F440001

General Info

Members Datasets Scaffolds Average Seq Length
421 229 842 82

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10207877|Ga0182008_102078772
Length 98
Sequence VDVRLLAMTNSLEPSSSFASDPTPRTSWRWRFEDGSGAELTVAGGSTASGATGFPSQSDAESWIGEVWRDLLEEGVEQVTLFEGDREVYGPMSLHSAG

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
228 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
229 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.19
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 7.6
Rhizosphere 87.17
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10207877 3300014497 Bacteria 998
2 LJQas_1011447 3300000549 Bacteria 1054
3 JGI24744J21845_10009302 3300002077 Bacteria 2017
4 rootH1_10083814 3300003323 Bacteria 1241
5 Ga0070658_10263900 3300005327 Bacteria 1463
6 Ga0070658_10793851 3300005327 Bacteria 822
7 Ga0070658_11342732 3300005327 Bacteria 621
8 Ga0070658_11537253 3300005327 Bacteria 577
9 Ga0070683_100060296 3300005329 Bacteria 3526
10 Ga0070683_100210456 3300005329 Bacteria 1847
11 Ga0070683_100416942 3300005329 Bacteria 1281
12 Ga0070683_100925057 3300005329 Bacteria 837
13 Ga0070683_101513953 3300005329 Bacteria 645
14 Ga0070690_100506421 3300005330 Bacteria 904
15 Ga0070670_100140786 3300005331 Bacteria 2086
16 Ga0070670_100188563 3300005331 Bacteria 1791
17 Ga0070677_10254536 3300005333 Bacteria 873
18 Ga0070666_10954948 3300005335 Bacteria 635
19 Ga0070682_100012318 3300005337 Bacteria 4901
20 Ga0070682_100059430 3300005337 Bacteria 2415
21 Ga0070682_100399803 3300005337 Bacteria 1039
22 Ga0070682_100925508 3300005337 Bacteria 718
23 Ga0068868_100784138 3300005338 Bacteria 859
24 Ga0068868_101565140 3300005338 Bacteria 618
25 Ga0068868_102210813 3300005338 Bacteria 524
26 Ga0070660_100161139 3300005339 Bacteria 1808
27 Ga0070660_100211962 3300005339 Bacteria 1573
28 Ga0070660_100359297 3300005339 Bacteria 1200
29 Ga0070660_100495476 3300005339 Bacteria 1016
30 Ga0070687_100009535 3300005343 Bacteria 4165
31 Ga0070661_100193408 3300005344 Bacteria 1552
32 Ga0070661_100232616 3300005344 Bacteria 1417
33 Ga0070661_100947941 3300005344 Unclassified 712
34 Ga0070692_10005827 3300005345 Bacteria 5298
35 Ga0070668_101636612 3300005347 Bacteria 590
36 Ga0070669_100339820 3300005353 Bacteria 1216
37 Ga0070675_100783382 3300005354 Bacteria 871
38 Ga0070671_101828721 3300005355 Bacteria 540
39 Ga0070674_100114302 3300005356 Bacteria 1988
40 Ga0070674_100356506 3300005356 Bacteria 1183
41 Ga0070673_100054376 3300005364 Bacteria 3149
42 Ga0070688_100199215 3300005365 Bacteria 1400
43 Ga0070659_100290908 3300005366 Bacteria 1360
44 Ga0070659_100557106 3300005366 Bacteria 982
45 Ga0070659_101692494 3300005366 Bacteria 566
46 Ga0070714_100007416 3300005435 Bacteria 8534
47 Ga0070701_10010070 3300005438 Bacteria 4167
48 Ga0070705_101410968 3300005440 Bacteria 581
49 Ga0070700_100008782 3300005441 Bacteria 5518
50 Ga0070700_100274055 3300005441 Bacteria 1220
51 Ga0070700_100429724 3300005441 Bacteria 1000
52 Ga0070700_101121925 3300005441 Bacteria 653
53 Ga0070663_100811260 3300005455 Bacteria 803
54 Ga0070678_101653200 3300005456 Bacteria 602
55 Ga0070662_100770043 3300005457 Bacteria 817
56 Ga0068867_100219749 3300005459 Bacteria 1531
57 Ga0070685_10091620 3300005466 Bacteria 1841
58 Ga0070679_100435127 3300005530 Bacteria 1257
59 Ga0070679_101292975 3300005530 Bacteria 675
60 Ga0070684_100485323 3300005535 Bacteria 1144
61 Ga0070684_100541824 3300005535 Bacteria 1079
62 Ga0070684_100670287 3300005535 Bacteria 966
63 Ga0070684_101506230 3300005535 Bacteria 634
64 Ga0070684_101884903 3300005535 Unclassified 564
65 Ga0068853_100123685 3300005539 Bacteria 2310
66 Ga0070672_100010185 3300005543 Bacteria 6511
67 Ga0070672_100568178 3300005543 Bacteria 986
68 Ga0070686_100023482 3300005544 Bacteria 3685
69 Ga0070686_100675685 3300005544 Unclassified 821
70 Ga0070693_100250064 3300005547 Bacteria 1175
71 Ga0070693_101577290 3300005547 Bacteria 515
