F440034

General Info

Members Datasets Scaffolds Average Seq Length
421 238 842 96

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10165145|Ga0316578_101651452
Length 110
Sequence MGILGSLEVMMTTIYDVLRRPIITEKSNFQNGILNQVVFEVAPDANKKMIKEAVEVLFDVQVEWVNVLNMPAKRSRRWQSRRVLIRKPGYKKAIVQLAPGDSIDVFEGVR

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
103 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
104 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
120 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
121 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
122 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
210 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
225 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
226 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
227 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
228 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
229 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
230 2842682962 Bacillus sp. R-72492 Isolate Unclassified
231 2849139964 Bacillus sp. R-71875 Isolate Unclassified
232 2857581216 Bacillus sp. R-71922 Isolate Unclassified
233 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
234 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
235 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
236 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
237 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
238 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.66
Metatranscriptomes 32.78
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 2.14
Rhizosphere 90.02
Stem 0
Stem Tuber 0
Unclassified 14.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10165145 3300031728 Bacteria 1334
2 SwRhRL2b_contig_1398824 2162886007 Bacteria 2557
3 JGI25151J46595_10012054 3300003187 Bacteria 3943
4 JGI25151J46595_10139085 3300003187 Bacteria 594
5 rootL2_10195668 3300003322 Bacteria 1577
6 Ga0055538_1000160 3300003751 Bacteria 44715
7 Ga0055536_1003459 3300003781 Bacteria 8458
8 Ga0058859_11224629 3300004798 Unclassified 610
9 Ga0065704_10093923 3300005289 Bacteria 2570
10 Ga0065712_10217425 3300005290 Bacteria 1035
11 Ga0065712_10554893 3300005290 Bacteria 615
12 Ga0065707_10085242 3300005295 Bacteria 6325
13 Ga0065707_10882035 3300005295 Unclassified 572
14 Ga0070670_100878784 3300005331 Unclassified 812
15 Ga0070670_101028438 3300005331 Unclassified 750
16 Ga0070670_102261481 3300005331 Unclassified 501
17 Ga0070666_11244189 3300005335 Unclassified 555
18 Ga0070682_100364867 3300005337 Bacteria 1081
19 Ga0070682_100909471 3300005337 Bacteria 724
20 Ga0068868_101578894 3300005338 Unclassified 616
21 Ga0070689_101864830 3300005340 Bacteria 549
22 Ga0070687_100122245 3300005343 Bacteria 1490
23 Ga0070675_100151467 3300005354 Bacteria 1989
24 Ga0070675_101858317 3300005354 Unclassified 556
25 Ga0070674_100350987 3300005356 Bacteria 1191
26 Ga0070673_100879832 3300005364 Bacteria 830
27 Ga0070673_101197468 3300005364 Bacteria 712
28 Ga0070673_102190466 3300005364 Bacteria 525
29 Ga0070713_100302121 3300005436 Bacteria 1473
30 Ga0070701_10905872 3300005438 Unclassified 609
31 Ga0070663_100587541 3300005455 Bacteria 935
32 Ga0070681_10029747 3300005458 Bacteria 5483
33 Ga0070707_100075438 3300005468 Bacteria 3253
34 Ga0070698_101038849 3300005471 Bacteria 767
35 Ga0070684_100052381 3300005535 Bacteria 3550
36 Ga0070684_101089324 3300005535 Bacteria 751
37 Ga0070672_100029772 3300005543 Bacteria 4097
38 Ga0070672_100508785 3300005543 Bacteria 1042
39 Ga0070672_102178433 3300005543 Unclassified 500
40 Ga0070686_100811101 3300005544 Bacteria 755
41 Ga0070664_100069855 3300005564 Bacteria 3006
42 Ga0070664_100360988 3300005564 Bacteria 1323
43 Ga0070664_100923615 3300005564 Bacteria 819
44 Ga0068857_101549677 3300005577 Unclassified 646
45 Ga0068856_100592761 3300005614 Bacteria 1129
46 Ga0070702_100519618 3300005615 Bacteria 878
47 Ga0068870_10157532 3300005840 Bacteria 1343
48 Ga0068870_10863119 3300005840 Bacteria 637
49 Ga0068860_100260911 3300005843 Bacteria 1689
