F440049

General Info

Members Datasets Scaffolds Average Seq Length
421 214 421 260

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0871307|Ga0436360_0871307_3341_4153
Length 270
Sequence MTGKAMKSRFLRLKPSGQRIEVVDAGPSGKKGGRDLFFLHGAGGHLPNDPLIATLATKYRVVAPLLPGYGRSEGEDGLRDMLDVALHALDVLDACKLDKPIVVGHSMGGMIAAEMAAIAHTEIAKLCLLAPAGLWLDDHPVADIFSKLPYELPGLLFHDAEAGQRLLATGGNMEDPEFLKQFLVMNARRLGMAGKLLFPIPDRGLAQRLYRISAKTLIVWGEEDVLIPPVYGDAFKKAVSKSKLVAIAGAGHAVGQEKPQAVLDAIRKFF

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 0
Rhizoplane 2.85
Rhizosphere 86.46
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10030085 3300003215 Bacteria 1853
2 rootH2_10005141 3300003320 Bacteria 21935
3 Ga0055530_10000696 3300003791 Bacteria 28367
4 Ga0055531_10003665 3300003794 Bacteria 9685
5 Ga0055531_10017307 3300003794 Bacteria 3052
6 Ga0055543_1032831 3300004625 Bacteria 900
7 Ga0065165_1000702 3300005262 Bacteria 47623
8 Ga0070658_10011045 3300005327 Bacteria 7237
9 Ga0070658_10025687 3300005327 Bacteria 4720
10 Ga0070658_10032646 3300005327 Bacteria 4186
11 Ga0070658_10419440 3300005327 Bacteria 1151
12 Ga0070683_100244792 3300005329 Bacteria 1705
13 Ga0070670_100755095 3300005331 Bacteria 877
14 Ga0070666_10004390 3300005335 Bacteria 8591
15 Ga0070680_100000765 3300005336 Bacteria 22520
16 Ga0070680_100036527 3300005336 Bacteria 3969
17 Ga0070680_100088101 3300005336 Bacteria 2567
18 Ga0070680_100096999 3300005336 Bacteria 2444
19 Ga0070660_100237647 3300005339 Bacteria 1483
20 Ga0070660_100242445 3300005339 Bacteria 1468
21 Ga0070660_100431051 3300005339 Bacteria 1092
22 Ga0070689_100226099 3300005340 Bacteria 1537
23 Ga0070691_10001763 3300005341 Bacteria 9416
24 Ga0070691_10002923 3300005341 Bacteria 7661
25 Ga0070691_10059376 3300005341 Bacteria 1838
26 Ga0070661_100000694 3300005344 Bacteria 24691
27 Ga0070661_100006385 3300005344 Bacteria 8133
28 Ga0070671_100127511 3300005355 Bacteria 2143
29 Ga0070659_100009771 3300005366 Bacteria 7051
30 Ga0070659_100026419 3300005366 Bacteria 4468
31 Ga0070667_100080173 3300005367 Bacteria 2791
32 Ga0070709_10005089 3300005434 Bacteria 7105
33 Ga0070709_10240117 3300005434 Bacteria 1301
34 Ga0070709_10457162 3300005434 Bacteria 963
35 Ga0070714_100367656 3300005435 Bacteria 1353
36 Ga0070713_100000001 3300005436 Bacteria 257984
37 Ga0070713_100148707 3300005436 Bacteria 2081
38 Ga0070713_100545920 3300005436 Bacteria 1097
39 Ga0070713_100617390 3300005436 Bacteria 1031
40 Ga0070711_100031441 3300005439 Bacteria 3524
41 Ga0070705_100080360 3300005440 Bacteria 2000
42 Ga0070708_100256071 3300005445 Bacteria 1645
43 Ga0070681_10000030 3300005458 Bacteria 102898
44 Ga0070681_10006775 3300005458 Bacteria 11153
45 Ga0070681_10026307 3300005458 Bacteria 5848
46 Ga0070681_10057984 3300005458 Bacteria 3852
47 Ga0070681_10059515 3300005458 Bacteria 3800
48 Ga0070681_10334383 3300005458 Bacteria 1424
49 Ga0070706_100154173 3300005467 Bacteria 2144
50 Ga0070698_100001054 3300005471 Bacteria 30349
51 Ga0070699_100106498 3300005518 Bacteria 2459
52 Ga0070679_100004492 3300005530 Bacteria 12891
53 Ga0070679_100018959 3300005530 Bacteria 6681
54 Ga0070679_100074542 3300005530 Bacteria 3384
55 Ga0070679_100207735 3300005530 Bacteria 1922
56 Ga0070679_100358400 3300005530 Bacteria 1406
57 Ga0070697_100260773 3300005536 Bacteria 1484
58 Ga0068853_100002232 3300005539 Bacteria 14472
59 Ga0068853_100004334 3300005539 Bacteria 10976
60 Ga0068853_100263633 3300005539 Bacteria 1585
61 Ga0068853_100302984 3300005539 Bacteria 1477
62 Ga0070695_100055587 3300005545 Bacteria 2552
63 Ga0070695_100318914 3300005545 Bacteria 1155
64 Ga0070696_100278595 3300005546 Bacteria 1274
65 Ga0070693_100303989 3300005547 Bacteria 1076
66 Ga0070665_100000794 3300005548 Bacteria 41381
67 Ga0070665_100319246 3300005548 Bacteria 1557
68 Ga0068855_100000080 3300005563 Bacteria 115920
69 Ga0068855_100013598 3300005563 Bacteria 9814
70 Ga0068855_100018290 3300005563 Bacteria 8418
71 Ga0068855_100038080 3300005563 Bacteria 5715
72 Ga0068855_100058892 3300005563 Bacteria 4496
73 Ga0068855_100058971 3300005563 Bacteria 4492
74 Ga0068855_100153801 3300005563 Bacteria 2614
75 Ga0070664_100057919 3300005564 Bacteria 3295
76 Ga0068857_100016422 3300005577 Bacteria 6486
77 Ga0068857_100154587 3300005577 Bacteria 2080
78 Ga0068856_100012987 3300005614 Bacteria 8064
79 Ga0068856_100051247 3300005614 Bacteria 4070
80 Ga0068856_100712491 3300005614 Bacteria 1024
81 Ga0068852_100001802 3300005616 Bacteria 14542
82 Ga0068852_100014851 3300005616 Bacteria 6017
83 Ga0068852_100017284 3300005616 Bacteria 5655
84 Ga0068859_100110108 3300005617 Bacteria 2816
85 Ga0068864_100003746 3300005618 Bacteria 12556
86 Ga0068863_100019869 3300005841 Bacteria 6425
87 Ga0068863_100351721 3300005841 Bacteria 1435
88 Ga0068863_100412945 3300005841 Bacteria 1321
89 Ga0068858_100175560 3300005842 Bacteria 2022
90 Ga0068858_100368220 3300005842 Bacteria 1378
91 Ga0068862_100056165 3300005844 Bacteria 3373
92 Ga0081455_10004291 3300005937 Bacteria 16048
93 Ga0081455_10030713 3300005937 Bacteria 4876
94 Ga0081538_10061068 3300005981 Bacteria 2161
95 Ga0081539_10061497 3300005985 Bacteria 2057
96 Ga0081539_10153568 3300005985 Bacteria 1105
97 Ga0070717_10041146 3300006028 Bacteria 3767
98 Ga0075365_10068537 3300006038 Bacteria 2384
99 Ga0075365_10094819 3300006038 Bacteria 2037
100 Ga0075363_100013888 3300006048 Bacteria 3920
101 Ga0075364_10120249 3300006051 Bacteria 1758
102 Ga0070716_100192728 3300006173 Bacteria 1348
103 Ga0070712_100000198 3300006175 Bacteria 33726
104 Ga0070712_100361988 3300006175 Bacteria 1190
105 Ga0075367_10017524 3300006178 Bacteria 3932
106 Ga0075367_10271087 3300006178 Bacteria 1066
107 Ga0075369_10029075 3300006186 Bacteria 2319
108 Ga0075369_10078582 3300006186 Bacteria 1461
109 Ga0075370_10022063 3300006353 Bacteria 3492
110 Ga0075434_100070110 3300006871 Bacteria 3496
111 Ga0075436_100025717 3300006914 Bacteria 4051
112 Ga0097620_100031310 3300006931 Bacteria 5341
113 Ga0097620_100110107 3300006931 Bacteria 2816
114 Ga0105240_10000575 3300009093 Bacteria 68057
115 Ga0105240_10006449 3300009093 Bacteria 17248
116 Ga0105240_10009769 3300009093 Bacteria 13545
117 Ga0105240_10013920 3300009093 Bacteria 11011
118 Ga0105240_10446153 3300009093 Bacteria 1449
119 Ga0105247_10129416 3300009101 Bacteria 1644
120 Ga0105241_10029020 3300009174 Bacteria 4123
121 Ga0105241_10433186 3300009174 Bacteria 1160
122 Ga0105242_10166499 3300009176 Bacteria 1934
123 Ga0105248_10000001 3300009177 Bacteria 1881304
124 Ga0105248_10001206 3300009177 Bacteria 28898
125 Ga0105248_10179257 3300009177 Bacteria 2388
126 Ga0105238_10006259 3300009551 Bacteria 11826
