F440039

General Info

Members Datasets Scaffolds Average Seq Length
421 227 842 186

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0331185|Ga0373943_0331185_34_675
Length 213
Sequence VPVLSVCTPGGDHAGVLRRNRMSDTSAGNGKVVVNRSMSLDGFIAGPGDAMDWIFDFVAPDAAWLTETAAATGAMLIGRRTDEVGDRMDANKERGAASSDEGYPFSGPTFVLTHEPPDPPAPEVTYLTGDIGEAVATALDAAGGKNLEILGADVAGQCLQRGLVDEILVYVLPVLLGDGIRIYSSPGLARIDLEPLDSTRHGAVTILRFRVRK

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
54 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
55 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 2.61
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 4.51
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0331185 3300035170 Bacteria 869
2 JGI24735J21928_10069746 3300002067 Bacteria 1007
3 Ga0070658_10412987 3300005327 Bacteria 1160
4 Ga0070683_100122774 3300005329 Bacteria 2454
5 Ga0070683_100143661 3300005329 Bacteria 2261
6 Ga0070683_100252013 3300005329 Bacteria 1679
7 Ga0070683_100344761 3300005329 Bacteria 1419
8 Ga0070690_100449972 3300005330 Bacteria 955
9 Ga0070670_100893311 3300005331 Bacteria 805
10 Ga0070680_100143355 3300005336 Bacteria 2003
11 Ga0070680_100470532 3300005336 Bacteria 1074
12 Ga0068868_100174222 3300005338 Bacteria 1782
13 Ga0068868_100184573 3300005338 Bacteria 1732
14 Ga0070660_100406584 3300005339 Bacteria 1126
15 Ga0070692_10414222 3300005345 Bacteria 854
16 Ga0070673_100143876 3300005364 Bacteria 2014
17 Ga0070673_100373482 3300005364 Bacteria 1270
18 Ga0070659_100000541 3300005366 Bacteria 27562
19 Ga0070709_10015919 3300005434 Bacteria 4283
20 Ga0070709_10032636 3300005434 Bacteria 3141
21 Ga0070709_10039565 3300005434 Bacteria 2894
22 Ga0070709_10289110 3300005434 Bacteria 1194
23 Ga0070709_10348504 3300005434 Bacteria 1093
24 Ga0070709_10434779 3300005434 Bacteria 986
25 Ga0070714_100061625 3300005435 Bacteria 3223
26 Ga0070714_100096346 3300005435 Bacteria 2600
27 Ga0070714_100130758 3300005435 Bacteria 2243
28 Ga0070714_100141071 3300005435 Bacteria 2163
29 Ga0070714_100324972 3300005435 Bacteria 1439
30 Ga0070714_100822842 3300005435 Bacteria 900
31 Ga0070714_101108281 3300005435 Bacteria 771
32 Ga0070713_100016662 3300005436 Bacteria 5529
33 Ga0070713_100050293 3300005436 Bacteria 3442
34 Ga0070713_100093533 3300005436 Bacteria 2590
35 Ga0070713_100135031 3300005436 Bacteria 2179
36 Ga0070713_100380269 3300005436 Bacteria 1315
37 Ga0070713_100831970 3300005436 Bacteria 886
38 Ga0070713_101208865 3300005436 Bacteria 732
39 Ga0070710_10004870 3300005437 Bacteria 6349
40 Ga0070710_10138970 3300005437 Bacteria 1488
41 Ga0070710_10195776 3300005437 Bacteria 1273
42 Ga0070701_10040362 3300005438 Bacteria 2372
43 Ga0070711_100004421 3300005439 Bacteria 8295
44 Ga0070711_100048205 3300005439 Bacteria 2911
45 Ga0070711_100098079 3300005439 Bacteria 2126
46 Ga0070711_100117549 3300005439 Bacteria 1961
47 Ga0070711_100237441 3300005439 Bacteria 1424
48 Ga0070708_100117404 3300005445 Bacteria 2450
49 Ga0070708_100209187 3300005445 Bacteria 1828
50 Ga0070663_100220544 3300005455 Bacteria 1489
51 Ga0070681_10335916 3300005458 Bacteria 1420
52 Ga0070681_10461923 3300005458 Bacteria 1182
53 Ga0070681_10650854 3300005458 Bacteria 969
54 Ga0070681_10973536 3300005458 Bacteria 768
55 Ga0070706_100005810 3300005467 Bacteria 11723
56 Ga0070706_100042391 3300005467 Bacteria 4204
57 Ga0070706_100093932 3300005467 Bacteria 2783
58 Ga0070706_100329585 3300005467 Bacteria 1424
59 Ga0070706_100384647 3300005467 Bacteria 1307
60 Ga0070707_100002288 3300005468 Bacteria 18303
61 Ga0070707_100022905 3300005468 Bacteria 5906
62 Ga0070707_100052688 3300005468 Bacteria 3901
63 Ga0070707_100289476 3300005468 Bacteria 1592
64 Ga0070707_100476951 3300005468 Bacteria 1209
65 Ga0070698_100003106 3300005471 Bacteria 18303
66 Ga0070698_100020747 3300005471 Bacteria 6886
67 Ga0070698_100215820 3300005471 Bacteria 1853
68 Ga0070698_100591555 3300005471 Bacteria 1050