50 Ga0068862_101005890 3300005844 Unclassified 825
51 Ga0075364_10776945 3300006051 Bacteria 653
52 Ga0075432_10318205 3300006058 Unclassified 651
53 Ga0075428_100027440 3300006844 Bacteria 6299
54 Ga0075428_100127065 3300006844 Bacteria 2774
55 Ga0075428_100201539 3300006844 Bacteria 2151
56 Ga0075430_100035323 3300006846 Bacteria 4240
57 Ga0075430_100490467 3300006846 Bacteria 1014
58 Ga0075431_101107434 3300006847 Bacteria 756
59 Ga0075433_11040966 3300006852 Bacteria 712
60 Ga0075434_100047847 3300006871 Bacteria 4243
61 Ga0075434_100049262 3300006871 Bacteria 4182
62 Ga0075434_100645637 3300006871 Bacteria 1077
63 Ga0075429_100320687 3300006880 Bacteria 1356
64 Ga0105240_11022228 3300009093 Bacteria 883
65 Ga0111539_10133012 3300009094 Bacteria 2912
66 Ga0111539_12222351 3300009094 Bacteria 636
67 Ga0105245_10535757 3300009098 Bacteria 1191
68 Ga0105245_13010862 3300009098 Unclassified 522
69 Ga0105247_10518571 3300009101 Bacteria 871
70 Ga0114129_10052031 3300009147 Bacteria 5748
71 Ga0114129_10175239 3300009147 Bacteria 2921
72 Ga0114129_13091135 3300009147 Unclassified 544
73 Ga0105243_10703476 3300009148 Bacteria 985
74 Ga0105241_10940236 3300009174 Bacteria 805
75 Ga0105242_10255950 3300009176 Bacteria 1579
76 Ga0105242_11705909 3300009176 Bacteria 666
77 Ga0105237_10034038 3300009545 Bacteria 5160
78 Ga0105237_10961365 3300009545 Bacteria 861
79 Ga0105237_12332027 3300009545 Unclassified 545
80 Ga0105249_11142867 3300009553 Unclassified 849
81 Ga0105239_10792906 3300010375 Bacteria 1085
82 Ga0157325_1012115 3300012485 Bacteria 660
83 Ga0157371_10009714 3300013102 Bacteria 7550
84 Ga0157371_10639457 3300013102 Bacteria 793
85 Ga0157371_11319476 3300013102 Unclassified 559
86 Ga0157374_10054504 3300013296 Bacteria 3730
87 Ga0157378_10115797 3300013297 Bacteria 2464
88 Ga0157378_10827984 3300013297 Bacteria 953
89 Ga0163162_10907490 3300013306 Bacteria 994
90 Ga0163162_11521428 3300013306 Bacteria 762
91 Ga0157375_11573993 3300013308 Unclassified 777
92 Ga0157375_13270156 3300013308 Bacteria 540
93 Ga0163163_10936253 3300014325 Bacteria 930
94 Ga0163163_13276728 3300014325 Bacteria 505
95 Ga0163161_10573290 3300017792 Unclassified 927
96 Ga0209784_100044 3300025224 Bacteria 206858
97 Ga0209676_1095260 3300025292 Bacteria 645
98 Ga0209025_1009107 3300025294 Bacteria 6991
99 Ga0209025_1045113 3300025294 Bacteria 1832
100 Ga0207697_10190004 3300025315 Bacteria 902
101 Ga0207688_10359745 3300025901 Unclassified 898
102 Ga0207643_10553553 3300025908 Bacteria 738
103 Ga0207707_10084493 3300025912 Bacteria 2772
104 Ga0207671_10084674 3300025914 Bacteria 2381
105 Ga0207646_10037563 3300025922 Bacteria 4366
106 Ga0207650_10824277 3300025925 Unclassified 787
107 Ga0207650_11231048 3300025925 Unclassified 637
108 Ga0207659_11057766 3300025926 Bacteria 698
109 Ga0207659_11232419 3300025926 Unclassified 643
110 Ga0207700_10049159 3300025928 Bacteria 3136
111 Ga0207709_10349009 3300025935 Bacteria 1116
112 Ga0207691_10060357 3300025940 Bacteria 3445
113 Ga0207691_10445747 3300025940 Bacteria 1102
114 Ga0207691_11178602 3300025940 Bacteria 636
115 Ga0207689_10205153 3300025942 Bacteria 1628
116 Ga0207661_10926342 3300025944 Bacteria 803
117 Ga0207661_11302815 3300025944 Bacteria 668
118 Ga0207679_10058841 3300025945 Bacteria 2850
119 Ga0207651_10992165 3300025960 Unclassified 750
120 Ga0207712_10330520 3300025961 Bacteria 1261
121 Ga0207668_10271457 3300025972 Bacteria 1387
122 Ga0207658_10349796 3300025986 Bacteria 1287
123 Ga0207703_11868876 3300026035 Unclassified 577
124 Ga0207678_11941308 3300026067 Unclassified 513
125 Ga0207641_11781330 3300026088 Bacteria 618
126 Ga0207641_12378929 3300026088 Unclassified 529
127 Ga0207698_11206292 3300026142 Unclassified 771
128 Ga0207698_12611178 3300026142 Unclassified 514
129 Ga0209998_10134917 3300027717 Unclassified 628
130 Ga0207428_11226166 3300027907 Unclassified 521
131 Ga0268266_12059735 3300028379 Unclassified 544
132 Ga0268265_10780558 3300028380 Bacteria 930