72 Ga0068855_100533596 3300005563 Bacteria 1272
73 Ga0070664_101166492 3300005564 Bacteria 726
74 Ga0068857_101059978 3300005577 Bacteria 782
75 Ga0068857_101236829 3300005577 Bacteria 724
76 Ga0068854_100015956 3300005578 Bacteria 4994
77 Ga0068854_101077680 3300005578 Bacteria 715
78 Ga0068856_100718009 3300005614 Bacteria 1020
79 Ga0070702_100239586 3300005615 Bacteria 1224
80 Ga0068852_100010468 3300005616 Bacteria 6934
81 Ga0068852_100430113 3300005616 Bacteria 1303
82 Ga0068852_100621478 3300005616 Bacteria 1086
83 Ga0068852_100821534 3300005616 Bacteria 944
84 Ga0068852_102045326 3300005616 Bacteria 595
85 Ga0068859_100655033 3300005617 Bacteria 1142
86 Ga0068864_100078862 3300005618 Bacteria 2883
87 Ga0068864_101908349 3300005618 Bacteria 600
88 Ga0068864_102025812 3300005618 Bacteria 582
89 Ga0068866_10040320 3300005718 Bacteria 2311
90 Ga0068870_10010367 3300005840 Bacteria 4280
91 Ga0068863_100474105 3300005841 Bacteria 1230
92 Ga0075365_10110530 3300006038 Bacteria 1888
93 Ga0075364_10018462 3300006051 Bacteria 4366
94 Ga0075432_10472365 3300006058 Bacteria 554
95 Ga0070712_100382976 3300006175 Bacteria 1158
96 Ga0075362_10070483 3300006177 Bacteria 1595
97 Ga0097621_102100313 3300006237 Bacteria 540
98 Ga0068871_101948359 3300006358 Bacteria 559
99 Ga0075428_100082218 3300006844 Bacteria 3515
100 Ga0075433_11941716 3300006852 Bacteria 505
101 Ga0075434_102038494 3300006871 Bacteria 579
102 Ga0068865_102149161 3300006881 Bacteria 508
103 Ga0097620_100655051 3300006931 Bacteria 1142
104 Ga0075435_100257362 3300007076 Bacteria 1487
105 Ga0105240_10791950 3300009093 Bacteria 1027
106 Ga0111539_10721197 3300009094 Bacteria 1161
107 Ga0105245_10011453 3300009098 Bacteria 7724
108 Ga0105245_10674299 3300009098 Bacteria 1065
109 Ga0105245_10851581 3300009098 Bacteria 952
110 Ga0105247_10441038 3300009101 Bacteria 936
111 Ga0114129_10467546 3300009147 Bacteria 1652
112 Ga0105243_10007913 3300009148 Bacteria 8163
113 Ga0105243_10871406 3300009148 Bacteria 893
114 Ga0105243_11748507 3300009148 Bacteria 652
115 Ga0105242_10247606 3300009176 Bacteria 1604
116 Ga0105242_10952294 3300009176 Bacteria 863
117 Ga0105242_13255057 3300009176 Bacteria 505
118 Ga0105248_10031255 3300009177 Bacteria 5951
119 Ga0105248_11598010 3300009177 Unclassified 739
120 Ga0105237_12629602 3300009545 Bacteria 514
121 Ga0105238_10104872 3300009551 Bacteria 2808
122 Ga0105238_10303171 3300009551 Bacteria 1581
123 Ga0105238_11171552 3300009551 Bacteria 792
124 Ga0105238_12480095 3300009551 Bacteria 554
125 Ga0105249_10068158 3300009553 Bacteria 3280
126 Ga0105239_10162248 3300010375 Bacteria 2498
127 Ga0105239_10543036 3300010375 Bacteria 1323
128 Ga0105239_10735680 3300010375 Bacteria 1129
129 Ga0105239_11048609 3300010375 Bacteria 938
130 Ga0105239_12282671 3300010375 Bacteria 630
131 Ga0105246_10128533 3300011119 Bacteria 1889
132 Ga0105246_10295143 3300011119 Bacteria 1306
133 Ga0105246_10501389 3300011119 Bacteria 1031
134 Ga0105246_10968065 3300011119 Bacteria 768
135 Ga0105246_11161820 3300011119 Bacteria 708
136 Ga0105246_11618256 3300011119 Bacteria 613
137 Ga0157327_1040704 3300012512 Bacteria 624
138 Ga0157371_11116964 3300013102 Bacteria 605
139 Ga0157371_11234263 3300013102 Unclassified 577
140 Ga0157370_10395985 3300013104 Bacteria 1271
141 Ga0157370_10991665 3300013104 Bacteria 761
142 Ga0157369_10167551 3300013105 Bacteria 2316
143 Ga0157369_10804737 3300013105 Bacteria 966
144 Ga0157369_11184649 3300013105 Bacteria 780
145 Ga0157369_11313107 3300013105 Bacteria 737
146 Ga0157369_12141288 3300013105 Bacteria 567
147 Ga0163162_11554125 3300013306 Bacteria 754
148 Ga0157372_10032619 3300013307 Bacteria 5712
149 Ga0157372_10153111 3300013307 Bacteria 2662
150 Ga0157372_10453996 3300013307 Bacteria 1493
151 Ga0157372_10477998 3300013307 Bacteria 1452
152 Ga0157372_11399003 3300013307 Bacteria 806
153 Ga0157372_12954244 3300013307 Bacteria 544
154 Ga0157372_13303935 3300013307 Bacteria 514
