
203 3300025933 Ga0207706_10296913 Ga0207706_102969131 194
204 3300025934 Ga0207686_10038908 Ga0207686_100389084 194
205 3300025941 Ga0207711_10156133 Ga0207711_101561333 194
206 3300025942 Ga0207689_10033290 Ga0207689_100332903 194
207 3300025949 Ga0207667_10083262 Ga0207667_100832622 194
208 3300025961 Ga0207712_10048184 Ga0207712_100481843 194
209 3300025972 Ga0207668_10011403 Ga0207668_100114035 194
210 3300025986 Ga0207658_10048924 Ga0207658_100489244 194
211 3300026035 Ga0207703_10773648 Ga0207703_107736481 194
212 3300026075 Ga0207708_10120929 Ga0207708_101209291 194
213 3300026078 Ga0207702_10332980 Ga0207702_103329802 194
214 3300026118 Ga0207675_100040598 Ga0207675_1000405984 194
215 3300027296 Ga0209389_1000030 Ga0209389_100003040 194
216 3300027907 Ga0207428_10028891 Ga0207428_100288914 194
217 3300027907 Ga0207428_10065027 Ga0207428_100650272 194
218 3300027907 Ga0207428_10095644 Ga0207428_100956444 194
219 3300027907 Ga0207428_10127369 Ga0207428_101273691 194
220 3300028380 Ga0268265_10012342 Ga0268265_100123423 194
221 3300028381 Ga0268264_10092062 Ga0268264_100920624 194
222 3300028786 Ga0307517_10016705 Ga0307517_100167055 194
223 3300030521 Ga0307511_10082716 Ga0307511_100827161 194
224 3300031507 Ga0307509_10505202 Ga0307509_105052021 194
225 3300031616 Ga0307508_10092717 Ga0307508_100927172 194
226 3300031616 Ga0307508_10158140 Ga0307508_101581403 194
227 3300031911 Ga0307412_10084253 Ga0307412_100842532 194
228 3300033179 Ga0307507_10010483 Ga0307507_100104832 194
229 3300035171 Ga0373946_0120114 Ga0373946_0120114_186_773 194
230 3300035692 Ga0373935_0297710 Ga0373935_0297710_75_662 194
231 3300035695 Ga0373927_0011247 Ga0373927_0011247_3038_3625 194
232 3300037068 Ga0373925_0017860 Ga0373925_0017860_3883_4521 194
233 3300039447 Ga0436361_0245698 Ga0436361_0245698_278_874 194
234 3300039447 Ga0436361_1000817 Ga0436361_1000817_4016_4603 194
235 3300042013 Ga0439456_014175 Ga0439456_014175_217_801 194
236 3300045051 Ga0451576_0013698 Ga0451576_0013698_3166_3750 194
237 3300046452 Ga0495617_000093 Ga0495617_000093_21500_22207 194
238 3300046452 Ga0495617_002639 Ga0495617_002639_5198_5782 194
239 3300046455 Ga0495603_0261756 Ga0495603_0261756_49_633 194
240 3300046460 Ga0495638_0000112 Ga0495638_0000112_102371_102961 194
241 3300046460 Ga0495638_0002552 Ga0495638_0002552_8983_9567 194
242 3300046460 Ga0495638_0012520 Ga0495638_0012520_2196_2780 194
243 3300046460 Ga0495638_0025425 Ga0495638_0025425_453_1037 194
244 3300046471 Ga0495650_0000675 Ga0495650_0000675_21536_22243 194
245 3300046472 Ga0495580_0286232 Ga0495580_0286232_182_769 194
246 3300046474 Ga0495605_0000211 Ga0495605_0000211_21325_22032 194
247 3300046474 Ga0495605_0008393 Ga0495605_0008393_3417_4001 194
248 3300046474 Ga0495605_0016671 Ga0495605_0016671_1968_2552 194
249 3300046491 Ga0495584_0000063 Ga0495584_0000063_50048_50632 194
250 3300046491 Ga0495584_0039934 Ga0495584_0039934_1584_2168 194
251 3300046492 Ga0495585_0004519 Ga0495585_0004519_4570_5154 194
252 3300046499 Ga0495594_0000547 Ga0495594_0000547_10280_10867 194