133 Ga0268265_11350082 3300028380 Unclassified 714
134 Ga0268264_12449793 3300028381 Unclassified 527
135 Ga0316575_10088179 3300031665 Bacteria 1255
136 Ga0316579_10024838 3300031691 Bacteria 2700
137 Ga0316579_10299324 3300031691 Unclassified 778
138 Ga0316576_10069836 3300031727 Bacteria 2590
139 Ga0316576_10246260 3300031727 Bacteria 1342
140 Ga0316576_10470057 3300031727 Bacteria 927
141 Ga0316576_10475401 3300031727 Unclassified 921
142 Ga0316576_11285947 3300031727 Unclassified 515
143 Ga0316578_10016793 3300031728 Bacteria 3971
144 Ga0316578_10022554 3300031728 Bacteria 3511
145 Ga0316578_10042194 3300031728 Bacteria 2644
146 Ga0316577_10000311 3300031733 Bacteria 17784
147 Ga0316577_10258888 3300031733 Bacteria 984
148 Ga0316577_10267646 3300031733 Bacteria 967
149 Ga0307413_10821092 3300031824 Bacteria 783
150 Ga0307407_10512815 3300031903 Bacteria 881
151 Ga0307412_11316619 3300031911 Bacteria 651
152 Ga0307409_100345386 3300031995 Bacteria 1402
153 Ga0307409_100413436 3300031995 Bacteria 1292
154 Ga0307416_101997850 3300032002 Bacteria 682
155 Ga0316585_10013627 3300032137 Bacteria 2422
156 Ga0316580_10120193 3300032139 Bacteria 804
157 Ga0316593_10000072 3300032168 Bacteria 12236
158 Ga0316593_10000758 3300032168 Bacteria 6386
159 Ga0316593_10008449 3300032168 Bacteria 2872
160 Ga0316593_10083190 3300032168 Bacteria 1119
161 Ga0316593_10099608 3300032168 Unclassified 1030
162 Ga0316593_10101649 3300032168 Bacteria 1020
163 Ga0316593_10103133 3300032168 Unclassified 1013
164 Ga0316593_10167916 3300032168 Bacteria 803
165 Ga0316593_10232948 3300032168 Bacteria 686
166 Ga0316593_10436476 3300032168 Unclassified 510
167 Ga0316592_1000219 3300033524 Bacteria 7010
168 Ga0316592_1026854 3300033524 Bacteria 1244
169 Ga0316592_1052344 3300033524 Bacteria 913
170 Ga0316592_1058543 3300033524 Bacteria 864
171 Ga0316592_1071915 3300033524 Unclassified 782
172 Ga0316586_1073683 3300033527 Bacteria 631
173 Ga0316588_1012105 3300033528 Bacteria 1853
174 Ga0316588_1158287 3300033528 Bacteria 583
175 Ga0316588_1179413 3300033528 Bacteria 549
176 Ga0316587_1079588 3300033529 Bacteria 619
177 Ga0316596_1000197 3300033541 Bacteria 8812
178 Ga0316596_1000387 3300033541 Bacteria 7281
179 Ga0316596_1001212 3300033541 Bacteria 5086
180 Ga0316596_1021083 3300033541 Bacteria 1659
181 Ga0316596_1026586 3300033541 Bacteria 1492
182 Ga0316596_1029715 3300033541 Bacteria 1415
183 Ga0316596_1038095 3300033541 Bacteria 1259
184 Ga0316596_1058163 3300033541 Bacteria 1029
185 Ga0316596_1156695 3300033541 Unclassified 626
186 Ga0373929_0011985 3300035085 Bacteria 1642
187 Ga0373955_0086548 3300035172 Bacteria 1780
188 Ga0316574_0001655 3300035398 Bacteria 10724
189 Ga0316574_0170065 3300035398 Bacteria 1403
190 Ga0316574_0286639 3300035398 Bacteria 1048
191 Ga0316574_0454840 3300035398 Bacteria 802
192 Ga0316574_0639966 3300035398 Unclassified 655
193 Ga0373935_0320438 3300035692 Bacteria 1100
194 Ga0373933_0467009 3300035724 Bacteria 826
195 Ga0373937_0071721 3300036401 Bacteria 3194
196 Ga0373937_0791016 3300036401 Unclassified 896
197 Ga0316582_0052449 3300036647 Bacteria 2592
198 Ga0316582_0146218 3300036647 Bacteria 1596
199 Ga0316582_0401191 3300036647 Bacteria 945
200 Ga0316582_1162713 3300036647 Unclassified 525
201 Ga0316584_0017303 3300036712 Bacteria 5179
202 Ga0316584_0663785 3300036712 Bacteria 718
203 Ga0316584_0921859 3300036712 Unclassified 587
204 Ga0373925_0249095 3300037068 Bacteria 1424
205 Ga0316581_0003616 3300037588 Bacteria 3868
206 Ga0400490_17491 3300038726 Bacteria 28094
207 Ga0400491_12215 3300038727 Bacteria 7556
208 Ga0400491_21453 3300038727 Bacteria 7600
209 Ga0400483_008760 3300039062 Bacteria 1121
210 Ga0400483_046274 3300039062 Bacteria 1446
211 Ga0400483_080090 3300039062 Unclassified 1497
212 Ga0400483_170277 3300039062 Bacteria 2626
213 Ga0400483_183627 3300039062 Bacteria 2032
214 Ga0400483_243868 3300039062 Bacteria 1840
215 Ga0400483_265905 3300039062 Bacteria 3120
216 Ga0436365_0780362 3300039437 Bacteria 751
217 Ga0451793_0102125 3300041452 Bacteria 652