155 Ga0157375_12210589 3300013308 Bacteria 655
156 Ga0163163_10079027 3300014325 Bacteria 3287
157 Ga0157380_10005482 3300014326 Bacteria 8865
158 Ga0157380_12030333 3300014326 Bacteria 637
159 Ga0157380_12385992 3300014326 Bacteria 594
160 Ga0182008_10152715 3300014497 Bacteria 1159
161 Ga0157377_10006282 3300014745 Bacteria 5653
162 Ga0157377_10050050 3300014745 Bacteria 2351
163 Ga0157376_10577967 3300014969 Bacteria 1115
164 Ga0157376_11605673 3300014969 Bacteria 685
165 Ga0163161_10117324 3300017792 Bacteria 1996
166 Ga0163161_11651398 3300017792 Bacteria 566
167 Ga0206356_10124381 3300020070 Bacteria 771
168 Ga0206350_10181077 3300020080 Bacteria 679
169 Ga0206354_10692761 3300020081 Bacteria 541
170 Ga0206353_11218945 3300020082 Bacteria 2169
171 Ga0206353_11281111 3300020082 Bacteria 523
172 Ga0207697_10052821 3300025315 Bacteria 1682
173 Ga0207642_10414922 3300025899 Bacteria 808
174 Ga0207642_10612358 3300025899 Bacteria 679
175 Ga0207688_10054635 3300025901 Bacteria 2241
176 Ga0207688_10127444 3300025901 Bacteria 1490
177 Ga0207688_10285138 3300025901 Bacteria 1007
178 Ga0207688_10666001 3300025901 Bacteria 657
179 Ga0207643_10014468 3300025908 Bacteria 4287
180 Ga0207705_10001806 3300025909 Bacteria 16878
181 Ga0207705_10283543 3300025909 Bacteria 1268
182 Ga0207705_11181344 3300025909 Bacteria 587
183 Ga0207707_10860001 3300025912 Bacteria 752
184 Ga0207662_10161675 3300025918 Bacteria 1431
185 Ga0207657_10047471 3300025919 Bacteria 3755
186 Ga0207657_10224085 3300025919 Bacteria 1505
187 Ga0207657_10818305 3300025919 Bacteria 720
188 Ga0207657_11514142 3300025919 Unclassified 501
189 Ga0207649_11486971 3300025920 Bacteria 536
190 Ga0207681_10049737 3300025923 Bacteria 2835
191 Ga0207694_10219632 3300025924 Bacteria 1550
192 Ga0207650_10263410 3300025925 Bacteria 1399
193 Ga0207659_10192257 3300025926 Bacteria 1625
194 Ga0207659_11471082 3300025926 Bacteria 583
195 Ga0207687_10058991 3300025927 Bacteria 2702
196 Ga0207687_10130399 3300025927 Bacteria 1894
197 Ga0207687_10314171 3300025927 Bacteria 1266
198 Ga0207687_10717919 3300025927 Bacteria 849
199 Ga0207664_10005672 3300025929 Bacteria 8530
200 Ga0207690_10010541 3300025932 Bacteria 5498
201 Ga0207690_10204707 3300025932 Bacteria 1501
202 Ga0207686_10025546 3300025934 Bacteria 3437
203 Ga0207686_10188410 3300025934 Bacteria 1469
204 Ga0207709_10035704 3300025935 Bacteria 2941
205 Ga0207709_10940753 3300025935 Bacteria 704
206 Ga0207670_10347129 3300025936 Bacteria 1174
207 Ga0207669_10132597 3300025937 Bacteria 1715
208 Ga0207704_11097023 3300025938 Bacteria 676
209 Ga0207691_10006431 3300025940 Bacteria 11347
210 Ga0207711_10044881 3300025941 Bacteria 3775
211 Ga0207711_10483149 3300025941 Bacteria 1154
212 Ga0207689_11589984 3300025942 Bacteria 544
213 Ga0207661_10013050 3300025944 Bacteria 6063
214 Ga0207661_10349141 3300025944 Bacteria 1334
215 Ga0207661_10404226 3300025944 Bacteria 1239
216 Ga0207661_10623843 3300025944 Bacteria 990
217 Ga0207661_11103512 3300025944 Unclassified 731
218 Ga0207661_11363635 3300025944 Bacteria 651
219 Ga0207679_11808676 3300025945 Bacteria 558
220 Ga0207651_10432898 3300025960 Bacteria 1125
221 Ga0207651_11616390 3300025960 Bacteria 584
222 Ga0207712_11136979 3300025961 Bacteria 696
223 Ga0207668_10899153 3300025972 Bacteria 788
224 Ga0207640_10017896 3300025981 Bacteria 4154
225 Ga0207677_10487095 3300026023 Bacteria 1064
226 Ga0207677_10574899 3300026023 Unclassified 985
227 Ga0207639_10332349 3300026041 Bacteria 1352
228 Ga0207678_10969298 3300026067 Bacteria 752
229 Ga0207678_11109333 3300026067 Bacteria 701
230 Ga0207708_10001687 3300026075 Bacteria 16343
231 Ga0207708_10190084 3300026075 Bacteria 1634
232 Ga0207708_10417679 3300026075 Bacteria 1112
233 Ga0207708_10530648 3300026075 Bacteria 990
234 Ga0207641_11459021 3300026088 Bacteria 686
235 Ga0207648_10009611 3300026089 Bacteria 9251
236 Ga0207676_10080777 3300026095 Bacteria 2640
237 Ga0207676_11816224 3300026095 Bacteria 608