253 3300046499 Ga0495594_0039977 Ga0495594_0039977_1850_2434 194
254 3300046501 Ga0495607_0000091 Ga0495607_0000091_3590_4174 194
255 3300046501 Ga0495607_0000293 Ga0495607_0000293_31723_32430 194
256 3300046501 Ga0495607_0009586 Ga0495607_0009586_5902_6486 194
257 3300046501 Ga0495607_0153451 Ga0495607_0153451_44_628 194
258 3300046506 Ga0495583_0002334 Ga0495583_0002334_12421_13005 194
259 3300046506 Ga0495583_0009985 Ga0495583_0009985_1189_1773 194
260 3300046513 Ga0495616_0015558 Ga0495616_0015558_2645_3229 194
261 3300046517 Ga0495630_0000514 Ga0495630_0000514_7234_7818 194
262 3300046518 Ga0495631_0030396 Ga0495631_0030396_844_1428 194
263 3300046518 Ga0495631_0054472 Ga0495631_0054472_585_1292 194
264 3300046519 Ga0495632_0004522 Ga0495632_0004522_2387_2986 194
265 3300046519 Ga0495632_0036496 Ga0495632_0036496_1326_1910 194
266 3300046520 Ga0495637_0000331 Ga0495637_0000331_11747_12331 194
267 3300046522 Ga0495643_0001324 Ga0495643_0001324_99_683 194
268 3300046523 Ga0495644_0118738 Ga0495644_0118738_222_806 194
269 3300046524 Ga0495648_0000428 Ga0495648_0000428_11682_12266 194
270 3300046524 Ga0495648_0010086 Ga0495648_0010086_98_682 194
271 3300046524 Ga0495648_0017316 Ga0495648_0017316_2667_3251 194
272 3300046524 Ga0495648_0028242 Ga0495648_0028242_3066_3650 194
273 3300046526 Ga0495666_0038926 Ga0495666_0038926_494_1081 194
274 3300046528 Ga0495642_0043026 Ga0495642_0043026_128_835 194
275 3300046530 Ga0495654_0007210 Ga0495654_0007210_2101_2808 194
276 3300046538 Ga0495609_0000131 Ga0495609_0000131_13399_13983 194
277 3300046538 Ga0495609_0015212 Ga0495609_0015212_2656_3240 194
278 3300046538 Ga0495609_0042362 Ga0495609_0042362_1194_1901 194
279 3300046542 Ga0495597_0010339 Ga0495597_0010339_2489_3196 194
280 3300046557 Ga0495622_0001174 Ga0495622_0001174_9665_10252 194
281 3300046557 Ga0495622_0011010 Ga0495622_0011010_435_1019 194
282 3300046557 Ga0495622_0025609 Ga0495622_0025609_2050_2634 194
283 3300046615 Ga0495656_0072168 Ga0495656_0072168_473_1057 194
284 3300046616 Ga0495668_0150075 Ga0495668_0150075_432_1031 194
285 3300046648 Ga0495611_0000366 Ga0495611_0000366_9511_10218 194
286 3300046648 Ga0495611_0004339 Ga0495611_0004339_1774_2358 194
287 3300046660 Ga0495625_0022404 Ga0495625_0022404_4169_4753 194
288 3300046660 Ga0495625_0070176 Ga0495625_0070176_1669_2253 194
289 3300046660 Ga0495625_0078178 Ga0495625_0078178_183_767 194
290 3300046660 Ga0495625_0202520 Ga0495625_0202520_529_1128 194
291 3300046660 Ga0495625_0231173 Ga0495625_0231173_367_954 194
292 3300046660 Ga0495625_0351627 Ga0495625_0351627_73_660 194
293 3300046664 Ga0495659_0006228 Ga0495659_0006228_2744_3328 194
294 3300046664 Ga0495659_0029035 Ga0495659_0029035_1130_1837 194
295 3300046665 Ga0495661_0003347 Ga0495661_0003347_7943_8527 194
296 3300046665 Ga0495661_0127313 Ga0495661_0127313_143_727 194
297 3300046674 Ga0495588_0061177 Ga0495588_0061177_1096_1680 194
298 3300046684 Ga0495669_0053727 Ga0495669_0053727_238_822 194
299 3300046689 Ga0495613_0108773 Ga0495613_0108773_1011_1601 194