127 Ga0105238_10018604 3300009551 Bacteria 7073
128 Ga0105238_10038504 3300009551 Bacteria 4855
129 Ga0105238_10056576 3300009551 Bacteria 3934
130 Ga0105238_10170176 3300009551 Bacteria 2154
131 Ga0105249_10488202 3300009553 Bacteria 1275
132 Ga0099796_10064575 3300010159 Bacteria 1306
133 Ga0105239_10000221 3300010375 Bacteria 83919
134 Ga0105239_10009459 3300010375 Bacteria 10982
135 Ga0105239_10017006 3300010375 Bacteria 8040
136 Ga0157373_10005545 3300013100 Bacteria 9463
137 Ga0157373_10203786 3300013100 Bacteria 1395
138 Ga0157370_10003943 3300013104 Bacteria 17267
139 Ga0157370_10163710 3300013104 Bacteria 2069
140 Ga0157370_10193539 3300013104 Bacteria 1887
141 Ga0157369_10003800 3300013105 Bacteria 17944
142 Ga0157369_10018290 3300013105 Bacteria 7860
143 Ga0157369_10018826 3300013105 Bacteria 7738
144 Ga0157374_10334438 3300013296 Bacteria 1503
145 Ga0157378_10265456 3300013297 Bacteria 1649
146 Ga0163162_10558133 3300013306 Bacteria 1273
147 Ga0157372_10024888 3300013307 Bacteria 6506
148 Ga0157372_10138029 3300013307 Bacteria 2809
149 Ga0157372_10138802 3300013307 Bacteria 2800
150 Ga0157375_10177448 3300013308 Bacteria 2281
151 Ga0163163_10126838 3300014325 Bacteria 2590
152 Ga0157379_10013671 3300014968 Bacteria 7114
153 Ga0157379_10054062 3300014968 Bacteria 3588
154 Ga0157379_10077418 3300014968 Bacteria 2978
155 Ga0182007_10062170 3300015262 Bacteria 1224
156 Ga0213871_10002897 3300021441 Bacteria 3231
157 Ga0209148_1004808 3300025254 Bacteria 3229
158 Ga0209758_1003794 3300025297 Bacteria 13312
159 Ga0209050_1000073 3300025298 Bacteria 292046
160 Ga0209257_1000099 3300025304 Bacteria 255304
161 Ga0209257_1001506 3300025304 Bacteria 27363
162 Ga0207680_10000192 3300025903 Bacteria 29474
163 Ga0207680_10129246 3300025903 Bacteria 1663
164 Ga0207699_10000096 3300025906 Bacteria 63442
165 Ga0207699_10129514 3300025906 Bacteria 1644
166 Ga0207699_10302858 3300025906 Bacteria 1117
167 Ga0207705_10000089 3300025909 Bacteria 113394
168 Ga0207705_10004109 3300025909 Bacteria 11031
169 Ga0207705_10043582 3300025909 Bacteria 3224
170 Ga0207705_10349637 3300025909 Bacteria 1139
171 Ga0207684_10088792 3300025910 Bacteria 2634
172 Ga0207654_10017845 3300025911 Bacteria 3717
173 Ga0207654_10283576 3300025911 Unclassified 1121
174 Ga0207707_10000001 3300025912 Bacteria 1212482
175 Ga0207707_10010004 3300025912 Bacteria 8230
176 Ga0207707_10080915 3300025912 Bacteria 2836
177 Ga0207707_10104817 3300025912 Bacteria 2471
178 Ga0207707_10125402 3300025912 Bacteria 2245
179 Ga0207707_10329473 3300025912 Bacteria 1317
180 Ga0207707_10646699 3300025912 Bacteria 891
181 Ga0207695_10000012 3300025913 Bacteria 840961
182 Ga0207695_10001862 3300025913 Bacteria 33045
183 Ga0207695_10002578 3300025913 Bacteria 26581
184 Ga0207695_10002748 3300025913 Bacteria 25656
185 Ga0207695_10056344 3300025913 Bacteria 4090
186 Ga0207695_10068843 3300025913 Bacteria 3625
187 Ga0207695_10177260 3300025913 Bacteria 2053
188 Ga0207671_10116790 3300025914 Bacteria 2036
189 Ga0207693_10000052 3300025915 Bacteria 98125
190 Ga0207693_10000094 3300025915 Bacteria 79297
191 Ga0207693_10235853 3300025915 Bacteria 1436
192 Ga0207663_10009311 3300025916 Bacteria 5183
193 Ga0207663_10039648 3300025916 Bacteria 2856
194 Ga0207660_10000652 3300025917 Bacteria 23389
195 Ga0207660_10007895 3300025917 Bacteria 6888
196 Ga0207660_10019278 3300025917 Bacteria 4557
197 Ga0207660_10117101 3300025917 Bacteria 2013
198 Ga0207657_10000654 3300025919 Bacteria 36849
199 Ga0207657_10002126 3300025919 Bacteria 21453
200 Ga0207657_10062788 3300025919 Bacteria 3179
201 Ga0207649_10000112 3300025920 Bacteria 68472
202 Ga0207649_10126744 3300025920 Bacteria 1729
203 Ga0207652_10000311 3300025921 Bacteria 50145
204 Ga0207652_10015724 3300025921 Bacteria 6164
205 Ga0207652_10022940 3300025921 Bacteria 5169
206 Ga0207652_10176040 3300025921 Bacteria 1921
207 Ga0207646_10451865 3300025922 Bacteria 1159
208 Ga0207694_10000055 3300025924 Bacteria 151308
209 Ga0207694_10015131 3300025924 Bacteria 5818
210 Ga0207694_10071788 3300025924 Bacteria 2706
211 Ga0207694_10127102 3300025924 Bacteria 2040
212 Ga0207694_10264117 3300025924 Bacteria 1410
213 Ga0207700_10000015 3300025928 Bacteria 224772
214 Ga0207664_10021892 3300025929 Bacteria 4763
215 Ga0207644_10020639 3300025931 Bacteria 4483
216 Ga0207690_10001425 3300025932 Bacteria 14987
217 Ga0207690_10004285 3300025932 Bacteria 8424
218 Ga0207690_10124668 3300025932 Bacteria 1876
219 Ga0207686_10107428 3300025934 Bacteria 1876
220 Ga0207670_10354002 3300025936 Bacteria 1163
221 Ga0207704_10000592 3300025938 Bacteria 16027
222 Ga0207711_10000001 3300025941 Bacteria 1325674
223 Ga0207711_10000088 3300025941 Bacteria 98086
224 Ga0207711_10042523 3300025941 Bacteria 3872
225 Ga0207711_10303250 3300025941 Bacteria 1473
226 Ga0207711_10318969 3300025941 Bacteria 1436
227 Ga0207667_10000068 3300025949 Bacteria 180716
228 Ga0207667_10037982 3300025949 Bacteria 5145
229 Ga0207667_10041754 3300025949 Bacteria 4877
230 Ga0207667_10068643 3300025949 Bacteria 3690
231 Ga0207667_10089847 3300025949 Bacteria 3174
232 Ga0207712_10218143 3300025961 Bacteria 1523
233 Ga0207658_10099449 3300025986 Bacteria 2275
234 Ga0207703_10099196 3300026035 Bacteria 2465
235 Ga0207639_10002707 3300026041 Bacteria 11883
236 Ga0207639_10237096 3300026041 Bacteria 1584
237 Ga0207639_10240493 3300026041 Bacteria 1573
238 Ga0207678_10600237 3300026067 Bacteria 965
239 Ga0207702_10000011 3300026078 Bacteria 284514
240 Ga0207702_10000465 3300026078 Bacteria 45960
241 Ga0207702_10568459 3300026078 Bacteria 1110
242 Ga0207702_10840451 3300026078 Bacteria 908
243 Ga0207641_10145110 3300026088 Bacteria 2145
244 Ga0207641_10178129 3300026088 Bacteria 1945
245 Ga0207641_10308066 3300026088 Bacteria 1498
246 Ga0207676_10075896 3300026095 Bacteria 2713
247 Ga0207674_10000002 3300026116 Bacteria 279738
248 Ga0207683_10082456 3300026121 Bacteria 2857
249 Ga0207698_10001974 3300026142 Bacteria 12073
250 Ga0207698_10047841 3300026142 Bacteria 3244
251 Ga0207698_10050297 3300026142 Bacteria 3178
252 Ga0209813_10052899 3300027866 Bacteria 1275
253 Ga0268266_10000189 3300028379 Bacteria 109217
254 Ga0268266_10765571 3300028379 Bacteria 932
255 Ga0268265_10049304 3300028380 Bacteria 3166
256 Ga0265334_10016538 3300028573 Bacteria 3050
257 Ga0307517_10001838 3300028786 Bacteria 34795
258 Ga0307517_10147130 3300028786 Bacteria 1630
259 Ga0265338_10000378 3300028800 Bacteria 79834
260 Ga0265338_10053321 3300028800 Bacteria 3619
261 Ga0265324_10033984 3300029957 Bacteria 1777
262 Ga0307511_10012406 3300030521 Bacteria 8359
263 Ga0265332_10035256 3300031238 Bacteria 2173