238 Ga0207676_12577274 3300026095 Bacteria 505
239 Ga0207674_10300444 3300026116 Bacteria 1554
240 Ga0207674_11567276 3300026116 Unclassified 627
241 Ga0207674_12143194 3300026116 Bacteria 522
242 Ga0207683_10389655 3300026121 Bacteria 1281
243 Ga0207683_10608307 3300026121 Bacteria 1012
244 Ga0207698_10169203 3300026142 Bacteria 1922
245 Ga0207698_11237828 3300026142 Bacteria 761
246 Ga0207698_11274939 3300026142 Bacteria 749
247 Ga0207698_12048940 3300026142 Bacteria 586
248 Ga0207428_10131580 3300027907 Bacteria 1914
249 Ga0268265_10239941 3300028380 Bacteria 1599
250 Ga0268265_12652119 3300028380 Bacteria 507
251 Ga0307405_11829356 3300031731 Bacteria 540
252 Ga0307406_10294408 3300031901 Bacteria 1244
253 Ga0307407_10064914 3300031903 Bacteria 2147
254 Ga0307412_10137629 3300031911 Bacteria 1784
255 Ga0307409_100068198 3300031995 Bacteria 2812
256 Ga0307409_100292558 3300031995 Bacteria 1511
257 Ga0307409_100310763 3300031995 Bacteria 1471
258 Ga0307409_101115715 3300031995 Bacteria 810
259 Ga0307409_101438354 3300031995 Bacteria 716
260 Ga0307416_100296447 3300032002 Bacteria 1604
261 Ga0307416_100542394 3300032002 Bacteria 1235
262 Ga0307414_10113533 3300032004 Bacteria 2068
263 Ga0307411_11746485 3300032005 Bacteria 577
264 Ga0307415_100541922 3300032126 Bacteria 1025
265 Ga0373960_0226481 3300035121 Bacteria 671
266 Ga0373961_0083564 3300035241 Bacteria 1008
267 Ga0373931_1090434 3300035691 Bacteria 543
268 Ga0373927_0895123 3300035695 Bacteria 586
269 Ga0373947_0806739 3300035725 Bacteria 641
270 Ga0373925_1038244 3300037068 Bacteria 675
271 Ga0395899_0040496 3300037312 Bacteria 3484
272 Ga0395898_0161264 3300037466 Bacteria 2145
273 Ga0436364_1421217 3300037853 Bacteria 3552
274 Ga0395901_0012965 3300038443 Bacteria 8457
275 Ga0451807_1943677 3300041486 Bacteria 566
276 Ga0451839_0269243 3300041496 Bacteria 590
277 Ga0451841_0535108 3300041498 Bacteria 653
278 Ga0451845_0293928 3300041501 Bacteria 625
279 Ga0451847_0162866 3300041503 Bacteria 645
280 Ga0451847_0505682 3300041503 Bacteria 607
281 Ga0451851_0828895 3300041507 Bacteria 660
282 Ga0451843_1284192 3300041509 Bacteria 613
283 Ga0451855_0545476 3300041511 Bacteria 573
284 Ga0451853_1352757 3300041512 Bacteria 1220
285 Ga0439458_0065140 3300042157 Bacteria 914
286 Ga0439434_0237512 3300042435 Unclassified 621
287 Ga0466972_0070025 3300044658 Bacteria 1674
288 Ga0466965_0340701 3300044683 Bacteria 820
289 Ga0466966_0649623 3300044684 Bacteria 635
290 Ga0466961_0283992 3300044693 Bacteria 1013
291 Ga0466961_0362720 3300044693 Bacteria 881
292 Ga0466963_0189677 3300044694 Bacteria 1436
293 Ga0466970_0478901 3300044765 Bacteria 715
294 Ga0466970_0914577 3300044765 Bacteria 516
295 Ga0466957_0301795 3300044842 Bacteria 1076
296 Ga0466957_0684953 3300044842 Bacteria 723
297 Ga0466960_0006501 3300044901 Bacteria 4691
298 Ga0466960_0045497 3300044901 Bacteria 2097
299 Ga0466960_0106335 3300044901 Bacteria 1451
300 Ga0466960_0119300 3300044901 Bacteria 1380
301 Ga0466960_0251225 3300044901 Bacteria 982
302 Ga0466960_0263238 3300044901 Bacteria 961
303 Ga0466960_0415734 3300044901 Bacteria 777
304 Ga0466960_0956123 3300044901 Bacteria 525
305 Ga0466958_0738233 3300045836 Bacteria 642
306 Ga0466967_0130898 3300045976 Bacteria 2329
307 Ga0466967_1178045 3300045976 Bacteria 763
308 Ga0495582_0495686 3300046473 Bacteria 706
309 Ga0495664_0456782 3300046477 Bacteria 765
310 Ga0495645_0725296 3300046543 Bacteria 602
311 Ga0495658_0268641 3300046683 Bacteria 1075
312 Ga0495676_0375405 3300047321 Bacteria 947
313 Ga0495680_1089787 3300047322 Bacteria 505
314 Ga0496100_0083949 3300048903 Bacteria 2158
315 Ga0496101_1164376 3300048904 Bacteria 605
316 Ga0496102_0017913 3300048905 Bacteria 6212
317 Ga0496102_0702952 3300048905 Bacteria 934
318 Ga0496102_1019139 3300048905 Bacteria 748
319 Ga0496103_0061933 3300048906 Bacteria 2328
320 Ga0496104_0365081 3300048907 Bacteria 1356
321 Ga0496106_0021533 3300048909 Bacteria 4787