218 Ga0451797_1420620 3300041453 Bacteria 1032
219 Ga0451802_1392621 3300041460 Unclassified 568
220 Ga0451807_2632992 3300041486 Bacteria 612
221 Ga0451577_0047607 3300042876 Bacteria 3833
222 Ga0451577_0456984 3300042876 Bacteria 1160
223 Ga0453684_0017055 3300044712 Bacteria 11276
224 Ga0453684_0140360 3300044712 Bacteria 2886
225 Ga0453684_0341873 3300044712 Bacteria 1689
226 Ga0451576_0040998 3300045051 Bacteria 4895
227 Ga0451576_0181681 3300045051 Bacteria 2196
228 Ga0451576_1021170 3300045051 Bacteria 866
229 Ga0451576_1547711 3300045051 Bacteria 688
230 Ga0495629_0142030 3300046459 Bacteria 1670
231 Ga0495580_0203015 3300046472 Bacteria 1365
232 Ga0495584_0095652 3300046491 Bacteria 1500
233 Ga0495585_0354849 3300046492 Bacteria 712
234 Ga0495594_0278889 3300046499 Bacteria 952
235 Ga0495620_0027078 3300046515 Bacteria 2688
236 Ga0495644_0114518 3300046523 Bacteria 1024
237 Ga0495663_0074709 3300046525 Bacteria 1084
238 Ga0495663_0315903 3300046525 Unclassified 564
239 Ga0495665_0069879 3300046531 Bacteria 1851
240 Ga0495586_0288987 3300046535 Bacteria 939
241 Ga0495598_0194531 3300046537 Bacteria 730
242 Ga0495609_0260042 3300046538 Unclassified 713
243 Ga0495621_0009165 3300046539 Bacteria 2996
244 Ga0495621_0021744 3300046539 Bacteria 2118
245 Ga0495656_0108797 3300046615 Bacteria 1293
246 Ga0495634_0057670 3300046642 Bacteria 2591
247 Ga0495659_0022653 3300046664 Bacteria 2128
248 Ga0495659_0053037 3300046664 Bacteria 1481
249 Ga0495661_0030567 3300046665 Bacteria 3428
250 Ga0495657_0491773 3300046675 Unclassified 716
251 Ga0495623_0017278 3300046679 Bacteria 4661
252 Ga0495669_0023866 3300046684 Bacteria 2664
253 Ga0495669_0660180 3300046684 Archaea 508
254 Ga0495581_0080478 3300047315 Bacteria 1886
255 Ga0495680_0268601 3300047322 Unclassified 1205
256 Ga0495677_0124404 3300047445 Bacteria 985
257 Ga0495684_0853524 3300047471 Unclassified 590
258 Ga0496104_0201783 3300048907 Bacteria 1901
259 Ga0496108_0402820 3300048911 Bacteria 1195
260 Ga0496109_0087437 3300048912 Bacteria 2879
261 Ga0496110_0003743 3300048913 Bacteria 11715
262 Ga0496111_0005358 3300048914 Bacteria 8202
263 Ga0496126_0108704 3300048929 Bacteria 2418
264 Ga0501306_000138 3300049127 Bacteria 4465
265 Ga0501306_036073 3300049127 Bacteria 752
266 Ga0501308_000127 3300049128 Bacteria 3778
267 Ga0501308_002500 3300049128 Bacteria 1617
268 Ga0501308_025907 3300049128 Unclassified 762
269 Ga0501308_035745 3300049128 Bacteria 683
270 Ga0501308_072287 3300049128 Unclassified 537
271 Ga0501309_000417 3300049129 Bacteria 3337
272 Ga0501310_001482 3300049130 Bacteria 2142
273 Ga0501341_00123 3300049131 Bacteria 2456
274 Ga0501341_04192 3300049131 Bacteria 837
275 Ga0501343_000491 3300049132 Bacteria 2319
276 Ga0501343_001845 3300049132 Bacteria 1470
277 Ga0501343_007845 3300049132 Bacteria 847
278 Ga0501344_00118 3300049133 Bacteria 2655
279 Ga0501304_000222 3300049160 Bacteria 2511
280 Ga0501304_004181 3300049160 Bacteria 1089
281 Ga0501305_000007 3300049161 Bacteria 11997
282 Ga0501305_000842 3300049161 Bacteria 2738
283 Ga0501305_027898 3300049161 Bacteria 867
284 Ga0501305_078239 3300049161 Bacteria 591
285 Ga0501307_000770 3300049162 Bacteria 2406
286 Ga0501307_023018 3300049162 Bacteria 823
287 Ga0501307_063705 3300049162 Bacteria 577
288 Ga0501342_00043 3300049163 Bacteria 2484
289 Ga0501342_00417 3300049163 Bacteria 1126
290 Ga0501311_000226 3300049527 Bacteria 3395
291 Ga0501311_003970 3300049527 Bacteria 1548
292 Ga0501312_000002 3300049528 Bacteria 17365
293 Ga0501312_000469 3300049528 Bacteria 3260
294 Ga0501312_001531 3300049528 Bacteria 2296
295 Ga0501312_015450 3300049528 Bacteria 1083
296 Ga0501312_018713 3300049528 Bacteria 1011
297 Ga0501313_000081 3300049529 Bacteria 4439
298 Ga0501313_008800 3300049529 Bacteria 1130
299 Ga0501314_000370 3300049530 Bacteria 2722
300 Ga0501314_009144 3300049530 Bacteria 906
301 Ga0501314_009713 3300049530 Bacteria 887
302 Ga0501315_000072 3300049531 Bacteria 4669
303 Ga0501315_004100 3300049531 Bacteria 1502