69 Ga0070699_101126822 3300005518 Bacteria 720
70 Ga0070679_100116522 3300005530 Bacteria 2656
71 Ga0070684_100015811 3300005535 Bacteria 6157
72 Ga0070684_100671466 3300005535 Bacteria 965
73 Ga0070672_100337085 3300005543 Bacteria 1283
74 Ga0070665_100262845 3300005548 Bacteria 1727
75 Ga0070665_100443277 3300005548 Bacteria 1308
76 Ga0068855_100195351 3300005563 Bacteria 2280
77 Ga0068857_100097000 3300005577 Bacteria 2643
78 Ga0068857_100315686 3300005577 Bacteria 1442
79 Ga0068857_100719908 3300005577 Bacteria 949
80 Ga0068856_100022201 3300005614 Bacteria 6171
81 Ga0068856_100518792 3300005614 Bacteria 1213
82 Ga0068856_100705199 3300005614 Bacteria 1029
83 Ga0068856_100951125 3300005614 Bacteria 878
84 Ga0068864_100031082 3300005618 Bacteria 4529
85 Ga0068864_100050977 3300005618 Bacteria 3563
86 Ga0068864_100070620 3300005618 Bacteria 3039
87 Ga0068863_100002677 3300005841 Bacteria 17612
88 Ga0081455_10246100 3300005937 Bacteria 1311
89 Ga0070717_10153413 3300006028 Bacteria 1994
90 Ga0070717_10186148 3300006028 Bacteria 1812
91 Ga0070717_10898014 3300006028 Bacteria 806
92 Ga0070717_11012270 3300006028 Bacteria 757
93 Ga0075363_100133587 3300006048 Bacteria 1393
94 Ga0070715_10134815 3300006163 Bacteria 1192
95 Ga0070716_100078256 3300006173 Bacteria 1965
96 Ga0070716_100404550 3300006173 Bacteria 982
97 Ga0070712_100008689 3300006175 Bacteria 6398
98 Ga0070712_100022000 3300006175 Bacteria 4194
99 Ga0070712_100063244 3300006175 Bacteria 2620
100 Ga0070712_100418277 3300006175 Bacteria 1110
101 Ga0075428_100166899 3300006844 Bacteria 2388
102 Ga0075428_100280464 3300006844 Bacteria 1793
103 Ga0075428_100630750 3300006844 Bacteria 1144
104 Ga0075430_100001956 3300006846 Bacteria 16928
105 Ga0075430_100006100 3300006846 Bacteria 10161
106 Ga0075431_100108248 3300006847 Bacteria 2868
107 Ga0075429_100023083 3300006880 Bacteria 5394
108 Ga0105250_10104199 3300009092 Bacteria 1159
109 Ga0105245_10189500 3300009098 Bacteria 1969
110 Ga0105245_10317707 3300009098 Bacteria 1533
111 Ga0105245_10498074 3300009098 Bacteria 1234
112 Ga0105247_10336218 3300009101 Bacteria 1058
113 Ga0114129_10004382 3300009147 Bacteria 19907
114 Ga0114129_10865777 3300009147 Bacteria 1147
115 Ga0105248_10029187 3300009177 Bacteria 6151
116 Ga0105248_10198496 3300009177 Bacteria 2260
117 Ga0105248_10240659 3300009177 Bacteria 2037
118 Ga0105248_10909501 3300009177 Bacteria 994
119 Ga0105237_10074904 3300009545 Bacteria 3377
120 Ga0105249_10133231 3300009553 Bacteria 2375
121 Ga0105239_11503567 3300010375 Bacteria 778
122 Ga0157322_1016813 3300012490 Bacteria 665
123 Ga0157335_1005315 3300012492 Bacteria 897
124 Ga0157324_1017197 3300012506 Bacteria 697
125 Ga0157373_10227287 3300013100 Bacteria 1317
126 Ga0157371_10014536 3300013102 Bacteria 5938
127 Ga0157371_10279186 3300013102 Bacteria 1206
128 Ga0157369_10450168 3300013105 Bacteria 1333
129 Ga0157369_10875634 3300013105 Bacteria 921
130 Ga0157374_10024726 3300013296 Bacteria 5385
131 Ga0157374_11435399 3300013296 Bacteria 713
132 Ga0163162_10115715 3300013306 Bacteria 2782
133 Ga0163163_10012150 3300014325 Bacteria 7834
134 Ga0163163_10030396 3300014325 Bacteria 5205
135 Ga0163163_10970424 3300014325 Bacteria 913
136 Ga0157379_10013043 3300014968 Bacteria 7277
137 Ga0157379_10132549 3300014968 Bacteria 2243
138 Ga0157376_10014967 3300014969 Bacteria 5846
139 Ga0197907_10991385 3300020069 Bacteria 1147
140 Ga0206356_11439872 3300020070 Bacteria 1094
141 Ga0206355_1505630 3300020076 Bacteria 777
142 Ga0206351_10243120 3300020077 Bacteria 956
143 Ga0206352_11118830 3300020078 Bacteria 1039
144 Ga0206350_10499254 3300020080 Bacteria 1535
145 Ga0206354_11004784 3300020081 Bacteria 1009
146 Ga0206353_10729171 3300020082 Bacteria 1284
147 Ga0207692_10032211 3300025898 Bacteria 2517
148 Ga0207692_10076927 3300025898 Bacteria 1774
149 Ga0207642_10624030 3300025899 Bacteria 673
150 Ga0207710_10064510 3300025900 Bacteria 1668
151 Ga0207699_10036640 3300025906 Bacteria 2798