322 Ga0496106_0061990 3300048909 Bacteria 2839
323 Ga0496107_0019292 3300048910 Bacteria 4811
324 Ga0496108_0047498 3300048911 Bacteria 3588
325 Ga0496108_0131171 3300048911 Bacteria 2154
326 Ga0496108_0165007 3300048911 Bacteria 1915
327 Ga0496108_0589064 3300048911 Bacteria 969
328 Ga0496108_1102523 3300048911 Bacteria 674
329 Ga0496108_1430548 3300048911 Bacteria 577
330 Ga0496109_0107201 3300048912 Bacteria 2595
331 Ga0496109_0238082 3300048912 Bacteria 1713
332 Ga0496109_0354269 3300048912 Bacteria 1386
333 Ga0496110_0086287 3300048913 Bacteria 2802
334 Ga0496110_0179714 3300048913 Bacteria 1921
335 Ga0496110_0785833 3300048913 Bacteria 856
336 Ga0496110_1221819 3300048913 Bacteria 660
337 Ga0496111_0690618 3300048914 Bacteria 743
338 Ga0496111_0724662 3300048914 Bacteria 722
339 Ga0496113_0141185 3300048916 Bacteria 1895
340 Ga0496114_0094129 3300048917 Bacteria 2548
341 Ga0496114_0109364 3300048917 Bacteria 2367
342 Ga0496114_0154008 3300048917 Bacteria 1995
343 Ga0496114_1291661 3300048917 Bacteria 617
344 Ga0496114_1624370 3300048917 Bacteria 534
345 Ga0501031_0132361 3300049568 Bacteria 1629
346 Ga0501031_0166616 3300049568 Bacteria 1440
347 Ga0501031_0299124 3300049568 Bacteria 1043
348 Ga0501031_0476057 3300049568 Bacteria 806
349 Ga0501036_0621394 3300049572 Bacteria 895
350 Ga0501036_1138745 3300049572 Bacteria 637
351 Ga0501036_1332386 3300049572 Bacteria 583
352 Ga0501038_0711674 3300049574 Bacteria 752
353 Ga0501038_1408651 3300049574 Bacteria 501
354 Ga0501039_0294956 3300049575 Bacteria 1275
355 Ga0501039_0378936 3300049575 Bacteria 1111
356 Ga0501039_0565250 3300049575 Bacteria 892
357 Ga0501039_0780545 3300049575 Bacteria 746
358 Ga0501039_0936273 3300049575 Bacteria 674
359 Ga0501040_0037432 3300049576 Bacteria 3296
360 Ga0501040_0262980 3300049576 Unclassified 1231
361 Ga0501041_0508632 3300049577 Bacteria 766
362 Ga0501041_0620095 3300049577 Bacteria 691
363 Ga0501042_0197558 3300049578 Bacteria 1451
364 Ga0501042_0250185 3300049578 Bacteria 1279
365 Ga0501042_0301796 3300049578 Bacteria 1157
366 Ga0501042_0543418 3300049578 Bacteria 844
367 Ga0501042_0567940 3300049578 Bacteria 825
368 Ga0501042_0629862 3300049578 Bacteria 780
369 Ga0501046_0714232 3300049580 Bacteria 706
370 Ga0501048_0143918 3300049582 Bacteria 1686
371 Ga0501048_0201784 3300049582 Bacteria 1410
372 Ga0501048_0426689 3300049582 Bacteria 949
373 Ga0501067_0019832 3300049583 Bacteria 3722
374 Ga0501067_0024250 3300049583 Bacteria 3364
375 Ga0501067_0042976 3300049583 Bacteria 2510
376 Ga0501068_0007230 3300049584 Bacteria 6147
377 Ga0501068_0299989 3300049584 Bacteria 1028
378 Ga0501069_0073113 3300049585 Bacteria 1922
379 Ga0501069_0149976 3300049585 Bacteria 1340
380 Ga0501069_0232446 3300049585 Bacteria 1073
381 Ga0501069_0724080 3300049585 Bacteria 601
382 Ga0501071_0700559 3300049587 Bacteria 780
383 Ga0501071_1571615 3300049587 Bacteria 508
384 Ga0501072_0260017 3300049588 Bacteria 1382
385 Ga0501074_0737917 3300049590 Bacteria 695
386 Ga0501074_0951202 3300049590 Bacteria 604
387 Ga0501075_0725637 3300049591 Unclassified 757
388 Ga0501075_1282562 3300049591 Bacteria 555
389 Ga0501076_0694985 3300049592 Bacteria 840
390 Ga0501076_0708820 3300049592 Bacteria 831
391 Ga0501076_1126437 3300049592 Bacteria 646
392 Ga0501209_248155 3300049656 Bacteria 556
393 Ga0501209_253772 3300049656 Bacteria 550
394 Ga0501079_0114767 3300049741 Bacteria 2094
395 Ga0501079_0198663 3300049741 Bacteria 1566
396 Ga0501081_0189097 3300049743 Bacteria 1491
397 Ga0501279_088840 3300049775 Bacteria 543
398 Ga0501045_0270654 3300049824 Bacteria 1265
399 Ga0501045_0642077 3300049824 Bacteria 785
400 Ga0501045_0921483 3300049824 Bacteria 642
401 nmdc:mga00v17_221972_c1 3300050491 Bacteria 1223
402 nmdc:mga00v17_81850_c1 3300050491 Bacteria 2017
403 nmdc:mga0yw44_233626_c1 3300050492 Bacteria 740
404 nmdc:mga0yw44_24397_c1 3300050492 Bacteria 3422
405 nmdc:mga08y16_128977_c1 3300050511 Bacteria 2631