264 Ga0265325_10000003 3300031241 Bacteria 370490
265 Ga0265325_10001297 3300031241 Bacteria 17699
266 Ga0265325_10081162 3300031241 Bacteria 1612
267 Ga0265325_10133309 3300031241 Unclassified 1188
268 Ga0265329_10056460 3300031242 Bacteria 1245
269 Ga0265340_10000681 3300031247 Bacteria 19051
270 Ga0265340_10016674 3300031247 Bacteria 3802
271 Ga0265340_10026842 3300031247 Bacteria 2908
272 Ga0265339_10001460 3300031249 Bacteria 17503
273 Ga0265339_10004438 3300031249 Bacteria 9578
274 Ga0265339_10164456 3300031249 Bacteria 1115
275 Ga0265331_10000003 3300031250 Bacteria 499358
276 Ga0265331_10005092 3300031250 Bacteria 8021
277 Ga0265331_10026448 3300031250 Bacteria 2916
278 Ga0265327_10000150 3300031251 Bacteria 150039
279 Ga0265327_10004207 3300031251 Bacteria 12935
280 Ga0265316_10075229 3300031344 Bacteria 2597
281 Ga0307513_10003217 3300031456 Bacteria 22279
282 Ga0307513_10005657 3300031456 Bacteria 16461
283 Ga0265313_10001099 3300031595 Bacteria 25965
284 Ga0265313_10002518 3300031595 Bacteria 15753
285 Ga0265314_10006618 3300031711 Bacteria 10194
286 Ga0265314_10013734 3300031711 Bacteria 6527
287 Ga0265314_10021364 3300031711 Bacteria 4978
288 Ga0265314_10092965 3300031711 Bacteria 1959
289 Ga0265342_10027019 3300031712 Unclassified 3593
290 Ga0307516_10010643 3300031730 Bacteria 10091
291 Ga0307510_10108735 3300033180 Bacteria 2525
292 Ga0307510_10225372 3300033180 Bacteria 1382
293 Ga0373955_0023599 3300035172 Bacteria 3136
294 Ga0373935_0314352 3300035692 Bacteria 1110
295 Ga0373933_0080870 3300035724 Bacteria 1992
296 Ga0373937_0013433 3300036401 Bacteria 7214
297 Ga0373937_0238636 3300036401 Bacteria 1712
298 Ga0373925_0093250 3300037068 Bacteria 2304
299 Ga0395899_0000052 3300037312 Bacteria 221643
300 Ga0395899_0183491 3300037312 Bacteria 1467
301 Ga0395899_0259415 3300037312 Bacteria 1189
302 Ga0395900_0000002 3300037418 Bacteria 671103
303 Ga0395900_0010603 3300037418 Bacteria 9424
304 Ga0395900_0535504 3300037418 Bacteria 1117
305 Ga0395898_0028079 3300037466 Bacteria 5642
306 Ga0395898_0180210 3300037466 Bacteria 2019
307 Ga0395898_0490690 3300037466 Bacteria 1168
308 Ga0395905_0002542 3300037471 Bacteria 20129
309 Ga0395905_0055744 3300037471 Bacteria 3699
310 Ga0436364_1344247 3300037853 Unclassified 1203
311 Ga0395901_0000013 3300038443 Bacteria 375733
312 Ga0436360_0554790 3300039438 Bacteria 1111
313 Ga0436360_0871307 3300039438 Bacteria 8988
314 Ga0436360_1193301 3300039438 Bacteria 2836
315 Ga0436361_1005508 3300039447 Bacteria 5860
316 Ga0466960_0095452 3300044901 Bacteria 1523
317 Ga0495629_0483791 3300046459 Bacteria 836
318 Ga0495650_0007159 3300046471 Bacteria 6765
319 Ga0495642_0000481 3300046528 Bacteria 20475
320 Ga0495642_0011830 3300046528 Bacteria 3362
321 Ga0495652_0028827 3300046529 Bacteria 4881
322 Ga0495652_0137047 3300046529 Bacteria 1930
323 Ga0495645_0045455 3300046543 Bacteria 3204
324 Ga0495668_0097237 3300046616 Bacteria 1611
325 Ga0495668_0236968 3300046616 Bacteria 999
326 Ga0495611_0002968 3300046648 Bacteria 7563
327 Ga0495625_0056739 3300046660 Bacteria 2787
328 Ga0495625_0145368 3300046660 Bacteria 1597
329 Ga0495675_0066739 3300047444 Bacteria 2274
330 Ga0495681_0058838 3300047470 Bacteria 1779
331 Ga0495686_0001321 3300047472 Bacteria 27786
332 Ga0496100_0021012 3300048903 Bacteria 3925
333 Ga0496101_0098823 3300048904 Bacteria 2181
334 Ga0496102_0167445 3300048905 Bacteria 2068
335 Ga0496106_0116879 3300048909 Bacteria 2081
336 Ga0496106_0146538 3300048909 Bacteria 1860
337 Ga0496106_0207531 3300048909 Bacteria 1560
338 Ga0496107_0181628 3300048910 Bacteria 1562
339 Ga0496108_0129015 3300048911 Bacteria 2173
340 Ga0496110_0450208 3300048913 Bacteria 1173
341 Ga0496112_0091275 3300048915 Bacteria 3015
342 Ga0496115_0001126 3300048918 Bacteria 19279
343 Ga0496115_0058039 3300048918 Bacteria 3113
344 Ga0496126_0000782 3300048929 Bacteria 57324
345 Ga0496126_0413317 3300048929 Bacteria 1092
346 Ga0495682_0005196 3300049460 Bacteria 5439
347 Ga0501031_0008161 3300049568 Bacteria 6815
348 Ga0501031_0234444 3300049568 Bacteria 1194
349 Ga0501032_0097267 3300049569 Bacteria 1951
350 Ga0501032_0402424 3300049569 Bacteria 879
351 Ga0501033_0037526 3300049570 Bacteria 3626
352 Ga0501033_0139607 3300049570 Bacteria 1752
353 Ga0501033_0165318 3300049570 Bacteria 1591
354 Ga0501034_0077024 3300049571 Bacteria 3341
355 Ga0501037_0037212 3300049573 Bacteria 3587
356 Ga0501037_0340970 3300049573 Bacteria 1035
357 Ga0501037_0350289 3300049573 Bacteria 1019
358 Ga0501038_0013822 3300049574 Bacteria 7356
359 Ga0501038_0025964 3300049574 Bacteria 5217
360 Ga0501038_0353211 3300049574 Bacteria 1145
361 Ga0501038_0493454 3300049574 Bacteria 937
362 Ga0501039_0018996 3300049575 Bacteria 5275
363 Ga0501043_0024769 3300049579 Bacteria 4707
364 Ga0501043_0611764 3300049579 Bacteria 804
365 Ga0501046_0022069 3300049580 Bacteria 5247
366 Ga0501047_0211430 3300049581 Bacteria 1798
367 Ga0501047_0212171 3300049581 Bacteria 1794
368 Ga0501047_0221781 3300049581 Bacteria 1747
369 Ga0501047_0234434 3300049581 Bacteria 1687
370 Ga0501047_0328249 3300049581 Bacteria 1369
371 Ga0501047_0662456 3300049581 Bacteria 863
372 Ga0501067_0000544 3300049583 Bacteria 20482
373 Ga0501068_0036043 3300049584 Bacteria 2956
374 Ga0501070_0000025 3300049586 Bacteria 152175
375 Ga0501070_0008192 3300049586 Bacteria 8838
376 Ga0501070_0010935 3300049586 Bacteria 7664
377 Ga0501070_0179196 3300049586 Bacteria 1744
378 Ga0501072_0024827 3300049588 Bacteria 4666
379 Ga0501073_0007405 3300049589 Bacteria 8158
380 Ga0501074_0058688 3300049590 Bacteria 2772
381 Ga0501079_0000409 3300049741 Bacteria 27753
382 Ga0501080_0007796 3300049742 Bacteria 9683
383 Ga0501080_0011706 3300049742 Bacteria 8039
384 Ga0501080_0026993 3300049742 Bacteria 5339
385 Ga0501080_0056372 3300049742 Bacteria 3659
386 Ga0501080_0149888 3300049742 Bacteria 2156
387 Ga0501083_0086385 3300049744 Bacteria 2075
388 Ga0501083_0094935 3300049744 Bacteria 1968
389 Ga0501035_0001300 3300049822 Bacteria 25791
390 Ga0501035_0015401 3300049822 Bacteria 7055
391 Ga0501035_0056569 3300049822 Bacteria 3499
392 Ga0501035_0519103 3300049822 Bacteria 979
393 Ga0501044_0002065 3300049823 Bacteria 23150
394 Ga0501044_0012159 3300049823 Bacteria 9320
395 Ga0501044_0036372 3300049823 Bacteria 5151
396 Ga0501044_0054724 3300049823 Bacteria 4100
397 Ga0501044_0059559 3300049823 Bacteria 3912
398 Ga0501044_0294828 3300049823 Bacteria 1552
399 Ga0501044_0298620 3300049823 Bacteria 1540
400 Ga0501044_0478080 3300049823 Bacteria 1149
401 nmdc:mga03n38_166707_c1 3300050490 Bacteria 1119
402 nmdc:mga03n38_3356_c1 3300050490 Bacteria 5127