152 Ga0207699_10063394 3300025906 Bacteria 2232
153 Ga0207699_10099587 3300025906 Bacteria 1842
154 Ga0207699_10273505 3300025906 Bacteria 1171
155 Ga0207699_10727151 3300025906 Bacteria 727
156 Ga0207705_10024706 3300025909 Bacteria 4288
157 Ga0207705_10213482 3300025909 Bacteria 1464
158 Ga0207684_10001756 3300025910 Bacteria 22923
159 Ga0207684_10027555 3300025910 Bacteria 4839
160 Ga0207684_10308614 3300025910 Bacteria 1364
161 Ga0207707_10036081 3300025912 Bacteria 4323
162 Ga0207707_10798899 3300025912 Bacteria 786
163 Ga0207695_10288822 3300025913 Bacteria 1533
164 Ga0207671_10425979 3300025914 Bacteria 1056
165 Ga0207693_10011918 3300025915 Bacteria 7026
166 Ga0207693_10071635 3300025915 Bacteria 2713
167 Ga0207663_10068643 3300025916 Bacteria 2277
168 Ga0207663_10129000 3300025916 Bacteria 1744
169 Ga0207660_10239489 3300025917 Bacteria 1429
170 Ga0207657_10064900 3300025919 Bacteria 3114
171 Ga0207652_10011961 3300025921 Bacteria 7003
172 Ga0207652_10354643 3300025921 Bacteria 1324
173 Ga0207646_10003313 3300025922 Bacteria 18317
174 Ga0207646_10011602 3300025922 Bacteria 8518
175 Ga0207646_10043438 3300025922 Bacteria 4036
176 Ga0207646_10442318 3300025922 Bacteria 1173
177 Ga0207700_10002550 3300025928 Bacteria 10459
178 Ga0207700_10005490 3300025928 Bacteria 7603
179 Ga0207700_10074715 3300025928 Bacteria 2623
180 Ga0207700_10132493 3300025928 Bacteria 2037
181 Ga0207700_10446433 3300025928 Bacteria 1139
182 Ga0207700_10452962 3300025928 Bacteria 1131
183 Ga0207700_10600827 3300025928 Bacteria 979
184 Ga0207700_10842898 3300025928 Bacteria 820
185 Ga0207664_10031012 3300025929 Bacteria 4086
186 Ga0207664_10057711 3300025929 Bacteria 3086
187 Ga0207664_10121570 3300025929 Bacteria 2186
188 Ga0207664_10395629 3300025929 Bacteria 1228
189 Ga0207664_10595034 3300025929 Bacteria 993
190 Ga0207664_10637005 3300025929 Bacteria 958
191 Ga0207690_10146974 3300025932 Bacteria 1743
192 Ga0207690_10245726 3300025932 Bacteria 1380
193 Ga0207665_10003786 3300025939 Bacteria 10105
194 Ga0207665_10015129 3300025939 Bacteria 5067
195 Ga0207665_10195197 3300025939 Bacteria 1473
196 Ga0207691_10022565 3300025940 Bacteria 5935
197 Ga0207711_10066863 3300025941 Bacteria 3109
198 Ga0207711_10801765 3300025941 Bacteria 877
199 Ga0207661_10950413 3300025944 Bacteria 792
200 Ga0207679_10060619 3300025945 Bacteria 2812
201 Ga0207679_10389471 3300025945 Bacteria 1223
202 Ga0207667_10318188 3300025949 Bacteria 1589
203 Ga0207651_11073657 3300025960 Bacteria 721
204 Ga0207702_10036612 3300026078 Bacteria 4105
205 Ga0207702_10101158 3300026078 Bacteria 2545
206 Ga0207676_10022226 3300026095 Bacteria 4664
207 Ga0207674_10055769 3300026116 Bacteria 4016
208 Ga0207674_10252663 3300026116 Bacteria 1710
209 Ga0207674_10732177 3300026116 Bacteria 954
210 Ga0268266_10315412 3300028379 Bacteria 1462
211 Ga0268266_10998779 3300028379 Bacteria 810
212 Ga0268264_10132241 3300028381 Bacteria 2214
213 Ga0265337_1000337 3300028556 Bacteria 25047
214 Ga0265326_10007633 3300028558 Bacteria 3303
215 Ga0265319_1011703 3300028563 Bacteria 3574
216 Ga0265323_10015261 3300028653 Bacteria 3024
217 Ga0265338_10000315 3300028800 Bacteria 87685
218 Ga0265324_10002872 3300029957 Bacteria 8473
219 Ga0265760_10057333 3300031090 Bacteria 1180
220 Ga0265332_10004204 3300031238 Bacteria 6815
221 Ga0265320_10001430 3300031240 Bacteria 17363
222 Ga0265340_10004022 3300031247 Bacteria 8261
223 Ga0265339_10065661 3300031249 Bacteria 1945
224 Ga0265313_10014059 3300031595 Bacteria 4762
225 Ga0265314_10010283 3300031711 Bacteria 7818
226 Ga0265342_10004609 3300031712 Bacteria 10755
227 Ga0307409_100194983 3300031995 Bacteria 1807
228 Ga0373938_0087276 3300034957 Bacteria 767
229 Ga0373926_0052739 3300035083 Bacteria 1470
230 Ga0373934_0006128 3300035086 Bacteria 4454
231 Ga0373944_0003816 3300035089 Bacteria 3903
232 Ga0373923_0002472 3300035111 Bacteria 5701
233 Ga0373923_0041071 3300035111 Bacteria 1906