406 nmdc:mga0rr50_857771_c1 3300050513 Bacteria 774
407 nmdc:mga0sz30_185295_c1 3300050516 Bacteria 924
408 Ga0495612_0560243 3300053078 Bacteria 527
409 Ga0500620_075559 3300053155 Bacteria 1163
410 Ga0501084_0509372 3300054114 Bacteria 1017
411 Ga0501082_1244524 3300060353 Bacteria 650
412 Ga0466962_0112188 3300061719 Bacteria 1313
413 Ga0466962_0313243 3300061719 Bacteria 778
414 Ga0530510_0118464 3300061734 Bacteria 1943
415 Ga0530510_0182214 3300061734 Bacteria 1558
416 Ga0530510_0526251 3300061734 Bacteria 897
417 Ga0530510_0576274 3300061734 Bacteria 855
418 Ga0530510_0956081 3300061734 Bacteria 655
419 Ga0530510_1433393 3300061734 Bacteria 530
420 2984580439 2984576629 Bacteria 4248407
421 2990258131 2990256926 Bacteria 4252839
422 Ga0182008_10207877
423 LJQas_1011447
424 JGI24744J21845_10009302
425 rootH1_10083814
426 Ga0070658_10263900
427 Ga0070658_10793851
428 Ga0070658_11342732
429 Ga0070658_11537253
430 Ga0070683_100060296
431 Ga0070683_100210456
432 Ga0070683_100416942
433 Ga0070683_100925057
434 Ga0070683_101513953
435 Ga0070690_100506421
436 Ga0070670_100140786
437 Ga0070670_100188563
438 Ga0070677_10254536
439 Ga0070666_10954948
440 Ga0070682_100012318
441 Ga0070682_100059430
442 Ga0070682_100399803
443 Ga0070682_100925508
444 Ga0068868_100784138
445 Ga0068868_101565140
446 Ga0068868_102210813
447 Ga0070660_100161139
448 Ga0070660_100211962
449 Ga0070660_100359297
450 Ga0070660_100495476
451 Ga0070687_100009535
452 Ga0070661_100193408
453 Ga0070661_100232616
454 Ga0070661_100947941
455 Ga0070692_10005827
456 Ga0070668_101636612
457 Ga0070669_100339820
458 Ga0070675_100783382
459 Ga0070671_101828721
460 Ga0070674_100114302
461 Ga0070674_100356506
462 Ga0070673_100054376
463 Ga0070688_100199215
464 Ga0070659_100290908
465 Ga0070659_100557106
466 Ga0070659_101692494
467 Ga0070714_100007416
468 Ga0070701_10010070
469 Ga0070705_101410968
470 Ga0070700_100008782
471 Ga0070700_100274055
472 Ga0070700_100429724
473 Ga0070700_101121925
474 Ga0070663_100811260
475 Ga0070678_101653200
476 Ga0070662_100770043
477 Ga0068867_100219749
478 Ga0070685_10091620
479 Ga0070679_100435127
480 Ga0070679_101292975
481 Ga0070684_100485323
482 Ga0070684_100541824
483 Ga0070684_100670287
484 Ga0070684_101506230
485 Ga0070684_101884903
486 Ga0068853_100123685
487 Ga0070672_100010185
488 Ga0070672_100568178
489 Ga0070686_100023482
490 Ga0070686_100675685
491 Ga0070693_100250064
492 Ga0070693_101577290
493 Ga0068855_100533596
494 Ga0070664_101166492
495 Ga0068857_101059978
496 Ga0068857_101236829
497 Ga0068854_100015956
498 Ga0068854_101077680
499 Ga0068856_100718009
500 Ga0070702_100239586
501 Ga0068852_100010468
502 Ga0068852_100430113
503 Ga0068852_100621478
504 Ga0068852_100821534
505 Ga0068852_102045326
506 Ga0068859_100655033
507 Ga0068864_100078862
508 Ga0068864_101908349
509 Ga0068864_102025812
510 Ga0068866_10040320
511 Ga0068870_10010367
512 Ga0068863_100474105
513 Ga0075365_10110530
514 Ga0075364_10018462
515 Ga0075432_10472365
516 Ga0070712_100382976
517 Ga0075362_10070483
518 Ga0097621_102100313
519 Ga0068871_101948359
520 Ga0075428_100082218
521 Ga0075433_11941716
522 Ga0075434_102038494
523 Ga0068865_102149161
524 Ga0097620_100655051
525 Ga0075435_100257362
526 Ga0105240_10791950
527 Ga0111539_10721197
528 Ga0105245_10011453
529 Ga0105245_10674299
530 Ga0105245_10851581
531 Ga0105247_10441038
532 Ga0114129_10467546
533 Ga0105243_10007913
534 Ga0105243_10871406
535 Ga0105243_11748507
536 Ga0105242_10247606
537 Ga0105242_10952294
538 Ga0105242_13255057
539 Ga0105248_10031255
540 Ga0105248_11598010
541 Ga0105237_12629602
542 Ga0105238_10104872
543 Ga0105238_10303171
544 Ga0105238_11171552
545 Ga0105238_12480095
546 Ga0105249_10068158
547 Ga0105239_10162248
548 Ga0105239_10543036
549 Ga0105239_10735680
550 Ga0105239_11048609
551 Ga0105239_12282671
552 Ga0105246_10128533
553 Ga0105246_10295143
554 Ga0105246_10501389
555 Ga0105246_10968065
556 Ga0105246_11161820
557 Ga0105246_11618256
558 Ga0157327_1040704