403 nmdc:mga0yw44_198171_c1 3300050492 Bacteria 1325
404 nmdc:mga0yw44_57006_c1 3300050492 Bacteria 2382
405 nmdc:mga04h51_58988_c1 3300050495 Bacteria 1310
406 nmdc:mga07m45_11751_c1 3300050496 Bacteria 4607
407 nmdc:mga07m45_32359_c1 3300050496 Bacteria 2900
408 nmdc:mga0n895_17840_c1 3300050512 Bacteria 6553
409 nmdc:mga0n895_39297_c1 3300050512 Bacteria 4590
410 nmdc:mga0rr50_74138_c1 3300050513 Bacteria 2604
411 nmdc:mga08x19_41_c1 3300050514 Bacteria 151756
412 Ga0500562_001053 3300053108 Bacteria 6774
413 Ga0500594_0052890 3300053118 Bacteria 1149
414 Ga0500595_040384 3300053119 Bacteria 1505
415 Ga0500568_0058065 3300053139 Bacteria 1504
416 Ga0500645_002100 3300053730 Bacteria 9203
417 Ga0501084_0001149 3300054114 Bacteria 20616
418 Ga0501084_0002732 3300054114 Bacteria 14230
419 Ga0501082_0041878 3300060353 Bacteria 3949
420 Ga0501082_0065176 3300060353 Bacteria 3137
421 Ga0501082_0096367 3300060353 Bacteria 2557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100545920 Ga0070713_1005459201 225
2 3300025910 Ga0207684_10088792 Ga0207684_100887925 225
3 3300037853 Ga0436364_1344247 Ga0436364_1344247_492_1175 226
4 3300005344 Ga0070661_100006385 Ga0070661_1000063852 244
5 3300010375 Ga0105239_10000221 Ga0105239_1000022120 244
6 3300013105 Ga0157369_10018826 Ga0157369_100188263 244
7 3300005331 Ga0070670_100755095 Ga0070670_1007550951 257
8 3300005617 Ga0068859_100110108 Ga0068859_1001101082 257
9 3300005841 Ga0068863_100019869 Ga0068863_1000198695 257
10 3300005844 Ga0068862_100056165 Ga0068862_1000561653 257
11 3300006931 Ga0097620_100110107 Ga0097620_1001101072 257
12 3300025961 Ga0207712_10218143 Ga0207712_102181432 257
13 3300026088 Ga0207641_10145110 Ga0207641_101451102 257
14 3300028380 Ga0268265_10049304 Ga0268265_100493042 257
15 3300039438 Ga0436360_1193301 Ga0436360_1193301_656_1432 257
16 3300046459 Ga0495629_0483791 Ga0495629_0483791_20_802 257
17 3300003215 JGI25153J46596_10030085 JGI25153J46596_100300852 258
18 3300003320 rootH2_10005141 rootH2_100051414 258
19 3300003791 Ga0055530_10000696 Ga0055530_1000069619 258
20 3300003794 Ga0055531_10003665 Ga0055531_100036657 258
21 3300003794 Ga0055531_10017307 Ga0055531_100173072 258
22 3300004625 Ga0055543_1032831 Ga0055543_10328311 258
23 3300005262 Ga0065165_1000702 Ga0065165_100070211 258
24 3300005327 Ga0070658_10011045 Ga0070658_100110452 258
25 3300005327 Ga0070658_10025687 Ga0070658_100256874 258
26 3300005327 Ga0070658_10032646 Ga0070658_100326465 258
27 3300005327 Ga0070658_10419440 Ga0070658_104194401 258
28 3300005329 Ga0070683_100244792 Ga0070683_1002447922 258
29 3300005335 Ga0070666_10004390 Ga0070666_100043902 258
30 3300005336 Ga0070680_100000765 Ga0070680_10000076515 258
31 3300005336 Ga0070680_100036527 Ga0070680_1000365274 258
32 3300005336 Ga0070680_100088101 Ga0070680_1000881012 258
33 3300005336 Ga0070680_100096999 Ga0070680_1000969992 258
34 3300005339 Ga0070660_100237647 Ga0070660_1002376472 258
35 3300005339 Ga0070660_100242445 Ga0070660_1002424452 258
36 3300005339 Ga0070660_100431051 Ga0070660_1004310512 258
37 3300005340 Ga0070689_100226099 Ga0070689_1002260991 258
38 3300005341 Ga0070691_10001763 Ga0070691_100017639 258
39 3300005341 Ga0070691_10002923 Ga0070691_100029236 258
40 3300005341 Ga0070691_10059376 Ga0070691_100593762 258
41 3300005344 Ga0070661_100000694 Ga0070661_1000006942 258
42 3300005355 Ga0070671_100127511 Ga0070671_1001275112 258
43 3300005366 Ga0070659_100009771 Ga0070659_1000097717 258
44 3300005366 Ga0070659_100026419 Ga0070659_1000264195 258
45 3300005367 Ga0070667_100080173 Ga0070667_1000801732 258
46 3300005434 Ga0070709_10005089 Ga0070709_100050894 258
47 3300005434 Ga0070709_10240117 Ga0070709_102401172 258
48 3300005434 Ga0070709_10457162 Ga0070709_104571622 258
49 3300005435 Ga0070714_100367656 Ga0070714_1003676562 258
50 3300005436 Ga0070713_100000001 Ga0070713_100000001100 258
51 3300005436 Ga0070713_100148707 Ga0070713_1001487072 258
52 3300005436 Ga0070713_100617390 Ga0070713_1006173901 258
53 3300005439 Ga0070711_100031441 Ga0070711_1000314413 258
54 3300005440 Ga0070705_100080360 Ga0070705_1000803602 258
55 3300005445 Ga0070708_100256071 Ga0070708_1002560712 258
56 3300005458 Ga0070681_10000030 Ga0070681_100000307 258
57 3300005458 Ga0070681_10006775 Ga0070681_100067756 258
58 3300005458 Ga0070681_10026307 Ga0070681_100263074 258
59 3300005458 Ga0070681_10057984 Ga0070681_100579843 258
60 3300005458 Ga0070681_10059515 Ga0070681_100595152 258
61 3300005458 Ga0070681_10334383 Ga0070681_103343832 258
62 3300005467 Ga0070706_100154173 Ga0070706_1001541732 258
63 3300005471 Ga0070698_100001054 Ga0070698_1000010543 258
64 3300005518 Ga0070699_100106498 Ga0070699_1001064983 258
65 3300005530 Ga0070679_100004492 Ga0070679_1000044926 258
66 3300005530 Ga0070679_100018959 Ga0070679_1000189595 258
67 3300005530 Ga0070679_100074542 Ga0070679_1000745423 258
68 3300005530 Ga0070679_100207735 Ga0070679_1002077352 258
69 3300005530 Ga0070679_100358400 Ga0070679_1003584002 258
70 3300005536 Ga0070697_100260773 Ga0070697_1002607732 258
71 3300005539 Ga0068853_100002232 Ga0068853_1000022328 258
72 3300005539 Ga0068853_100004334 Ga0068853_1000043346 258
73 3300005539 Ga0068853_100263633 Ga0068853_1002636332 258
74 3300005539 Ga0068853_100302984 Ga0068853_1003029842 258
75 3300005545 Ga0070695_100055587 Ga0070695_1000555872 258
76 3300005545 Ga0070695_100318914 Ga0070695_1003189141 258
77 3300005546 Ga0070696_100278595 Ga0070696_1002785952 258
78 3300005547 Ga0070693_100303989 Ga0070693_1003039891 258
79 3300005548 Ga0070665_100000794 Ga0070665_10000079416 258
80 3300005548 Ga0070665_100319246 Ga0070665_1003192462 258
81 3300005563 Ga0068855_100000080 Ga0068855_10000008063 258
82 3300005563 Ga0068855_100013598 Ga0068855_1000135984 258
83 3300005563 Ga0068855_100018290 Ga0068855_1000182908 258
84 3300005563 Ga0068855_100038080 Ga0068855_1000380806 258
85 3300005563 Ga0068855_100058892 Ga0068855_1000588924 258
86 3300005563 Ga0068855_100058971 Ga0068855_1000589713 258
87 3300005563 Ga0068855_100153801 Ga0068855_1001538012 258
88 3300005564 Ga0070664_100057919 Ga0070664_1000579194 258
89 3300005577 Ga0068857_100016422 Ga0068857_1000164222 258
90 3300005577 Ga0068857_100154587 Ga0068857_1001545872 258
91 3300005614 Ga0068856_100012987 Ga0068856_1000129879 258
92 3300005614 Ga0068856_100051247 Ga0068856_1000512474 258
93 3300005614 Ga0068856_100712491 Ga0068856_1007124912 258
94 3300005616 Ga0068852_100001802 Ga0068852_1000018029 258
95 3300005616 Ga0068852_100014851 Ga0068852_1000148515 258
96 3300005616 Ga0068852_100017284 Ga0068852_1000172842 258
97 3300005618 Ga0068864_100003746 Ga0068864_1000037462 258