300 3300046691 Ga0495670_0006095 Ga0495670_0006095_219_803 194
301 3300046691 Ga0495670_0028044 Ga0495670_0028044_187_894 194
302 3300046692 Ga0495671_0000137 Ga0495671_0000137_26096_26680 194
303 3300046692 Ga0495671_0005908 Ga0495671_0005908_4171_4755 194
304 3300046692 Ga0495671_0124539 Ga0495671_0124539_514_1221 194
305 3300046694 Ga0495649_0060131 Ga0495649_0060131_1194_1901 194
306 3300046694 Ga0495649_0214329 Ga0495649_0214329_278_862 194
307 3300046794 Ga0495589_0000498 Ga0495589_0000498_20445_21152 194
308 3300046810 Ga0495660_0004884 Ga0495660_0004884_3842_4426 194
309 3300046810 Ga0495660_0072162 Ga0495660_0072162_541_1128 194
310 3300047317 Ga0495604_0122566 Ga0495604_0122566_648_1232 194
311 3300047318 Ga0495636_0000604 Ga0495636_0000604_5926_6510 194
312 3300047318 Ga0495636_0011584 Ga0495636_0011584_2638_3222 194
313 3300047318 Ga0495636_0014331 Ga0495636_0014331_1250_1957 194
314 3300047318 Ga0495636_0022708 Ga0495636_0022708_1386_1970 194
315 3300047318 Ga0495636_0024747 Ga0495636_0024747_934_1518 194
316 3300047320 Ga0495672_0000210 Ga0495672_0000210_63841_64548 194
317 3300047320 Ga0495672_0012924 Ga0495672_0012924_5145_5729 194
318 3300047320 Ga0495672_0017597 Ga0495672_0017597_2163_2747 194
319 3300047320 Ga0495672_0019130 Ga0495672_0019130_390_974 194
320 3300047323 Ga0495683_0005114 Ga0495683_0005114_5718_6302 194
321 3300047323 Ga0495683_0020509 Ga0495683_0020509_403_987 194
322 3300047443 Ga0495687_001370 Ga0495687_001370_5193_5780 194
323 3300047443 Ga0495687_016841 Ga0495687_016841_568_1167 194
324 3300047443 Ga0495687_041559 Ga0495687_041559_116_823 194
325 3300047444 Ga0495675_0017700 Ga0495675_0017700_3301_3885 194
326 3300047445 Ga0495677_0022500 Ga0495677_0022500_1239_1823 194
327 3300047447 Ga0495685_000382 Ga0495685_000382_1005_1589 194
328 3300047469 Ga0495673_0001031 Ga0495673_0001031_13435_14142 194
329 3300047469 Ga0495673_0010080 Ga0495673_0010080_227_811 194
330 3300047469 Ga0495673_0013592 Ga0495673_0013592_1354_1938 194
331 3300047470 Ga0495681_0239548 Ga0495681_0239548_102_686 194
332 3300047471 Ga0495684_0329979 Ga0495684_0329979_131_715 194
333 3300048091 Ga0495626_0005553 Ga0495626_0005553_4920_5504 194
334 3300048091 Ga0495626_0017897 Ga0495626_0017897_133_717 194
335 3300048091 Ga0495626_0037259 Ga0495626_0037259_1474_2073 194
336 3300048905 Ga0496102_0655401 Ga0496102_0655401_370_957 194
337 3300048905 Ga0496102_0658346 Ga0496102_0658346_273_860 194
338 3300048907 Ga0496104_0288914 Ga0496104_0288914_602_1189 194
339 3300048913 Ga0496110_0054191 Ga0496110_0054191_1342_1926 194
340 3300048914 Ga0496111_0503912 Ga0496111_0503912_40_624 194
341 3300048916 Ga0496113_0234281 Ga0496113_0234281_113_697 194
342 3300048917 Ga0496114_0001183 Ga0496114_0001183_8219_8803 194
343 3300048918 Ga0496115_0048419 Ga0496115_0048419_2603_3190 194
344 3300048920 Ga0496117_0005414 Ga0496117_0005414_8163_8747 194
345 3300048920 Ga0496117_0011748 Ga0496117_0011748_6537_7121 194
346 3300048920 Ga0496117_0044768 Ga0496117_0044768_1056_1643 194
347 3300048921 Ga0496118_0003581 Ga0496118_0003581_8050_8634 194