234 Ga0373936_0031348 3300035113 Bacteria 2099
235 Ga0373936_0118056 3300035113 Bacteria 1131
236 Ga0373945_0002385 3300035116 Bacteria 5892
237 Ga0373945_0098927 3300035116 Bacteria 1139
238 Ga0373945_0154453 3300035116 Bacteria 932
239 Ga0373954_0055102 3300035118 Bacteria 1870
240 Ga0373954_0075441 3300035118 Bacteria 1606
241 Ga0373956_0023021 3300035119 Bacteria 2670
242 Ga0373957_0033204 3300035120 Bacteria 1905
243 Ga0373957_0523519 3300035120 Bacteria 517
244 Ga0373943_0011566 3300035170 Bacteria 3972
245 Ga0373946_0000292 3300035171 Bacteria 16120
246 Ga0373946_0120623 3300035171 Bacteria 1197
247 Ga0373955_0016701 3300035172 Bacteria 3616
248 Ga0373955_0100533 3300035172 Bacteria 1659
249 Ga0373924_0000201 3300035410 Bacteria 17986
250 Ga0373924_0004089 3300035410 Bacteria 5074
251 Ga0373924_0147757 3300035410 Bacteria 1027
252 Ga0373931_0415284 3300035691 Bacteria 854
253 Ga0373935_0114227 3300035692 Bacteria 1796
254 Ga0373935_0126414 3300035692 Bacteria 1713
255 Ga0373935_0305063 3300035692 Bacteria 1126
256 Ga0373927_0025482 3300035695 Bacteria 3867
257 Ga0373927_0177013 3300035695 Bacteria 1399
258 Ga0373933_0078783 3300035724 Bacteria 2016
259 Ga0373947_0073128 3300035725 Bacteria 2106
260 Ga0373947_0416327 3300035725 Bacteria 908
261 Ga0373937_0128514 3300036401 Bacteria 2365
262 Ga0373937_0326305 3300036401 Bacteria 1452
263 Ga0373937_0526402 3300036401 Bacteria 1123
264 Ga0373937_0594562 3300036401 Bacteria 1050
265 Ga0373925_0009762 3300037068 Bacteria 6971
266 Ga0373925_0173222 3300037068 Bacteria 1704
267 Ga0373925_0350546 3300037068 Bacteria 1198
268 Ga0373925_0587008 3300037068 Bacteria 917
269 Ga0373925_0622378 3300037068 Bacteria 889
270 Ga0395900_0282350 3300037418 Bacteria 1652
271 Ga0395898_0321439 3300037466 Bacteria 1476
272 Ga0395898_1639662 3300037466 Bacteria 567
273 Ga0395901_0648808 3300038443 Bacteria 1059
274 Ga0395901_0746270 3300038443 Unclassified 972
275 Ga0436365_1064354 3300039437 Bacteria 4280
276 Ga0436363_0547802 3300039450 Bacteria 1132
277 Ga0436362_0960968 3300039453 Unclassified 1505
278 Ga0450910_012972 3300042147 Bacteria 1209
279 Ga0466965_0312509 3300044683 Bacteria 855
280 Ga0466963_0042513 3300044694 Bacteria 2985
281 Ga0466964_0107637 3300044706 Bacteria 1239
282 Ga0466970_0001569 3300044765 Bacteria 11032
283 Ga0466970_0158384 3300044765 Bacteria 1252
284 Ga0466970_0340762 3300044765 Bacteria 850
285 Ga0466957_0271557 3300044842 Bacteria 1132
286 Ga0466960_0109997 3300044901 Bacteria 1430
287 Ga0466960_0259448 3300044901 Bacteria 968
288 Ga0466959_0081382 3300045049 Unclassified 2334
289 Ga0495592_0000397 3300046454 Bacteria 33962
290 Ga0495592_0115860 3300046454 Bacteria 1891
291 Ga0495592_0122663 3300046454 Bacteria 1826
292 Ga0495603_0053238 3300046455 Bacteria 2401
293 Ga0495629_0017155 3300046459 Bacteria 5194
294 Ga0495641_0010311 3300046461 Bacteria 5424
295 Ga0495651_0000622 3300046462 Bacteria 27464
296 Ga0495651_0181787 3300046462 Bacteria 1488
297 Ga0495653_0000653 3300046463 Bacteria 26456
298 Ga0495653_0555235 3300046463 Bacteria 710
299 Ga0495580_0011926 3300046472 Bacteria 6697
300 Ga0495582_0268937 3300046473 Bacteria 978
301 Ga0495639_0005902 3300046475 Bacteria 5267
302 Ga0495639_0116498 3300046475 Bacteria 1272
303 Ga0495639_0457276 3300046475 Bacteria 649
304 Ga0495662_0002665 3300046476 Bacteria 9017
305 Ga0495662_0214790 3300046476 Bacteria 948
306 Ga0495664_0020228 3300046477 Bacteria 3836
307 Ga0495664_0080609 3300046477 Bacteria 1951
308 Ga0495664_0106112 3300046477 Bacteria 1694
309 Ga0495664_0200755 3300046477 Bacteria 1208
310 Ga0495608_0054770 3300046511 Bacteria 2636
311 Ga0495618_0009875 3300046514 Bacteria 5776
312 Ga0495618_0027520 3300046514 Bacteria 3538
313 Ga0495618_0346653 3300046514 Bacteria 916
314 Ga0495618_0651984 3300046514 Bacteria 622
315 Ga0495628_0015185 3300046516 Bacteria 6433
316 Ga0495628_0118877 3300046516 Bacteria 2028
317 Ga0495630_0046995 3300046517 Bacteria 3227