98 3300005841 Ga0068863_100351721 Ga0068863_1003517212 258
99 3300005841 Ga0068863_100412945 Ga0068863_1004129451 258
100 3300005842 Ga0068858_100175560 Ga0068858_1001755602 258
101 3300005842 Ga0068858_100368220 Ga0068858_1003682202 258
102 3300005937 Ga0081455_10004291 Ga0081455_1000429112 258
103 3300005937 Ga0081455_10030713 Ga0081455_100307132 258
104 3300005981 Ga0081538_10061068 Ga0081538_100610682 258
105 3300005985 Ga0081539_10061497 Ga0081539_100614972 258
106 3300005985 Ga0081539_10153568 Ga0081539_101535681 258
107 3300006028 Ga0070717_10041146 Ga0070717_100411463 258
108 3300006038 Ga0075365_10068537 Ga0075365_100685371 258
109 3300006038 Ga0075365_10094819 Ga0075365_100948191 258
110 3300006048 Ga0075363_100013888 Ga0075363_1000138882 258
111 3300006051 Ga0075364_10120249 Ga0075364_101202492 258
112 3300006173 Ga0070716_100192728 Ga0070716_1001927281 258
113 3300006175 Ga0070712_100000198 Ga0070712_10000019832 258
114 3300006175 Ga0070712_100361988 Ga0070712_1003619881 258
115 3300006178 Ga0075367_10017524 Ga0075367_100175242 258
116 3300006178 Ga0075367_10271087 Ga0075367_102710871 258
117 3300006186 Ga0075369_10029075 Ga0075369_100290752 258
118 3300006186 Ga0075369_10078582 Ga0075369_100785822 258
119 3300006353 Ga0075370_10022063 Ga0075370_100220632 258
120 3300006871 Ga0075434_100070110 Ga0075434_1000701102 258
121 3300006914 Ga0075436_100025717 Ga0075436_1000257174 258
122 3300006931 Ga0097620_100031310 Ga0097620_1000313103 258
123 3300009093 Ga0105240_10000575 Ga0105240_1000057514 258
124 3300009093 Ga0105240_10006449 Ga0105240_100064499 258
125 3300009093 Ga0105240_10009769 Ga0105240_100097692 258
126 3300009093 Ga0105240_10013920 Ga0105240_100139204 258
127 3300009093 Ga0105240_10446153 Ga0105240_104461532 258
128 3300009101 Ga0105247_10129416 Ga0105247_101294162 258
129 3300009174 Ga0105241_10029020 Ga0105241_100290202 258
130 3300009174 Ga0105241_10433186 Ga0105241_104331861 258
131 3300009176 Ga0105242_10166499 Ga0105242_101664992 258
132 3300009177 Ga0105248_10000001 Ga0105248_100000011102 258
133 3300009177 Ga0105248_10001206 Ga0105248_1000120612 258
134 3300009177 Ga0105248_10179257 Ga0105248_101792572 258
135 3300009551 Ga0105238_10006259 Ga0105238_1000625911 258
136 3300009551 Ga0105238_10018604 Ga0105238_100186046 258
137 3300009551 Ga0105238_10038504 Ga0105238_100385045 258
138 3300009551 Ga0105238_10056576 Ga0105238_100565762 258
139 3300009551 Ga0105238_10170176 Ga0105238_101701762 258
140 3300009553 Ga0105249_10488202 Ga0105249_104882021 258
141 3300010159 Ga0099796_10064575 Ga0099796_100645751 258
142 3300010375 Ga0105239_10009459 Ga0105239_100094599 258
143 3300010375 Ga0105239_10017006 Ga0105239_100170063 258
144 3300013100 Ga0157373_10005545 Ga0157373_1000554511 258
145 3300013100 Ga0157373_10203786 Ga0157373_102037862 258
146 3300013104 Ga0157370_10003943 Ga0157370_1000394311 258
147 3300013104 Ga0157370_10163710 Ga0157370_101637102 258
148 3300013104 Ga0157370_10193539 Ga0157370_101935392 258
149 3300013105 Ga0157369_10003800 Ga0157369_1000380014 258
150 3300013105 Ga0157369_10018290 Ga0157369_100182904 258
151 3300013296 Ga0157374_10334438 Ga0157374_103344382 258
152 3300013297 Ga0157378_10265456 Ga0157378_102654562 258
153 3300013306 Ga0163162_10558133 Ga0163162_105581332 258
154 3300013307 Ga0157372_10024888 Ga0157372_100248886 258
155 3300013307 Ga0157372_10138029 Ga0157372_101380292 258
156 3300013307 Ga0157372_10138802 Ga0157372_101388022 258
157 3300013308 Ga0157375_10177448 Ga0157375_101774482 258
158 3300014325 Ga0163163_10126838 Ga0163163_101268382 258
159 3300014968 Ga0157379_10013671 Ga0157379_100136712 258
160 3300014968 Ga0157379_10054062 Ga0157379_100540624 258
161 3300014968 Ga0157379_10077418 Ga0157379_100774182 258
162 3300015262 Ga0182007_10062170 Ga0182007_100621702 258
163 3300021441 Ga0213871_10002897 Ga0213871_100028973 258
164 3300025254 Ga0209148_1004808 Ga0209148_10048083 258
165 3300025297 Ga0209758_1003794 Ga0209758_100379410 258
166 3300025298 Ga0209050_1000073 Ga0209050_1000073284 258
167 3300025304 Ga0209257_1000099 Ga0209257_100009911 258
168 3300025304 Ga0209257_1001506 Ga0209257_10015069 258
169 3300025903 Ga0207680_10000192 Ga0207680_1000019232 258
170 3300025903 Ga0207680_10129246 Ga0207680_101292462 258
171 3300025906 Ga0207699_10000096 Ga0207699_100000963 258
172 3300025906 Ga0207699_10129514 Ga0207699_101295142 258
173 3300025906 Ga0207699_10302858 Ga0207699_103028581 258
174 3300025909 Ga0207705_10000089 Ga0207705_1000008948 258
175 3300025909 Ga0207705_10004109 Ga0207705_100041094 258
176 3300025909 Ga0207705_10043582 Ga0207705_100435823 258
177 3300025909 Ga0207705_10349637 Ga0207705_103496372 258
178 3300025911 Ga0207654_10017845 Ga0207654_100178452 258
179 3300025911 Ga0207654_10283576 Ga0207654_102835762 258
180 3300025912 Ga0207707_10000001 Ga0207707_100000011056 258
181 3300025912 Ga0207707_10010004 Ga0207707_100100043 258
182 3300025912 Ga0207707_10080915 Ga0207707_100809152 258
183 3300025912 Ga0207707_10104817 Ga0207707_101048172 258
184 3300025912 Ga0207707_10125402 Ga0207707_101254022 258
185 3300025912 Ga0207707_10329473 Ga0207707_103294732 258
186 3300025912 Ga0207707_10646699 Ga0207707_106466991 258
187 3300025913 Ga0207695_10000012 Ga0207695_10000012774 258
188 3300025913 Ga0207695_10001862 Ga0207695_1000186224 258
189 3300025913 Ga0207695_10002578 Ga0207695_100025782 258
190 3300025913 Ga0207695_10002748 Ga0207695_1000274814 258
191 3300025913 Ga0207695_10056344 Ga0207695_100563443 258
192 3300025913 Ga0207695_10068843 Ga0207695_100688433 258
193 3300025913 Ga0207695_10177260 Ga0207695_101772602 258
194 3300025914 Ga0207671_10116790 Ga0207671_101167902 258
195 3300025915 Ga0207693_10000052 Ga0207693_10000052100 258
196 3300025915 Ga0207693_10000094 Ga0207693_1000009443 258
197 3300025915 Ga0207693_10235853 Ga0207693_102358532 258
198 3300025916 Ga0207663_10009311 Ga0207663_100093113 258
199 3300025916 Ga0207663_10039648 Ga0207663_100396482 258
200 3300025917 Ga0207660_10000652 Ga0207660_1000065220 258
201 3300025917 Ga0207660_10007895 Ga0207660_100078954 258
202 3300025917 Ga0207660_10019278 Ga0207660_100192782 258
203 3300025917 Ga0207660_10117101 Ga0207660_101171011 258
204 3300025919 Ga0207657_10000654 Ga0207657_1000065423 258
205 3300025919 Ga0207657_10002126 Ga0207657_100021268 258
206 3300025919 Ga0207657_10062788 Ga0207657_100627882 258
207 3300025920 Ga0207649_10000112 Ga0207649_1000011224 258
208 3300025920 Ga0207649_10126744 Ga0207649_101267441 258
209 3300025921 Ga0207652_10000311 Ga0207652_1000031123 258
210 3300025921 Ga0207652_10015724 Ga0207652_100157246 258