304 Ga0501315_011029 3300049531 Bacteria 1096
305 Ga0501315_014662 3300049531 Bacteria 995
306 Ga0501316_000137 3300049532 Bacteria 3921
307 Ga0501316_004665 3300049532 Bacteria 1386
308 Ga0501316_010912 3300049532 Bacteria 1040
309 Ga0501317_000954 3300049533 Bacteria 2319
310 Ga0501317_001108 3300049533 Bacteria 2224
311 Ga0501317_004651 3300049533 Bacteria 1438
312 Ga0501317_014452 3300049533 Bacteria 1000
313 Ga0501318_000003 3300049534 Bacteria 10033
314 Ga0501318_006653 3300049534 Bacteria 1186
315 Ga0501318_010421 3300049534 Bacteria 1031
316 Ga0501319_000108 3300049535 Bacteria 2948
317 Ga0501319_001821 3300049535 Bacteria 1288
318 Ga0501319_030448 3300049535 Bacteria 517
319 Ga0501320_000070 3300049536 Bacteria 4546
320 Ga0501320_003450 3300049536 Bacteria 1341
321 Ga0501321_000002 3300049537 Bacteria 13305
322 Ga0501321_007924 3300049537 Bacteria 1115
323 Ga0501321_013971 3300049537 Bacteria 929
324 Ga0501321_024870 3300049537 Bacteria 769
325 Ga0501321_080581 3300049537 Bacteria 519
326 Ga0501322_000133 3300049538 Bacteria 2849
327 Ga0501322_001330 3300049538 Bacteria 1370
328 Ga0501322_003217 3300049538 Bacteria 1049
329 Ga0501322_009388 3300049538 Bacteria 740
330 Ga0501323_000294 3300049539 Bacteria 3460
331 Ga0501323_003540 3300049539 Bacteria 1601
332 Ga0501323_024124 3300049539 Bacteria 821
333 Ga0501323_083979 3300049539 Unclassified 524
334 Ga0501324_000076 3300049540 Bacteria 3543
335 Ga0501325_000547 3300049541 Bacteria 1861
336 Ga0501325_001547 3300049541 Bacteria 1436
337 Ga0501326_00045 3300049542 Bacteria 3869
338 Ga0501327_00035 3300049543 Bacteria 4032
339 Ga0501327_10976 3300049543 Bacteria 603
340 Ga0501328_00014 3300049544 Bacteria 4034
341 Ga0501329_00406 3300049545 Bacteria 1483
342 Ga0501329_00687 3300049545 Bacteria 1286
343 Ga0501330_000038 3300049546 Bacteria 3323
344 Ga0501330_003069 3300049546 Bacteria 977
345 Ga0501331_00101 3300049547 Bacteria 2690
346 Ga0501331_04352 3300049547 Bacteria 787
347 Ga0501331_06106 3300049547 Unclassified 698
348 Ga0501332_00052 3300049548 Bacteria 3335
349 Ga0501332_00979 3300049548 Bacteria 1407
350 Ga0501332_01047 3300049548 Bacteria 1380
351 Ga0501332_01137 3300049548 Bacteria 1345
352 Ga0501332_04841 3300049548 Bacteria 813
353 Ga0501333_000338 3300049549 Bacteria 2046
354 Ga0501334_00014 3300049550 Bacteria 5746
355 Ga0501334_04793 3300049550 Bacteria 878
356 Ga0501335_000116 3300049551 Bacteria 3814
357 Ga0501335_001737 3300049551 Bacteria 1704
358 Ga0501335_001832 3300049551 Bacteria 1674
359 Ga0501335_003017 3300049551 Bacteria 1405
360 Ga0501335_003344 3300049551 Bacteria 1355
361 Ga0501335_035639 3300049551 Bacteria 575
362 Ga0501336_000262 3300049552 Bacteria 2399
363 Ga0501337_000050 3300049553 Bacteria 4082
364 Ga0501338_00076 3300049554 Bacteria 2972
365 Ga0501338_01754 3300049554 Bacteria 1195
366 Ga0501338_03263 3300049554 Bacteria 954
367 Ga0501338_10035 3300049554 Unclassified 635
368 Ga0501340_000148 3300049556 Bacteria 2444
369 Ga0501340_010828 3300049556 Bacteria 673
370 Ga0501034_0225083 3300049571 Bacteria 1827
371 Ga0501042_0093789 3300049578 Bacteria 2156
372 Ga0501067_0086398 3300049583 Bacteria 1740
373 Ga0501072_0794544 3300049588 Bacteria 741
374 Ga0501073_0007918 3300049589 Bacteria 7882
375 Ga0501073_0615295 3300049589 Bacteria 750
376 Ga0501074_0002140 3300049590 Bacteria 13659
377 Ga0501076_0009809 3300049592 Bacteria 7075
378 Ga0501077_0238041 3300049593 Bacteria 1157
379 Ga0501217_036117 3300049661 Bacteria 1239
380 Ga0501245_059273 3300049708 Bacteria 696
381 Ga0501080_0001538 3300049742 Bacteria 19472
382 Ga0501080_0012444 3300049742 Bacteria 7800
383 Ga0501080_0105199 3300049742 Bacteria 2617
384 Ga0501083_0015971 3300049744 Bacteria 5257
385 Ga0501083_0050951 3300049744 Bacteria 2785
386 Ga0501083_0071732 3300049744 Bacteria 2302
387 Ga0501083_0383966 3300049744 Bacteria 914
388 nmdc:mga00v17_401107_c1 3300050491 Bacteria 891
389 nmdc:mga05p37_132953_c1 3300050507 Bacteria 3052
390 nmdc:mga05p37_2212611_c1 3300050507 Unclassified 510