348 3300048921 Ga0496118_0013330 Ga0496118_0013330_669_1253 194
349 3300048921 Ga0496118_0088728 Ga0496118_0088728_1483_2070 194
350 3300048921 Ga0496118_0409689 Ga0496118_0409689_100_684 194
351 3300048924 Ga0496121_0000556 Ga0496121_0000556_43228_43812 194
352 3300048924 Ga0496121_0017646 Ga0496121_0017646_6507_7091 194
353 3300048924 Ga0496121_0019579 Ga0496121_0019579_2572_3156 194
354 3300048925 Ga0496122_0000394 Ga0496122_0000394_31328_31912 194
355 3300048925 Ga0496122_0002240 Ga0496122_0002240_23722_24306 194
356 3300048925 Ga0496122_0044061 Ga0496122_0044061_1115_1702 194
357 3300048926 Ga0496123_0000055 Ga0496123_0000055_172174_172758 194
358 3300048926 Ga0496123_0000668 Ga0496123_0000668_52993_53580 194
359 3300048926 Ga0496123_0001070 Ga0496123_0001070_38042_38626 194
360 3300048927 Ga0496124_0013906 Ga0496124_0013906_5116_5700 194
361 3300048927 Ga0496124_0017681 Ga0496124_0017681_4132_4716 194
362 3300048927 Ga0496124_0020180 Ga0496124_0020180_2450_3034 194
363 3300048927 Ga0496124_0154937 Ga0496124_0154937_238_822 194
364 3300048928 Ga0496125_0010907 Ga0496125_0010907_5733_6317 194
365 3300048928 Ga0496125_0028523 Ga0496125_0028523_4050_4634 194
366 3300048928 Ga0496125_0050806 Ga0496125_0050806_1366_1953 194
367 3300048929 Ga0496126_0115755 Ga0496126_0115755_134_718 194
368 3300048929 Ga0496126_0117660 Ga0496126_0117660_987_1574 194
369 3300048929 Ga0496126_0603841 Ga0496126_0603841_15_599 194
370 3300048929 Ga0496126_0783828 Ga0496126_0783828_118_705 194
371 3300049459 Ga0495678_001336 Ga0495678_001336_11695_12279 194
372 3300049460 Ga0495682_0000270 Ga0495682_0000270_2617_3201 194
373 3300049460 Ga0495682_0001865 Ga0495682_0001865_9521_10105 194
374 3300049460 Ga0495682_0002969 Ga0495682_0002969_2239_2823 194
375 3300049460 Ga0495682_0024122 Ga0495682_0024122_1194_1901 194
376 3300049460 Ga0495682_0042778 Ga0495682_0042778_704_1288 194
377 3300049460 Ga0495682_0122181 Ga0495682_0122181_299_883 194
378 3300049569 Ga0501032_0000059 Ga0501032_0000059_47693_48322 194
379 3300049570 Ga0501033_0000048 Ga0501033_0000048_54842_55471 194
380 3300049571 Ga0501034_0000452 Ga0501034_0000452_54814_55443 194
381 3300049571 Ga0501034_0011141 Ga0501034_0011141_5525_6181 194
382 3300049572 Ga0501036_0000092 Ga0501036_0000092_54814_55443 194
383 3300049572 Ga0501036_0560140 Ga0501036_0560140_258_914 194
384 3300049573 Ga0501037_0000197 Ga0501037_0000197_9090_9719 194
385 3300049574 Ga0501038_0000123 Ga0501038_0000123_9693_10322 194
386 3300049575 Ga0501039_0006649 Ga0501039_0006649_6172_6756 194
387 3300049579 Ga0501043_0000303 Ga0501043_0000303_37697_38326 194
388 3300049580 Ga0501046_0178470 Ga0501046_0178470_754_1383 194
389 3300049581 Ga0501047_0045183 Ga0501047_0045183_498_1127 194
390 3300049822 Ga0501035_0000076 Ga0501035_0000076_54842_55471 194
391 3300049823 Ga0501044_0000075 Ga0501044_0000075_54815_55444 194
392 3300049823 Ga0501044_0191103 Ga0501044_0191103_1123_1710 194
393 3300050489 nmdc:mga03683_159003_c1 nmdc:mga03683_159003_c1_256_840 194