211 3300025921 Ga0207652_10022940 Ga0207652_100229402 258
212 3300025921 Ga0207652_10176040 Ga0207652_101760402 258
213 3300025922 Ga0207646_10451865 Ga0207646_104518652 258
214 3300025924 Ga0207694_10000055 Ga0207694_1000005537 258
215 3300025924 Ga0207694_10015131 Ga0207694_100151312 258
216 3300025924 Ga0207694_10071788 Ga0207694_100717883 258
217 3300025924 Ga0207694_10127102 Ga0207694_101271022 258
218 3300025924 Ga0207694_10264117 Ga0207694_102641172 258
219 3300025928 Ga0207700_10000015 Ga0207700_10000015166 258
220 3300025929 Ga0207664_10021892 Ga0207664_100218924 258
221 3300025931 Ga0207644_10020639 Ga0207644_100206392 258
222 3300025932 Ga0207690_10001425 Ga0207690_100014252 258
223 3300025932 Ga0207690_10004285 Ga0207690_100042851 258
224 3300025932 Ga0207690_10124668 Ga0207690_101246682 258
225 3300025934 Ga0207686_10107428 Ga0207686_101074282 258
226 3300025936 Ga0207670_10354002 Ga0207670_103540022 258
227 3300025938 Ga0207704_10000592 Ga0207704_100005922 258
228 3300025941 Ga0207711_10000001 Ga0207711_10000001769 258
229 3300025941 Ga0207711_10000088 Ga0207711_1000008881 258
230 3300025941 Ga0207711_10042523 Ga0207711_100425233 258
231 3300025941 Ga0207711_10303250 Ga0207711_103032501 258
232 3300025941 Ga0207711_10318969 Ga0207711_103189692 258
233 3300025949 Ga0207667_10000068 Ga0207667_1000006898 258
234 3300025949 Ga0207667_10037982 Ga0207667_100379826 258
235 3300025949 Ga0207667_10041754 Ga0207667_100417542 258
236 3300025949 Ga0207667_10068643 Ga0207667_100686431 258
237 3300025949 Ga0207667_10089847 Ga0207667_100898472 258
238 3300025986 Ga0207658_10099449 Ga0207658_100994491 258
239 3300026035 Ga0207703_10099196 Ga0207703_100991962 258
240 3300026041 Ga0207639_10002707 Ga0207639_100027074 258
241 3300026041 Ga0207639_10237096 Ga0207639_102370962 258
242 3300026041 Ga0207639_10240493 Ga0207639_102404932 258
243 3300026067 Ga0207678_10600237 Ga0207678_106002371 258
244 3300026078 Ga0207702_10000011 Ga0207702_10000011161 258
245 3300026078 Ga0207702_10000465 Ga0207702_1000046536 258
246 3300026078 Ga0207702_10568459 Ga0207702_105684592 258
247 3300026078 Ga0207702_10840451 Ga0207702_108404512 258
248 3300026088 Ga0207641_10178129 Ga0207641_101781292 258
249 3300026088 Ga0207641_10308066 Ga0207641_103080662 258
250 3300026095 Ga0207676_10075896 Ga0207676_100758962 258
251 3300026116 Ga0207674_10000002 Ga0207674_10000002166 258
252 3300026121 Ga0207683_10082456 Ga0207683_100824562 258
253 3300026142 Ga0207698_10001974 Ga0207698_100019742 258
254 3300026142 Ga0207698_10047841 Ga0207698_100478412 258
255 3300026142 Ga0207698_10050297 Ga0207698_100502972 258
256 3300027866 Ga0209813_10052899 Ga0209813_100528992 258
257 3300028379 Ga0268266_10000189 Ga0268266_1000018966 258
258 3300028379 Ga0268266_10765571 Ga0268266_107655711 258
259 3300028573 Ga0265334_10016538 Ga0265334_100165383 258
260 3300028786 Ga0307517_10001838 Ga0307517_1000183812 258
261 3300028786 Ga0307517_10147130 Ga0307517_101471302 258
262 3300028800 Ga0265338_10000378 Ga0265338_100003783 258
263 3300028800 Ga0265338_10053321 Ga0265338_100533214 258
264 3300029957 Ga0265324_10033984 Ga0265324_100339842 258
265 3300030521 Ga0307511_10012406 Ga0307511_100124062 258
266 3300031238 Ga0265332_10035256 Ga0265332_100352561 258
267 3300031241 Ga0265325_10000003 Ga0265325_10000003365 258
268 3300031241 Ga0265325_10001297 Ga0265325_1000129713 258
269 3300031241 Ga0265325_10081162 Ga0265325_100811622 258
270 3300031241 Ga0265325_10133309 Ga0265325_101333091 258
271 3300031242 Ga0265329_10056460 Ga0265329_100564602 258
272 3300031247 Ga0265340_10000681 Ga0265340_1000068112 258
273 3300031247 Ga0265340_10016674 Ga0265340_100166743 258
274 3300031247 Ga0265340_10026842 Ga0265340_100268423 258
275 3300031249 Ga0265339_10001460 Ga0265339_1000146012 258
276 3300031249 Ga0265339_10004438 Ga0265339_100044383 258
277 3300031249 Ga0265339_10164456 Ga0265339_101644561 258
278 3300031250 Ga0265331_10000003 Ga0265331_10000003405 258
279 3300031250 Ga0265331_10005092 Ga0265331_100050923 258
280 3300031250 Ga0265331_10026448 Ga0265331_100264482 258
281 3300031251 Ga0265327_10000150 Ga0265327_1000015050 258
282 3300031251 Ga0265327_10004207 Ga0265327_100042073 258
283 3300031344 Ga0265316_10075229 Ga0265316_100752292 258
284 3300031456 Ga0307513_10003217 Ga0307513_100032175 258
285 3300031456 Ga0307513_10005657 Ga0307513_1000565712 258
286 3300031595 Ga0265313_10001099 Ga0265313_100010998 258
287 3300031595 Ga0265313_10002518 Ga0265313_100025182 258
288 3300031711 Ga0265314_10006618 Ga0265314_1000661810 258
289 3300031711 Ga0265314_10013734 Ga0265314_100137342 258
290 3300031711 Ga0265314_10021364 Ga0265314_100213645 258
291 3300031711 Ga0265314_10092965 Ga0265314_100929652 258
292 3300031712 Ga0265342_10027019 Ga0265342_100270191 258
293 3300031730 Ga0307516_10010643 Ga0307516_1001064312 258
294 3300033180 Ga0307510_10108735 Ga0307510_101087352 258
295 3300033180 Ga0307510_10225372 Ga0307510_102253721 258
296 3300035172 Ga0373955_0023599 Ga0373955_0023599_2323_3105 258
297 3300035692 Ga0373935_0314352 Ga0373935_0314352_176_952 258
298 3300035724 Ga0373933_0080870 Ga0373933_0080870_1013_1795 258
299 3300036401 Ga0373937_0013433 Ga0373937_0013433_6211_6993 258
300 3300036401 Ga0373937_0238636 Ga0373937_0238636_277_1059 258
301 3300037068 Ga0373925_0093250 Ga0373925_0093250_1162_1944 258
302 3300037312 Ga0395899_0000052 Ga0395899_0000052_101945_102721 258
303 3300037312 Ga0395899_0183491 Ga0395899_0183491_82_858 258
304 3300037312 Ga0395899_0259415 Ga0395899_0259415_224_1000 258
305 3300037418 Ga0395900_0000002 Ga0395900_0000002_599746_600522 258
306 3300037418 Ga0395900_0010603 Ga0395900_0010603_2513_3289 258
307 3300037418 Ga0395900_0535504 Ga0395900_0535504_201_977 258
308 3300037466 Ga0395898_0028079 Ga0395898_0028079_4539_5315 258
309 3300037466 Ga0395898_0180210 Ga0395898_0180210_1113_1889 258
310 3300037466 Ga0395898_0490690 Ga0395898_0490690_242_1018 258
311 3300037471 Ga0395905_0002542 Ga0395905_0002542_18501_19277 258
312 3300037471 Ga0395905_0055744 Ga0395905_0055744_2671_3447 258
313 3300038443 Ga0395901_0000013 Ga0395901_0000013_103263_104039 258
314 3300039438 Ga0436360_0554790 Ga0436360_0554790_245_1027 258
315 3300039438 Ga0436360_0871307 Ga0436360_0871307_3341_4153 258
316 3300039447 Ga0436361_1005508 Ga0436361_1005508_1454_2266 258
317 3300044901 Ga0466960_0095452 Ga0466960_0095452_294_1070 258
318 3300046471 Ga0495650_0007159 Ga0495650_0007159_2564_3340 258
319 3300046528 Ga0495642_0000481 Ga0495642_0000481_7558_8340 258
320 3300046528 Ga0495642_0011830 Ga0495642_0011830_234_1010 258
321 3300046529 Ga0495652_0028827 Ga0495652_0028827_1119_1901 258