391 nmdc:mga05p37_54359_c1 3300050507 Bacteria 4926
392 nmdc:mga0qj67_17403_c1 3300050509 Bacteria 5464
393 nmdc:mga06r32_1765476_c1 3300050510 Bacteria 555
394 nmdc:mga08y16_1702769_c1 3300050511 Bacteria 586
395 nmdc:mga08y16_900279_c1 3300050511 Bacteria 871
396 nmdc:mga0n895_1143590_c1 3300050512 Bacteria 754
397 nmdc:mga0n895_38770_c1 3300050512 Bacteria 4618
398 nmdc:mga0n895_613947_c1 3300050512 Bacteria 1089
399 nmdc:mga0n895_73564_c1 3300050512 Bacteria 3393
400 nmdc:mga0a205_1175711_c1 3300050515 Unclassified 615
401 Ga0501084_0031571 3300054114 Bacteria 4428
402 Ga0501084_0053537 3300054114 Bacteria 3375
403 Ga0501084_0208162 3300054114 Bacteria 1650
404 Ga0587072_063902 3300059643 Unclassified 764
405 Ga0587081_11277 3300060246 Unclassified 646
406 Ga0501082_0866097 3300060353 Bacteria 790
407 2672333587 2671180330 Bacteria 5521719
408 2738839002 2738541299 Bacteria 4020721
409 2791215878 2788500588 Bacteria 4584915
410 2805348328 2802429420 Bacteria 845479
411 2816866380 2816332186 Bacteria 5331395
412 2819627548 2818991451 Bacteria 4697364
413 2842688274 2842682962 Bacteria 5589973
414 2849144968 2849139964 Bacteria 5613304
415 2857586484 2857581216 Bacteria 5522813
416 2904610130 2904606771 Bacteria 4684500
417 2916972076 2916971899 Bacteria 4250608
418 2939596143 2939593269 Bacteria 4798695
419 3006978358 3006973921 Bacteria 4423788
420 8022950773 8022948649 Bacteria 5366783
421 8055537097 8055531788 Bacteria 5249694
422 Ga0316578_10165145
423 SwRhRL2b_contig_1398824
424 JGI25151J46595_10012054
425 JGI25151J46595_10139085
426 rootL2_10195668
427 Ga0055538_1000160
428 Ga0055536_1003459
429 Ga0058859_11224629
430 Ga0065704_10093923
431 Ga0065712_10217425
432 Ga0065712_10554893
433 Ga0065707_10085242
434 Ga0065707_10882035
435 Ga0070670_100878784
436 Ga0070670_101028438
437 Ga0070670_102261481
438 Ga0070666_11244189
439 Ga0070682_100364867
440 Ga0070682_100909471
441 Ga0068868_101578894
442 Ga0070689_101864830
443 Ga0070687_100122245
444 Ga0070675_100151467
445 Ga0070675_101858317
446 Ga0070674_100350987
447 Ga0070673_100879832
448 Ga0070673_101197468
449 Ga0070673_102190466
450 Ga0070713_100302121
451 Ga0070701_10905872
452 Ga0070663_100587541
453 Ga0070681_10029747
454 Ga0070707_100075438
455 Ga0070698_101038849
456 Ga0070684_100052381
457 Ga0070684_101089324
458 Ga0070672_100029772
459 Ga0070672_100508785
460 Ga0070672_102178433
461 Ga0070686_100811101
462 Ga0070664_100069855
463 Ga0070664_100360988
464 Ga0070664_100923615
465 Ga0068857_101549677
466 Ga0068856_100592761
467 Ga0070702_100519618
468 Ga0068870_10157532
469 Ga0068870_10863119
470 Ga0068860_100260911
471 Ga0068862_101005890
472 Ga0075364_10776945
473 Ga0075432_10318205
474 Ga0075428_100027440
475 Ga0075428_100127065
476 Ga0075428_100201539
477 Ga0075430_100035323
478 Ga0075430_100490467
479 Ga0075431_101107434
480 Ga0075433_11040966
481 Ga0075434_100047847
482 Ga0075434_100049262
483 Ga0075434_100645637
484 Ga0075429_100320687
485 Ga0105240_11022228
486 Ga0111539_10133012
487 Ga0111539_12222351
488 Ga0105245_10535757
489 Ga0105245_13010862
490 Ga0105247_10518571
491 Ga0114129_10052031
492 Ga0114129_10175239
493 Ga0114129_13091135
494 Ga0105243_10703476
495 Ga0105241_10940236
496 Ga0105242_10255950
497 Ga0105242_11705909
498 Ga0105237_10034038
499 Ga0105237_10961365
500 Ga0105237_12332027
501 Ga0105249_11142867
502 Ga0105239_10792906
503 Ga0157325_1012115
504 Ga0157371_10009714
505 Ga0157371_10639457
506 Ga0157371_11319476
507 Ga0157374_10054504
508 Ga0157378_10115797
509 Ga0157378_10827984
510 Ga0163162_10907490
511 Ga0163162_11521428
512 Ga0157375_11573993
513 Ga0157375_13270156
514 Ga0163163_10936253
515 Ga0163163_13276728
516 Ga0163161_10573290
517 Ga0209784_100044
518 Ga0209676_1095260
519 Ga0209025_1009107
520 Ga0209025_1045113
521 Ga0207697_10190004
522 Ga0207688_10359745
523 Ga0207643_10553553
524 Ga0207707_10084493
525 Ga0207671_10084674
526 Ga0207646_10037563
527 Ga0207650_10824277
528 Ga0207650_11231048
529 Ga0207659_11057766
530 Ga0207659_11232419
531 Ga0207700_10049159