394 3300050491 nmdc:mga00v17_304747_c1 nmdc:mga00v17_304747_c1_135_719 194
395 3300050491 nmdc:mga00v17_45122_c1 nmdc:mga00v17_45122_c1_1727_2311 194
396 3300050491 nmdc:mga00v17_70341_c1 nmdc:mga00v17_70341_c1_431_1018 194
397 3300050492 nmdc:mga0yw44_66494_c1 nmdc:mga0yw44_66494_c1_786_1370 194
398 3300050493 nmdc:mga0k408_23691_c1 nmdc:mga0k408_23691_c1_312_899 194
399 3300050494 nmdc:mga06z11_508605_c1 nmdc:mga06z11_508605_c1_57_644 194
400 3300050496 nmdc:mga07m45_18265_c1 nmdc:mga07m45_18265_c1_24_608 194
401 3300050507 nmdc:mga05p37_361237_c1 nmdc:mga05p37_361237_c1_442_1026 194
402 3300050509 nmdc:mga0qj67_16877_c1 nmdc:mga0qj67_16877_c1_4897_5481 194
403 3300050509 nmdc:mga0qj67_470969_c1 nmdc:mga0qj67_470969_c1_177_761 194
404 3300050514 nmdc:mga08x19_145803_c1 nmdc:mga08x19_145803_c1_544_1128 194
405 3300050514 nmdc:mga08x19_61352_c1 nmdc:mga08x19_61352_c1_1452_2036 194
406 3300050516 nmdc:mga0sz30_166430_c1 nmdc:mga0sz30_166430_c1_307_894 194
407 3300050516 nmdc:mga0sz30_17952_c1 nmdc:mga0sz30_17952_c1_488_1075 194
408 3300050516 nmdc:mga0sz30_6745_c1 nmdc:mga0sz30_6745_c1_267_851 194
409 3300053080 Ga0500635_0007037 Ga0500635_0007037_1470_2057 194
410 3300053086 Ga0500578_0111842 Ga0500578_0111842_555_1139 194
411 3300053091 Ga0500647_0084318 Ga0500647_0084318_48_635 194
412 3300053094 Ga0500566_0149792 Ga0500566_0149792_170_757 194
413 3300053119 Ga0500595_049662 Ga0500595_049662_504_1091 194
414 3300053120 Ga0500597_174046 Ga0500597_174046_176_763 194
415 3300053148 Ga0500590_073758 Ga0500590_073758_496_1083 194
416 3300053161 Ga0500634_0001100 Ga0500634_0001100_3170_3754 194
417 3300053162 Ga0500638_145437 Ga0500638_145437_273_860 194
418 3300053177 Ga0500636_0031853 Ga0500636_0031853_2150_2737 194
419 3300053178 Ga0500637_0229626 Ga0500637_0229626_416_1003 194
420 3300053728 Ga0500657_070680 Ga0500657_070680_325_912 194
421 iso_pu_bacteria 2582581314 2585312210 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

52

208

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9531 1 187
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.9517 1 187
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.916 1 192
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9102 1 187
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9068 1 192
ID Description Score Start End Superfamily
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9428 1 187 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8848 5 192 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8817 1 187 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8814 4 186 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8774 1 187 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A1H2J558-F1-model_v4 deleted 0.9872 1 158
AF-A8L391-F1-model_v4 deleted 0.9842 1 188
AF-Q2W215-F1-model_v4 Amidase related to nicotinamidase 0.9794 4 189
AF-V5BRD7-F1-model_v4 Isochorismatase hydrolase 0.9789 1 112 GO:0016787
AF-S9RWT0-F1-model_v4 deleted 0.9773 2 187

Feature Viewer

pLDDT pTM Quality
93.1 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map