322 3300046529 Ga0495652_0137047 Ga0495652_0137047_42_818 258
323 3300046543 Ga0495645_0045455 Ga0495645_0045455_762_1544 258
324 3300046616 Ga0495668_0097237 Ga0495668_0097237_604_1383 258
325 3300046616 Ga0495668_0236968 Ga0495668_0236968_175_951 258
326 3300046648 Ga0495611_0002968 Ga0495611_0002968_3608_4384 258
327 3300046660 Ga0495625_0056739 Ga0495625_0056739_1557_2333 258
328 3300046660 Ga0495625_0145368 Ga0495625_0145368_96_872 258
329 3300047444 Ga0495675_0066739 Ga0495675_0066739_1039_1821 258
330 3300047470 Ga0495681_0058838 Ga0495681_0058838_425_1201 258
331 3300047472 Ga0495686_0001321 Ga0495686_0001321_22323_23099 258
332 3300048903 Ga0496100_0021012 Ga0496100_0021012_1555_2331 258
333 3300048904 Ga0496101_0098823 Ga0496101_0098823_1386_2162 258
334 3300048905 Ga0496102_0167445 Ga0496102_0167445_693_1469 258
335 3300048909 Ga0496106_0116879 Ga0496106_0116879_1226_2002 258
336 3300048909 Ga0496106_0146538 Ga0496106_0146538_871_1689 258
337 3300048909 Ga0496106_0207531 Ga0496106_0207531_257_1051 258
338 3300048910 Ga0496107_0181628 Ga0496107_0181628_258_1034 258
339 3300048911 Ga0496108_0129015 Ga0496108_0129015_286_1062 258
340 3300048913 Ga0496110_0450208 Ga0496110_0450208_76_852 258
341 3300048915 Ga0496112_0091275 Ga0496112_0091275_1739_2515 258
342 3300048918 Ga0496115_0001126 Ga0496115_0001126_17147_17923 258
343 3300048918 Ga0496115_0058039 Ga0496115_0058039_1558_2337 258
344 3300048929 Ga0496126_0000782 Ga0496126_0000782_35427_36209 258
345 3300048929 Ga0496126_0413317 Ga0496126_0413317_217_999 258
346 3300049460 Ga0495682_0005196 Ga0495682_0005196_1798_2580 258
347 3300049568 Ga0501031_0008161 Ga0501031_0008161_4809_5591 258
348 3300049568 Ga0501031_0234444 Ga0501031_0234444_160_942 258
349 3300049569 Ga0501032_0097267 Ga0501032_0097267_440_1216 258
350 3300049569 Ga0501032_0402424 Ga0501032_0402424_60_842 258
351 3300049570 Ga0501033_0037526 Ga0501033_0037526_2758_3534 258
352 3300049570 Ga0501033_0139607 Ga0501033_0139607_906_1682 258
353 3300049570 Ga0501033_0165318 Ga0501033_0165318_126_938 258
354 3300049571 Ga0501034_0077024 Ga0501034_0077024_108_890 258
355 3300049573 Ga0501037_0037212 Ga0501037_0037212_2046_2828 258
356 3300049573 Ga0501037_0340970 Ga0501037_0340970_189_965 258
357 3300049573 Ga0501037_0350289 Ga0501037_0350289_75_851 258
358 3300049574 Ga0501038_0013822 Ga0501038_0013822_6375_7157 258
359 3300049574 Ga0501038_0025964 Ga0501038_0025964_426_1202 258
360 3300049574 Ga0501038_0353211 Ga0501038_0353211_258_1070 258
361 3300049574 Ga0501038_0493454 Ga0501038_0493454_110_886 258
362 3300049575 Ga0501039_0018996 Ga0501039_0018996_1470_2246 258
363 3300049579 Ga0501043_0024769 Ga0501043_0024769_2660_3442 258
364 3300049579 Ga0501043_0611764 Ga0501043_0611764_18_794 258
365 3300049580 Ga0501046_0022069 Ga0501046_0022069_3125_3901 258
366 3300049581 Ga0501047_0211430 Ga0501047_0211430_701_1483 258
367 3300049581 Ga0501047_0212171 Ga0501047_0212171_711_1487 258
368 3300049581 Ga0501047_0221781 Ga0501047_0221781_254_1033 258
369 3300049581 Ga0501047_0234434 Ga0501047_0234434_514_1290 258
370 3300049581 Ga0501047_0328249 Ga0501047_0328249_315_1097 258
371 3300049581 Ga0501047_0662456 Ga0501047_0662456_48_830 258
372 3300049583 Ga0501067_0000544 Ga0501067_0000544_19494_20276 258
373 3300049584 Ga0501068_0036043 Ga0501068_0036043_1806_2582 258
374 3300049586 Ga0501070_0000025 Ga0501070_0000025_85873_86655 258
375 3300049586 Ga0501070_0008192 Ga0501070_0008192_1754_2536 258
376 3300049586 Ga0501070_0010935 Ga0501070_0010935_6195_6971 258
377 3300049586 Ga0501070_0179196 Ga0501070_0179196_444_1220 258
378 3300049588 Ga0501072_0024827 Ga0501072_0024827_3815_4591 258
379 3300049589 Ga0501073_0007405 Ga0501073_0007405_5689_6465 258
380 3300049590 Ga0501074_0058688 Ga0501074_0058688_1955_2731 258
381 3300049741 Ga0501079_0000409 Ga0501079_0000409_15144_15926 258
382 3300049742 Ga0501080_0007796 Ga0501080_0007796_1589_2365 258
383 3300049742 Ga0501080_0011706 Ga0501080_0011706_6354_7136 258
384 3300049742 Ga0501080_0026993 Ga0501080_0026993_567_1343 258
385 3300049742 Ga0501080_0056372 Ga0501080_0056372_546_1328 258
386 3300049742 Ga0501080_0149888 Ga0501080_0149888_1140_1916 258
387 3300049744 Ga0501083_0086385 Ga0501083_0086385_1099_1875 258
388 3300049744 Ga0501083_0094935 Ga0501083_0094935_54_830 258
389 3300049822 Ga0501035_0001300 Ga0501035_0001300_11296_12078 258
390 3300049822 Ga0501035_0015401 Ga0501035_0015401_1320_2096 258
391 3300049822 Ga0501035_0056569 Ga0501035_0056569_729_1505 258
392 3300049822 Ga0501035_0519103 Ga0501035_0519103_145_921 258
393 3300049823 Ga0501044_0002065 Ga0501044_0002065_21848_22630 258
394 3300049823 Ga0501044_0012159 Ga0501044_0012159_894_1670 258
395 3300049823 Ga0501044_0036372 Ga0501044_0036372_1363_2172 258
396 3300049823 Ga0501044_0054724 Ga0501044_0054724_567_1343 258
397 3300049823 Ga0501044_0059559 Ga0501044_0059559_2157_2933 258
398 3300049823 Ga0501044_0294828 Ga0501044_0294828_559_1371 258
399 3300049823 Ga0501044_0298620 Ga0501044_0298620_521_1303 258
400 3300049823 Ga0501044_0478080 Ga0501044_0478080_152_934 258
401 3300050490 nmdc:mga03n38_166707_c1 nmdc:mga03n38_166707_c1_16_795 258
402 3300050490 nmdc:mga03n38_3356_c1 nmdc:mga03n38_3356_c1_1733_2509 258
403 3300050492 nmdc:mga0yw44_198171_c1 nmdc:mga0yw44_198171_c1_253_1053 258
404 3300050492 nmdc:mga0yw44_57006_c1 nmdc:mga0yw44_57006_c1_1595_2371 258
405 3300050495 nmdc:mga04h51_58988_c1 nmdc:mga04h51_58988_c1_499_1275 258
406 3300050496 nmdc:mga07m45_11751_c1 nmdc:mga07m45_11751_c1_1737_2513 258
407 3300050496 nmdc:mga07m45_32359_c1 nmdc:mga07m45_32359_c1_682_1458 258
408 3300050512 nmdc:mga0n895_17840_c1 nmdc:mga0n895_17840_c1_1598_2380 258
409 3300050512 nmdc:mga0n895_39297_c1 nmdc:mga0n895_39297_c1_3066_3884 258
410 3300050513 nmdc:mga0rr50_74138_c1 nmdc:mga0rr50_74138_c1_317_1135 258
411 3300050514 nmdc:mga08x19_41_c1 nmdc:mga08x19_41_c1_40148_40966 258
412 3300053108 Ga0500562_001053 Ga0500562_001053_5906_6682 258
413 3300053118 Ga0500594_0052890 Ga0500594_0052890_346_1122 258
414 3300053119 Ga0500595_040384 Ga0500595_040384_162_938 258
415 3300053139 Ga0500568_0058065 Ga0500568_0058065_418_1194 258
416 3300053730 Ga0500645_002100 Ga0500645_002100_5629_6405 258
417 3300054114 Ga0501084_0001149 Ga0501084_0001149_6619_7398 258
418 3300054114 Ga0501084_0002732 Ga0501084_0002732_12904_13686 258
419 3300060353 Ga0501082_0041878 Ga0501082_0041878_2197_2973 258
420 3300060353 Ga0501082_0065176 Ga0501082_0065176_674_1456 258
421 3300060353 Ga0501082_0096367 Ga0501082_0096367_1422_2198 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00975