559 Ga0157371_11116964
560 Ga0157371_11234263
561 Ga0157370_10395985
562 Ga0157370_10991665
563 Ga0157369_10167551
564 Ga0157369_10804737
565 Ga0157369_11184649
566 Ga0157369_11313107
567 Ga0157369_12141288
568 Ga0163162_11554125
569 Ga0157372_10032619
570 Ga0157372_10153111
571 Ga0157372_10453996
572 Ga0157372_10477998
573 Ga0157372_11399003
574 Ga0157372_12954244
575 Ga0157372_13303935
576 Ga0157375_12210589
577 Ga0163163_10079027
578 Ga0157380_10005482
579 Ga0157380_12030333
580 Ga0157380_12385992
581 Ga0182008_10152715
582 Ga0157377_10006282
583 Ga0157377_10050050
584 Ga0157376_10577967
585 Ga0157376_11605673
586 Ga0163161_10117324
587 Ga0163161_11651398
588 Ga0206356_10124381
589 Ga0206350_10181077
590 Ga0206354_10692761
591 Ga0206353_11218945
592 Ga0206353_11281111
593 Ga0207697_10052821
594 Ga0207642_10414922
595 Ga0207642_10612358
596 Ga0207688_10054635
597 Ga0207688_10127444
598 Ga0207688_10285138
599 Ga0207688_10666001
600 Ga0207643_10014468
601 Ga0207705_10001806
602 Ga0207705_10283543
603 Ga0207705_11181344
604 Ga0207707_10860001
605 Ga0207662_10161675
606 Ga0207657_10047471
607 Ga0207657_10224085
608 Ga0207657_10818305
609 Ga0207657_11514142
610 Ga0207649_11486971
611 Ga0207681_10049737
612 Ga0207694_10219632
613 Ga0207650_10263410
614 Ga0207659_10192257
615 Ga0207659_11471082
616 Ga0207687_10058991
617 Ga0207687_10130399
618 Ga0207687_10314171
619 Ga0207687_10717919
620 Ga0207664_10005672
621 Ga0207690_10010541
622 Ga0207690_10204707
623 Ga0207686_10025546
624 Ga0207686_10188410
625 Ga0207709_10035704
626 Ga0207709_10940753
627 Ga0207670_10347129
628 Ga0207669_10132597
629 Ga0207704_11097023
630 Ga0207691_10006431
631 Ga0207711_10044881
632 Ga0207711_10483149
633 Ga0207689_11589984
634 Ga0207661_10013050
635 Ga0207661_10349141
636 Ga0207661_10404226
637 Ga0207661_10623843
638 Ga0207661_11103512
639 Ga0207661_11363635
640 Ga0207679_11808676
641 Ga0207651_10432898
642 Ga0207651_11616390
643 Ga0207712_11136979
644 Ga0207668_10899153
645 Ga0207640_10017896
646 Ga0207677_10487095
647 Ga0207677_10574899
648 Ga0207639_10332349
649 Ga0207678_10969298
650 Ga0207678_11109333
651 Ga0207708_10001687
652 Ga0207708_10190084
653 Ga0207708_10417679
654 Ga0207708_10530648
655 Ga0207641_11459021
656 Ga0207648_10009611
657 Ga0207676_10080777
658 Ga0207676_11816224
659 Ga0207676_12577274
660 Ga0207674_10300444
661 Ga0207674_11567276
662 Ga0207674_12143194
663 Ga0207683_10389655
664 Ga0207683_10608307
665 Ga0207698_10169203
666 Ga0207698_11237828
667 Ga0207698_11274939
668 Ga0207698_12048940
669 Ga0207428_10131580
670 Ga0268265_10239941
671 Ga0268265_12652119
672 Ga0307405_11829356
673 Ga0307406_10294408
674 Ga0307407_10064914
675 Ga0307412_10137629
676 Ga0307409_100068198
677 Ga0307409_100292558
678 Ga0307409_100310763
679 Ga0307409_101115715
680 Ga0307409_101438354
681 Ga0307416_100296447
682 Ga0307416_100542394
683 Ga0307414_10113533
684 Ga0307411_11746485
685 Ga0307415_100541922
686 Ga0373960_0226481
687 Ga0373961_0083564
688 Ga0373931_1090434
689 Ga0373927_0895123
690 Ga0373947_0806739
691 Ga0373925_1038244
692 Ga0395899_0040496
693 Ga0395898_0161264
694 Ga0436364_1421217
695 Ga0395901_0012965
696 Ga0451807_1943677
697 Ga0451839_0269243
698 Ga0451841_0535108
699 Ga0451845_0293928
700 Ga0451847_0162866
701 Ga0451847_0505682
702 Ga0451851_0828895
703 Ga0451843_1284192
704 Ga0451855_0545476
705 Ga0451853_1352757
706 Ga0439458_0065140
707 Ga0439434_0237512
708 Ga0466972_0070025
709 Ga0466965_0340701
710 Ga0466966_0649623
711 Ga0466961_0283992
712 Ga0466961_0362720
713 Ga0466963_0189677
714 Ga0466970_0478901
715 Ga0466970_0914577
716 Ga0466957_0301795
717 Ga0466957_0684953
718 Ga0466960_0006501
719 Ga0466960_0045497
720 Ga0466960_0106335
721 Ga0466960_0119300
722 Ga0466960_0251225
723 Ga0466960_0263238
724 Ga0466960_0415734
725 Ga0466960_0956123
726 Ga0466958_0738233
727 Ga0466967_0130898
728 Ga0466967_1178045
729 Ga0495582_0495686
730 Ga0495664_0456782
731 Ga0495645_0725296
732 Ga0495658_0268641