318 Ga0495630_0119213 3300046517 Bacteria 2001
319 Ga0495630_0151923 3300046517 Bacteria 1762
320 Ga0495666_0104841 3300046526 Bacteria 1331
321 Ga0495652_0011219 3300046529 Bacteria 8112
322 Ga0495652_0275565 3300046529 Bacteria 1234
323 Ga0495665_0116240 3300046531 Bacteria 1401
324 Ga0495640_0012324 3300046533 Bacteria 6538
325 Ga0495640_0022175 3300046533 Bacteria 4647
326 Ga0495640_0031502 3300046533 Bacteria 3784
327 Ga0495586_0095960 3300046535 Bacteria 1642
328 Ga0495586_0169588 3300046535 Bacteria 1233
329 Ga0495587_0002185 3300046536 Bacteria 13084
330 Ga0495645_0010615 3300046543 Bacteria 6467
331 Ga0495645_0088130 3300046543 Bacteria 2220
332 Ga0495645_0173035 3300046543 Bacteria 1485
333 Ga0495622_0221601 3300046557 Bacteria 838
334 Ga0495667_0012458 3300046559 Bacteria 5766
335 Ga0495656_0142940 3300046615 Bacteria 1149
336 Ga0495634_0006816 3300046642 Bacteria 8646
337 Ga0495634_0076577 3300046642 Bacteria 2195
338 Ga0495611_0302082 3300046648 Bacteria 738
339 Ga0495635_0019533 3300046663 Bacteria 4721
340 Ga0495635_0059655 3300046663 Bacteria 2623
341 Ga0495635_0755097 3300046663 Bacteria 628
342 Ga0495588_0008838 3300046674 Bacteria 4633
343 Ga0495657_0002699 3300046675 Bacteria 14825
344 Ga0495657_0019597 3300046675 Bacteria 4878
345 Ga0495657_0181100 3300046675 Bacteria 1293
346 Ga0495599_0000342 3300046678 Bacteria 27675
347 Ga0495599_0100555 3300046678 Bacteria 1802
348 Ga0495599_0160613 3300046678 Bacteria 1389
349 Ga0495599_0243023 3300046678 Bacteria 1097
350 Ga0495599_0431169 3300046678 Bacteria 782
351 Ga0495623_0027274 3300046679 Bacteria 3673
352 Ga0495646_0017806 3300046680 Bacteria 4503
353 Ga0495646_0026074 3300046680 Bacteria 3671
354 Ga0495646_0284327 3300046680 Bacteria 878
355 Ga0495613_0052473 3300046689 Bacteria 3003
356 Ga0495624_0190816 3300046690 Bacteria 1246
357 Ga0495600_0015497 3300046809 Bacteria 4819
358 Ga0495600_0029882 3300046809 Bacteria 3529
359 Ga0495581_0070883 3300047315 Bacteria 2016
360 Ga0495604_0003885 3300047317 Bacteria 11895
361 Ga0495604_0028177 3300047317 Bacteria 4467
362 Ga0495604_0268115 3300047317 Bacteria 1158
363 Ga0495674_0012012 3300047319 Bacteria 8164
364 Ga0495674_0113727 3300047319 Bacteria 2292
365 Ga0495674_0165376 3300047319 Bacteria 1849
366 Ga0495674_0240540 3300047319 Bacteria 1492
367 Ga0495674_0285081 3300047319 Bacteria 1352
368 Ga0495674_0488999 3300047319 Bacteria 985
369 Ga0495676_0011735 3300047321 Bacteria 7902
370 Ga0495676_0176525 3300047321 Bacteria 1500
371 Ga0495676_0309069 3300047321 Bacteria 1064
372 Ga0495680_0139118 3300047322 Bacteria 1777
373 Ga0495675_0011612 3300047444 Bacteria 5530
374 Ga0495675_0144895 3300047444 Bacteria 1470
375 Ga0495677_0324232 3300047445 Bacteria 607
376 Ga0495685_172676 3300047447 Bacteria 698
377 Ga0495684_0000603 3300047471 Bacteria 28888
378 Ga0495602_0001594 3300048088 Bacteria 22561
379 Ga0495602_0330870 3300048088 Bacteria 1105
380 Ga0495614_0033720 3300048089 Bacteria 2202
381 Ga0496100_0382088 3300048903 Bacteria 1070
382 Ga0496104_0011216 3300048907 Bacteria 8019
383 Ga0496104_0082256 3300048907 Bacteria 3070
384 Ga0496105_0008553 3300048908 Bacteria 7951
385 Ga0496106_0054247 3300048909 Bacteria 3028
386 Ga0496107_0635037 3300048910 Bacteria 788
387 Ga0496108_0008061 3300048911 Bacteria 8546
388 Ga0496109_0066179 3300048912 Bacteria 3308
389 Ga0496109_0262619 3300048912 Bacteria 1626
390 Ga0496110_0002242 3300048913 Bacteria 14460
391 Ga0496110_0007673 3300048913 Bacteria 8633
392 Ga0496110_0565561 3300048913 Bacteria 1033
393 Ga0496111_0079241 3300048914 Bacteria 2396
394 Ga0496112_0043719 3300048915 Bacteria 4387
395 Ga0496113_0012180 3300048916 Bacteria 5772
396 Ga0496113_0304171 3300048916 Bacteria 1277
397 Ga0496113_0329682 3300048916 Bacteria 1224
398 Ga0496114_0082125 3300048917 Bacteria 2723
399 Ga0496115_0888365 3300048918 Bacteria 688
400 Ga0501043_0832512 3300049579 Bacteria 666