Thioesterase

Thioesterase domain

34

144

0.8

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

36

259

0.77

PF12146

Hydrolase_4

Serine aminopeptidase, S33

34

259

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

36

265

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jd6-assembly1.cif.gz_A crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco 0.8398 1 256
2puh-assembly1.cif.gz_A crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda 0.822 3 254
3v1l-assembly1.cif.gz_A crystal structure of the s112a/h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400 0.8212 3 254
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8183 2 257
4q3l-assembly1.cif.gz_A crystal structure of mgs-m2, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.8136 4 257
ID Description Score Start End Superfamily
5jd6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8398 1 256 3.40.50.1820
af_Q922Q6_49_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8327 4 257 3.40.50.1820
af_F4IDE6_57_332_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8277 2 258 3.40.50.1820
2puhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.822 3 254 3.40.50.1820
af_F4IDE6_57_332_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8219 2 258 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A354P1B8-F1-model_v4 Alpha/beta hydrolase 0.9403 2 92 GO:0016787
AF-A0A2W1AU60-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9226 2 257 GO:0016020
AF-A0A523P200-F1-model_v4 Alpha/beta hydrolase 0.9213 1 257 GO:0016020
GO:0016787
AF-A0A352UK70-F1-model_v4 Alpha/beta hydrolase 0.9181 2 212 GO:0016787
AF-A0A6L7MVL1-F1-model_v4 Alpha/beta fold hydrolase 0.9129 2 255 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
89.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map