532 Ga0207709_10349009
533 Ga0207691_10060357
534 Ga0207691_10445747
535 Ga0207691_11178602
536 Ga0207689_10205153
537 Ga0207661_10926342
538 Ga0207661_11302815
539 Ga0207679_10058841
540 Ga0207651_10992165
541 Ga0207712_10330520
542 Ga0207668_10271457
543 Ga0207658_10349796
544 Ga0207703_11868876
545 Ga0207678_11941308
546 Ga0207641_11781330
547 Ga0207641_12378929
548 Ga0207698_11206292
549 Ga0207698_12611178
550 Ga0209998_10134917
551 Ga0207428_11226166
552 Ga0268266_12059735
553 Ga0268265_10780558
554 Ga0268265_11350082
555 Ga0268264_12449793
556 Ga0316575_10088179
557 Ga0316579_10024838
558 Ga0316579_10299324
559 Ga0316576_10069836
560 Ga0316576_10246260
561 Ga0316576_10470057
562 Ga0316576_10475401
563 Ga0316576_11285947
564 Ga0316578_10016793
565 Ga0316578_10022554
566 Ga0316578_10042194
567 Ga0316577_10000311
568 Ga0316577_10258888
569 Ga0316577_10267646
570 Ga0307413_10821092
571 Ga0307407_10512815
572 Ga0307412_11316619
573 Ga0307409_100345386
574 Ga0307409_100413436
575 Ga0307416_101997850
576 Ga0316585_10013627
577 Ga0316580_10120193
578 Ga0316593_10000072
579 Ga0316593_10000758
580 Ga0316593_10008449
581 Ga0316593_10083190
582 Ga0316593_10099608
583 Ga0316593_10101649
584 Ga0316593_10103133
585 Ga0316593_10167916
586 Ga0316593_10232948
587 Ga0316593_10436476
588 Ga0316592_1000219
589 Ga0316592_1026854
590 Ga0316592_1052344
591 Ga0316592_1058543
592 Ga0316592_1071915
593 Ga0316586_1073683
594 Ga0316588_1012105
595 Ga0316588_1158287
596 Ga0316588_1179413
597 Ga0316587_1079588
598 Ga0316596_1000197
599 Ga0316596_1000387
600 Ga0316596_1001212
601 Ga0316596_1021083
602 Ga0316596_1026586
603 Ga0316596_1029715
604 Ga0316596_1038095
605 Ga0316596_1058163
606 Ga0316596_1156695
607 Ga0373929_0011985
608 Ga0373955_0086548
609 Ga0316574_0001655
610 Ga0316574_0170065
611 Ga0316574_0286639
612 Ga0316574_0454840
613 Ga0316574_0639966
614 Ga0373935_0320438
615 Ga0373933_0467009
616 Ga0373937_0071721
617 Ga0373937_0791016
618 Ga0316582_0052449
619 Ga0316582_0146218
620 Ga0316582_0401191
621 Ga0316582_1162713
622 Ga0316584_0017303
623 Ga0316584_0663785
624 Ga0316584_0921859
625 Ga0373925_0249095
626 Ga0316581_0003616
627 Ga0400490_17491
628 Ga0400491_12215
629 Ga0400491_21453
630 Ga0400483_008760
631 Ga0400483_046274
632 Ga0400483_080090
633 Ga0400483_170277
634 Ga0400483_183627
635 Ga0400483_243868
636 Ga0400483_265905
637 Ga0436365_0780362
638 Ga0451793_0102125
639 Ga0451797_1420620
640 Ga0451802_1392621
641 Ga0451807_2632992
642 Ga0451577_0047607
643 Ga0451577_0456984
644 Ga0453684_0017055
645 Ga0453684_0140360
646 Ga0453684_0341873
647 Ga0451576_0040998
648 Ga0451576_0181681
649 Ga0451576_1021170
650 Ga0451576_1547711
651 Ga0495629_0142030
652 Ga0495580_0203015
653 Ga0495584_0095652
654 Ga0495585_0354849
655 Ga0495594_0278889
656 Ga0495620_0027078
657 Ga0495644_0114518
658 Ga0495663_0074709
659 Ga0495663_0315903
660 Ga0495665_0069879
661 Ga0495586_0288987
662 Ga0495598_0194531
663 Ga0495609_0260042
664 Ga0495621_0009165
665 Ga0495621_0021744
666 Ga0495656_0108797
667 Ga0495634_0057670
668 Ga0495659_0022653
669 Ga0495659_0053037
670 Ga0495661_0030567
671 Ga0495657_0491773
672 Ga0495623_0017278
673 Ga0495669_0023866
674 Ga0495669_0660180
675 Ga0495581_0080478
676 Ga0495680_0268601
677 Ga0495677_0124404
678 Ga0495684_0853524
679 Ga0496104_0201783
680 Ga0496108_0402820
681 Ga0496109_0087437
682 Ga0496110_0003743
683 Ga0496111_0005358
684 Ga0496126_0108704
685 Ga0501306_000138
686 Ga0501306_036073
687 Ga0501308_000127
688 Ga0501308_002500
689 Ga0501308_025907
690 Ga0501308_035745
691 Ga0501308_072287
692 Ga0501309_000417
693 Ga0501310_001482
694 Ga0501341_00123
695 Ga0501341_04192
696 Ga0501343_000491
697 Ga0501343_001845
698 Ga0501343_007845
699 Ga0501344_00118
700 Ga0501304_000222
701 Ga0501304_004181
702 Ga0501305_000007
703 Ga0501305_000842
704 Ga0501305_027898
705 Ga0501305_078239
706 Ga0501307_000770
707 Ga0501307_023018
708 Ga0501307_063705
709 Ga0501342_00043
710 Ga0501342_00417
711 Ga0501311_000226
712 Ga0501311_003970
713 Ga0501312_000002
714 Ga0501312_000469