401 Ga0501069_0022487 3300049585 Bacteria 3431
402 Ga0501075_0572969 3300049591 Bacteria 861
403 Ga0501262_055587 3300049759 Bacteria 622
404 nmdc:mga03n38_108538_c1 3300050490 Bacteria 1348
405 nmdc:mga05p37_645187_c1 3300050507 Bacteria 1187
406 nmdc:mga09592_15301_c1 3300050508 Bacteria 2114
407 nmdc:mga09592_250044_c1 3300050508 Bacteria 1537
408 nmdc:mga0qj67_360037_c1 3300050509 Bacteria 1176
409 nmdc:mga0qj67_3641_c1 3300050509 Bacteria 11118
410 nmdc:mga06r32_181778_c1 3300050510 Bacteria 2089
411 nmdc:mga08x19_137388_c1 3300050514 Bacteria 1649
412 Ga0495601_0018805 3300053077 Bacteria 4207
413 Ga0495601_0033175 3300053077 Bacteria 3216
414 Ga0495601_0132082 3300053077 Bacteria 1626
415 Ga0495612_0051214 3300053078 Bacteria 1696
416 Ga0495612_0176184 3300053078 Bacteria 938
417 Ga0495595_0001671 3300053084 Bacteria 8682
418 Ga0495619_0009664 3300053085 Bacteria 6083
419 Ga0587080_026853 3300059503 Bacteria 980
420 Ga0587099_015358 3300059622 Bacteria 817
421 2919448446 2919446982 Bacteria 3994487
422 Ga0373943_0331185
423 JGI24735J21928_10069746
424 Ga0070658_10412987
425 Ga0070683_100122774
426 Ga0070683_100143661
427 Ga0070683_100252013
428 Ga0070683_100344761
429 Ga0070690_100449972
430 Ga0070670_100893311
431 Ga0070680_100143355
432 Ga0070680_100470532
433 Ga0068868_100174222
434 Ga0068868_100184573
435 Ga0070660_100406584
436 Ga0070692_10414222
437 Ga0070673_100143876
438 Ga0070673_100373482
439 Ga0070659_100000541
440 Ga0070709_10015919
441 Ga0070709_10032636
442 Ga0070709_10039565
443 Ga0070709_10289110
444 Ga0070709_10348504
445 Ga0070709_10434779
446 Ga0070714_100061625
447 Ga0070714_100096346
448 Ga0070714_100130758
449 Ga0070714_100141071
450 Ga0070714_100324972
451 Ga0070714_100822842
452 Ga0070714_101108281
453 Ga0070713_100016662
454 Ga0070713_100050293
455 Ga0070713_100093533
456 Ga0070713_100135031
457 Ga0070713_100380269
458 Ga0070713_100831970
459 Ga0070713_101208865
460 Ga0070710_10004870
461 Ga0070710_10138970
462 Ga0070710_10195776
463 Ga0070701_10040362
464 Ga0070711_100004421
465 Ga0070711_100048205
466 Ga0070711_100098079
467 Ga0070711_100117549
468 Ga0070711_100237441
469 Ga0070708_100117404
470 Ga0070708_100209187
471 Ga0070663_100220544
472 Ga0070681_10335916
473 Ga0070681_10461923
474 Ga0070681_10650854
475 Ga0070681_10973536
476 Ga0070706_100005810
477 Ga0070706_100042391
478 Ga0070706_100093932
479 Ga0070706_100329585
480 Ga0070706_100384647
481 Ga0070707_100002288
482 Ga0070707_100022905
483 Ga0070707_100052688
484 Ga0070707_100289476
485 Ga0070707_100476951
486 Ga0070698_100003106
487 Ga0070698_100020747
488 Ga0070698_100215820
489 Ga0070698_100591555
490 Ga0070699_101126822
491 Ga0070679_100116522
492 Ga0070684_100015811
493 Ga0070684_100671466
494 Ga0070672_100337085
495 Ga0070665_100262845
496 Ga0070665_100443277
497 Ga0068855_100195351
498 Ga0068857_100097000
499 Ga0068857_100315686
500 Ga0068857_100719908
501 Ga0068856_100022201
502 Ga0068856_100518792
503 Ga0068856_100705199
504 Ga0068856_100951125
505 Ga0068864_100031082
506 Ga0068864_100050977
507 Ga0068864_100070620
508 Ga0068863_100002677
509 Ga0081455_10246100
510 Ga0070717_10153413
511 Ga0070717_10186148
512 Ga0070717_10898014
513 Ga0070717_11012270
514 Ga0075363_100133587
515 Ga0070715_10134815
516 Ga0070716_100078256
517 Ga0070716_100404550
518 Ga0070712_100008689
519 Ga0070712_100022000
520 Ga0070712_100063244
521 Ga0070712_100418277
522 Ga0075428_100166899
523 Ga0075428_100280464
524 Ga0075428_100630750
525 Ga0075430_100001956
526 Ga0075430_100006100
527 Ga0075431_100108248
528 Ga0075429_100023083
529 Ga0105250_10104199
530 Ga0105245_10189500
531 Ga0105245_10317707
532 Ga0105245_10498074
533 Ga0105247_10336218
534 Ga0114129_10004382
535 Ga0114129_10865777
536 Ga0105248_10029187
537 Ga0105248_10198496
538 Ga0105248_10240659
539 Ga0105248_10909501
540 Ga0105237_10074904
541 Ga0105249_10133231
542 Ga0105239_11503567
543 Ga0157322_1016813
544 Ga0157335_1005315
545 Ga0157324_1017197