733 Ga0495676_0375405
734 Ga0495680_1089787
735 Ga0496100_0083949
736 Ga0496101_1164376
737 Ga0496102_0017913
738 Ga0496102_0702952
739 Ga0496102_1019139
740 Ga0496103_0061933
741 Ga0496104_0365081
742 Ga0496106_0021533
743 Ga0496106_0061990
744 Ga0496107_0019292
745 Ga0496108_0047498
746 Ga0496108_0131171
747 Ga0496108_0165007
748 Ga0496108_0589064
749 Ga0496108_1102523
750 Ga0496108_1430548
751 Ga0496109_0107201
752 Ga0496109_0238082
753 Ga0496109_0354269
754 Ga0496110_0086287
755 Ga0496110_0179714
756 Ga0496110_0785833
757 Ga0496110_1221819
758 Ga0496111_0690618
759 Ga0496111_0724662
760 Ga0496113_0141185
761 Ga0496114_0094129
762 Ga0496114_0109364
763 Ga0496114_0154008
764 Ga0496114_1291661
765 Ga0496114_1624370
766 Ga0501031_0132361
767 Ga0501031_0166616
768 Ga0501031_0299124
769 Ga0501031_0476057
770 Ga0501036_0621394
771 Ga0501036_1138745
772 Ga0501036_1332386
773 Ga0501038_0711674
774 Ga0501038_1408651
775 Ga0501039_0294956
776 Ga0501039_0378936
777 Ga0501039_0565250
778 Ga0501039_0780545
779 Ga0501039_0936273
780 Ga0501040_0037432
781 Ga0501040_0262980
782 Ga0501041_0508632
783 Ga0501041_0620095
784 Ga0501042_0197558
785 Ga0501042_0250185
786 Ga0501042_0301796
787 Ga0501042_0543418
788 Ga0501042_0567940
789 Ga0501042_0629862
790 Ga0501046_0714232
791 Ga0501048_0143918
792 Ga0501048_0201784
793 Ga0501048_0426689
794 Ga0501067_0019832
795 Ga0501067_0024250
796 Ga0501067_0042976
797 Ga0501068_0007230
798 Ga0501068_0299989
799 Ga0501069_0073113
800 Ga0501069_0149976
801 Ga0501069_0232446
802 Ga0501069_0724080
803 Ga0501071_0700559
804 Ga0501071_1571615
805 Ga0501072_0260017
806 Ga0501074_0737917
807 Ga0501074_0951202
808 Ga0501075_0725637
809 Ga0501075_1282562
810 Ga0501076_0694985
811 Ga0501076_0708820
812 Ga0501076_1126437
813 Ga0501209_248155
814 Ga0501209_253772
815 Ga0501079_0114767
816 Ga0501079_0198663
817 Ga0501081_0189097
818 Ga0501279_088840
819 Ga0501045_0270654
820 Ga0501045_0642077
821 Ga0501045_0921483
822 nmdc:mga00v17_221972_c1
823 nmdc:mga00v17_81850_c1
824 nmdc:mga0yw44_233626_c1
825 nmdc:mga0yw44_24397_c1
826 nmdc:mga08y16_128977_c1
827 nmdc:mga0rr50_857771_c1
828 nmdc:mga0sz30_185295_c1
829 Ga0495612_0560243
830 Ga0500620_075559
831 Ga0501084_0509372
832 Ga0501082_1244524
833 Ga0466962_0112188
834 Ga0466962_0313243
835 Ga0530510_0118464
836 Ga0530510_0182214
837 Ga0530510_0526251
838 Ga0530510_0576274
839 Ga0530510_0956081
840 Ga0530510_1433393
841 2984580439
842 2990258131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0l-assembly1.cif.gz_B crystal structure of a pfam duf1425 family member (shew_1734) from shewanella sp. pv-4 at 1.81 a resolution 0.5998 18 41
1yd5-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima: point mutant n88a bound to its catalytic divalent cation 0.5446 18 70
1yd1-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima bound to its catalytic divalent cation: magnesium 0.5436 18 70
5hy3-assembly1.cif.gz_B crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd 0.5427 19 80
1yd2-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima: point mutant y19f bound to the catalytic divalent cation 0.5383 18 70
ID Description Score Start End Superfamily
3rh7E01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.5855 18 33 2.30.110.10
af_G5ECR0_1_1119_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.5833 18 40 3.40.50.410
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.562 18 69 3.40.140.10
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.556 18 77 3.10.20.520
af_P9WFC5_7_103_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.5503 16 70 3.40.1440.10
ID Description Score Start End GO Terms
AF-A0A2S6GVI7-F1-model_v4 Uncharacterized protein 0.9338 17 84
AF-A0A1I5PHJ9-F1-model_v4 Uncharacterized protein 0.932 20 84
AF-C8XF07-F1-model_v4 Uncharacterized protein 0.932 20 84
AF-A0A7K1FG86-F1-model_v4 Uncharacterized protein 0.9318 21 84
AF-A0A2T0R8J5-F1-model_v4 Uncharacterized protein 0.9297 18 84

Map