715 Ga0501312_001531
716 Ga0501312_015450
717 Ga0501312_018713
718 Ga0501313_000081
719 Ga0501313_008800
720 Ga0501314_000370
721 Ga0501314_009144
722 Ga0501314_009713
723 Ga0501315_000072
724 Ga0501315_004100
725 Ga0501315_011029
726 Ga0501315_014662
727 Ga0501316_000137
728 Ga0501316_004665
729 Ga0501316_010912
730 Ga0501317_000954
731 Ga0501317_001108
732 Ga0501317_004651
733 Ga0501317_014452
734 Ga0501318_000003
735 Ga0501318_006653
736 Ga0501318_010421
737 Ga0501319_000108
738 Ga0501319_001821
739 Ga0501319_030448
740 Ga0501320_000070
741 Ga0501320_003450
742 Ga0501321_000002
743 Ga0501321_007924
744 Ga0501321_013971
745 Ga0501321_024870
746 Ga0501321_080581
747 Ga0501322_000133
748 Ga0501322_001330
749 Ga0501322_003217
750 Ga0501322_009388
751 Ga0501323_000294
752 Ga0501323_003540
753 Ga0501323_024124
754 Ga0501323_083979
755 Ga0501324_000076
756 Ga0501325_000547
757 Ga0501325_001547
758 Ga0501326_00045
759 Ga0501327_00035
760 Ga0501327_10976
761 Ga0501328_00014
762 Ga0501329_00406
763 Ga0501329_00687
764 Ga0501330_000038
765 Ga0501330_003069
766 Ga0501331_00101
767 Ga0501331_04352
768 Ga0501331_06106
769 Ga0501332_00052
770 Ga0501332_00979
771 Ga0501332_01047
772 Ga0501332_01137
773 Ga0501332_04841
774 Ga0501333_000338
775 Ga0501334_00014
776 Ga0501334_04793
777 Ga0501335_000116
778 Ga0501335_001737
779 Ga0501335_001832
780 Ga0501335_003017
781 Ga0501335_003344
782 Ga0501335_035639
783 Ga0501336_000262
784 Ga0501337_000050
785 Ga0501338_00076
786 Ga0501338_01754
787 Ga0501338_03263
788 Ga0501338_10035
789 Ga0501340_000148
790 Ga0501340_010828
791 Ga0501034_0225083
792 Ga0501042_0093789
793 Ga0501067_0086398
794 Ga0501072_0794544
795 Ga0501073_0007918
796 Ga0501073_0615295
797 Ga0501074_0002140
798 Ga0501076_0009809
799 Ga0501077_0238041
800 Ga0501217_036117
801 Ga0501245_059273
802 Ga0501080_0001538
803 Ga0501080_0012444
804 Ga0501080_0105199
805 Ga0501083_0015971
806 Ga0501083_0050951
807 Ga0501083_0071732
808 Ga0501083_0383966
809 nmdc:mga00v17_401107_c1
810 nmdc:mga05p37_132953_c1
811 nmdc:mga05p37_2212611_c1
812 nmdc:mga05p37_54359_c1
813 nmdc:mga0qj67_17403_c1
814 nmdc:mga06r32_1765476_c1
815 nmdc:mga08y16_1702769_c1
816 nmdc:mga08y16_900279_c1
817 nmdc:mga0n895_1143590_c1
818 nmdc:mga0n895_38770_c1
819 nmdc:mga0n895_613947_c1
820 nmdc:mga0n895_73564_c1
821 nmdc:mga0a205_1175711_c1
822 Ga0501084_0031571
823 Ga0501084_0053537
824 Ga0501084_0208162
825 Ga0587072_063902
826 Ga0587081_11277
827 Ga0501082_0866097
828 2672333587
829 2738839002
830 2791215878
831 2805348328
832 2816866380
833 2819627548
834 2842688274
835 2849144968
836 2857586484
837 2904610130
838 2916972076
839 2939596143
840 3006978358
841 8022950773
842 8055537097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

16

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9641 3 84
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9499 2 91
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9479 2 90
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.9424 2 89
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.941 2 88
ID Description Score Start End Superfamily
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9169 5 96 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9025 2 89 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9009 2 90 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9 2 89 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8823 5 90 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A7X3QGC2-F1-model_v4 Large ribosomal subunit protein uL23m (50S ribosomal protein L23) 0.9723 1 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2A4MN04-F1-model_v4 Large ribosomal subunit protein uL23 0.9688 2 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3C0KRD0-F1-model_v4 50S ribosomal protein L23 0.9676 1 84 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2N1ZMU3-F1-model_v4 deleted 0.9674 3 85
AF-A0A6L7NLD4-F1-model_v4 Large ribosomal subunit protein uL23 0.9673 1 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map