546 Ga0157373_10227287
547 Ga0157371_10014536
548 Ga0157371_10279186
549 Ga0157369_10450168
550 Ga0157369_10875634
551 Ga0157374_10024726
552 Ga0157374_11435399
553 Ga0163162_10115715
554 Ga0163163_10012150
555 Ga0163163_10030396
556 Ga0163163_10970424
557 Ga0157379_10013043
558 Ga0157379_10132549
559 Ga0157376_10014967
560 Ga0197907_10991385
561 Ga0206356_11439872
562 Ga0206355_1505630
563 Ga0206351_10243120
564 Ga0206352_11118830
565 Ga0206350_10499254
566 Ga0206354_11004784
567 Ga0206353_10729171
568 Ga0207692_10032211
569 Ga0207692_10076927
570 Ga0207642_10624030
571 Ga0207710_10064510
572 Ga0207699_10036640
573 Ga0207699_10063394
574 Ga0207699_10099587
575 Ga0207699_10273505
576 Ga0207699_10727151
577 Ga0207705_10024706
578 Ga0207705_10213482
579 Ga0207684_10001756
580 Ga0207684_10027555
581 Ga0207684_10308614
582 Ga0207707_10036081
583 Ga0207707_10798899
584 Ga0207695_10288822
585 Ga0207671_10425979
586 Ga0207693_10011918
587 Ga0207693_10071635
588 Ga0207663_10068643
589 Ga0207663_10129000
590 Ga0207660_10239489
591 Ga0207657_10064900
592 Ga0207652_10011961
593 Ga0207652_10354643
594 Ga0207646_10003313
595 Ga0207646_10011602
596 Ga0207646_10043438
597 Ga0207646_10442318
598 Ga0207700_10002550
599 Ga0207700_10005490
600 Ga0207700_10074715
601 Ga0207700_10132493
602 Ga0207700_10446433
603 Ga0207700_10452962
604 Ga0207700_10600827
605 Ga0207700_10842898
606 Ga0207664_10031012
607 Ga0207664_10057711
608 Ga0207664_10121570
609 Ga0207664_10395629
610 Ga0207664_10595034
611 Ga0207664_10637005
612 Ga0207690_10146974
613 Ga0207690_10245726
614 Ga0207665_10003786
615 Ga0207665_10015129
616 Ga0207665_10195197
617 Ga0207691_10022565
618 Ga0207711_10066863
619 Ga0207711_10801765
620 Ga0207661_10950413
621 Ga0207679_10060619
622 Ga0207679_10389471
623 Ga0207667_10318188
624 Ga0207651_11073657
625 Ga0207702_10036612
626 Ga0207702_10101158
627 Ga0207676_10022226
628 Ga0207674_10055769
629 Ga0207674_10252663
630 Ga0207674_10732177
631 Ga0268266_10315412
632 Ga0268266_10998779
633 Ga0268264_10132241
634 Ga0265337_1000337
635 Ga0265326_10007633
636 Ga0265319_1011703
637 Ga0265323_10015261
638 Ga0265338_10000315
639 Ga0265324_10002872
640 Ga0265760_10057333
641 Ga0265332_10004204
642 Ga0265320_10001430
643 Ga0265340_10004022
644 Ga0265339_10065661
645 Ga0265313_10014059
646 Ga0265314_10010283
647 Ga0265342_10004609
648 Ga0307409_100194983
649 Ga0373938_0087276
650 Ga0373926_0052739
651 Ga0373934_0006128
652 Ga0373944_0003816
653 Ga0373923_0002472
654 Ga0373923_0041071
655 Ga0373936_0031348
656 Ga0373936_0118056
657 Ga0373945_0002385
658 Ga0373945_0098927
659 Ga0373945_0154453
660 Ga0373954_0055102
661 Ga0373954_0075441
662 Ga0373956_0023021
663 Ga0373957_0033204
664 Ga0373957_0523519
665 Ga0373943_0011566
666 Ga0373946_0000292
667 Ga0373946_0120623
668 Ga0373955_0016701
669 Ga0373955_0100533
670 Ga0373924_0000201
671 Ga0373924_0004089
672 Ga0373924_0147757
673 Ga0373931_0415284
674 Ga0373935_0114227
675 Ga0373935_0126414
676 Ga0373935_0305063
677 Ga0373927_0025482
678 Ga0373927_0177013
679 Ga0373933_0078783
680 Ga0373947_0073128
681 Ga0373947_0416327
682 Ga0373937_0128514
683 Ga0373937_0326305
684 Ga0373937_0526402
685 Ga0373937_0594562
686 Ga0373925_0009762
687 Ga0373925_0173222
688 Ga0373925_0350546
689 Ga0373925_0587008
690 Ga0373925_0622378
691 Ga0395900_0282350
692 Ga0395898_0321439
693 Ga0395898_1639662
694 Ga0395901_0648808
695 Ga0395901_0746270
696 Ga0436365_1064354
697 Ga0436363_0547802
698 Ga0436362_0960968
699 Ga0450910_012972
700 Ga0466965_0312509
701 Ga0466963_0042513
702 Ga0466964_0107637
703 Ga0466970_0001569
704 Ga0466970_0158384
705 Ga0466970_0340762
706 Ga0466957_0271557
707 Ga0466960_0109997
708 Ga0466960_0259448
709 Ga0466959_0081382
710 Ga0495592_0000397
711 Ga0495592_0115860
712 Ga0495592_0122663
713 Ga0495603_0053238
714 Ga0495629_0017155
715 Ga0495641_0010311
716 Ga0495651_0000622
717 Ga0495651_0181787
718 Ga0495653_0000653
719 Ga0495653_0555235
720 Ga0495580_0011926
721 Ga0495582_0268937
722 Ga0495639_0005902
723 Ga0495639_0116498
724 Ga0495639_0457276
725 Ga0495662_0002665
726 Ga0495662_0214790
727 Ga0495664_0020228
728 Ga0495664_0080609
729 Ga0495664_0106112
730 Ga0495664_0200755
731 Ga0495608_0054770
732 Ga0495618_0009875
733 Ga0495618_0027520
734 Ga0495618_0346653
735 Ga0495618_0651984
736 Ga0495628_0015185
737 Ga0495628_0118877
738 Ga0495630_0046995
739 Ga0495630_0119213
740 Ga0495630_0151923
741 Ga0495666_0104841
742 Ga0495652_0011219
743 Ga0495652_0275565
744 Ga0495665_0116240
745 Ga0495640_0012324
746 Ga0495640_0022175
747 Ga0495640_0031502
748 Ga0495586_0095960
749 Ga0495586_0169588
750 Ga0495587_0002185
751 Ga0495645_0010615
752 Ga0495645_0088130
753 Ga0495645_0173035
754 Ga0495622_0221601
755 Ga0495667_0012458
756 Ga0495656_0142940
757 Ga0495634_0006816
758 Ga0495634_0076577
759 Ga0495611_0302082
760 Ga0495635_0019533
761 Ga0495635_0059655
762 Ga0495635_0755097
763 Ga0495588_0008838
764 Ga0495657_0002699
765 Ga0495657_0019597
766 Ga0495657_0181100
767 Ga0495599_0000342
768 Ga0495599_0100555
769 Ga0495599_0160613
770 Ga0495599_0243023
771 Ga0495599_0431169
772 Ga0495623_0027274
773 Ga0495646_0017806
774 Ga0495646_0026074
775 Ga0495646_0284327
776 Ga0495613_0052473
777 Ga0495624_0190816
778 Ga0495600_0015497
779 Ga0495600_0029882
780 Ga0495581_0070883
781 Ga0495604_0003885
782 Ga0495604_0028177
783 Ga0495604_0268115
784 Ga0495674_0012012
785 Ga0495674_0113727
786 Ga0495674_0165376
787 Ga0495674_0240540
788 Ga0495674_0285081
789 Ga0495674_0488999
790 Ga0495676_0011735
791 Ga0495676_0176525
792 Ga0495676_0309069
793 Ga0495680_0139118
794 Ga0495675_0011612
795 Ga0495675_0144895
796 Ga0495677_0324232
797 Ga0495685_172676
798 Ga0495684_0000603
799 Ga0495602_0001594
800 Ga0495602_0330870
801 Ga0495614_0033720
802 Ga0496100_0382088
803 Ga0496104_0011216
804 Ga0496104_0082256
805 Ga0496105_0008553
806 Ga0496106_0054247
807 Ga0496107_0635037
808 Ga0496108_0008061
809 Ga0496109_0066179
810 Ga0496109_0262619
811 Ga0496110_0002242
812 Ga0496110_0007673
813 Ga0496110_0565561
814 Ga0496111_0079241
815 Ga0496112_0043719
816 Ga0496113_0012180
817 Ga0496113_0304171
818 Ga0496113_0329682
819 Ga0496114_0082125
820 Ga0496115_0888365
821 Ga0501043_0832512
822 Ga0501069_0022487
823 Ga0501075_0572969
824 Ga0501262_055587
825 nmdc:mga03n38_108538_c1
826 nmdc:mga05p37_645187_c1
827 nmdc:mga09592_15301_c1
828 nmdc:mga09592_250044_c1
829 nmdc:mga0qj67_360037_c1
830 nmdc:mga0qj67_3641_c1
831 nmdc:mga06r32_181778_c1
832 nmdc:mga08x19_137388_c1
833 Ga0495601_0018805
834 Ga0495601_0033175
835 Ga0495601_0132082
836 Ga0495612_0051214
837 Ga0495612_0176184
838 Ga0495595_0001671
839 Ga0495619_0009664
840 Ga0587080_026853
841 Ga0587099_015358
842 2919448446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

30

207

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8681 1 179
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8494 1 179
4l82-assembly1.cif.gz_B structure of a putative oxidoreductase from rickettsia felis 0.8082 160 182
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8081 3 180
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7998 3 180
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8681 1 179 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8494 1 179 3.40.430.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7822 160 182 2.30.110.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7747 4 179 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7728 6 179 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1G9I3A7-F1-model_v4 Dihydrofolate reductase 0.9483 2 181 GO:0008703
GO:0009231
AF-A0A4Y3WS67-F1-model_v4 Deaminase 0.933 1 183 GO:0008703
GO:0009231
AF-A0A0W7X5P0-F1-model_v4 Deaminase 0.9188 3 181 GO:0008703
GO:0009231
AF-A0A1E4I276-F1-model_v4 Deaminase 0.9099 1 181 GO:0008703
GO:0009231
AF-A0A7X7CE49-F1-model_v4 Dihydrofolate reductase 0.9035 3 181 GO:0008703
GO:0009231

Map