F439972

General Info

Members Datasets Scaffolds Average Seq Length
421 227 842 162

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10783095|Ga0105247_107830951
Length 181
Sequence MTFTDEVLANNQRYAESFSGPLPLPPSKHLAVVACMDARINVYAALGLNEGEAHVIRNAGGVVTDDEIRSLAISQRLLGTEEIILIHHTDCGMLTFTDDEFKAGIQQEVGIKPEWAAEAFSDVAEDVRQSIARIKASPFIPKTDAVRGFVFDVATGRLDEVAVEASPRVIRLEPAKSTSSV

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2527291627 Frankia casuarinae Thr Isolate Nodule
216 2527291629 Frankia sp. BMG5.23 Isolate Nodule
217 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
218 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
219 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
220 2576861822 Frankia sp. CeD Isolate Nodule
221 2643221615 Nocardioides sp. Root224 Isolate Unclassified
222 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
223 2684623036 Frankia sp. CgIM4 Isolate Nodule
224 2710264753 Frankia sp. KB5 Isolate Nodule
225 2773857924 Frankia sp. CgIS1 Isolate Nodule
226 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
227 637000116 Frankia casuarinae CcI3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 1.66
Rhizoplane 7.36
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10783095 3300009101 Bacteria 726
2 Ga0070658_11223282 3300005327 Bacteria 653
3 Ga0070676_10000090 3300005328 Bacteria 31500
4 Ga0070683_100103278 3300005329 Bacteria 2686
5 Ga0070683_100162957 3300005329 Bacteria 2116
6 Ga0070683_100169593 3300005329 Bacteria 2071
7 Ga0070683_100596435 3300005329 Bacteria 1057
8 Ga0068869_100254460 3300005334 Bacteria 1404
9 Ga0070682_100553340 3300005337 Bacteria 901
10 Ga0068868_100140957 3300005338 Bacteria 1979
11 Ga0070692_10135167 3300005345 Bacteria 1390
12 Ga0070669_100041445 3300005353 Bacteria 3348
13 Ga0070659_100910645 3300005366 Bacteria 769
14 Ga0070709_10044184 3300005434 Bacteria 2758
15 Ga0070714_100032466 3300005435 Bacteria 4358
16 Ga0070714_100032967 3300005435 Bacteria 4328
17 Ga0070714_100065596 3300005435 Bacteria 3128
18 Ga0070714_100107364 3300005435 Bacteria 2467
19 Ga0070714_101255868 3300005435 Bacteria 723
20 Ga0070713_100156595 3300005436 Bacteria 2031
21 Ga0070713_100164018 3300005436 Bacteria 1986
22 Ga0070713_100262146 3300005436 Bacteria 1580
23 Ga0070713_100360492 3300005436 Bacteria 1351
24 Ga0070713_101604735 3300005436 Bacteria 631
25 Ga0070710_10452177 3300005437 Bacteria 871
26 Ga0070711_100858193 3300005439 Bacteria 773
27 Ga0070708_100941374 3300005445 Bacteria 810
28 Ga0070678_100717782 3300005456 Bacteria 902
29 Ga0070662_100262357 3300005457 Bacteria 1392
30 Ga0070681_10087343 3300005458 Bacteria 3072
31 Ga0070681_11576064 3300005458 Bacteria 582
32 Ga0070706_100075464 3300005467 Bacteria 3120
33 Ga0070698_100634065 3300005471 Bacteria 1010
34 Ga0070679_100196634 3300005530 Bacteria 1984
35 Ga0070679_100733233 3300005530 Bacteria 931
36 Ga0070684_100180889 3300005535 Bacteria 1917
37 Ga0070684_100431733 3300005535 Bacteria 1216
38 Ga0070684_100670965 3300005535 Bacteria 966
39 Ga0070686_100305625 3300005544 Bacteria 1181
40 Ga0068857_100391535 3300005577 Bacteria 1292
41 Ga0068870_10488086 3300005840 Bacteria 819
42 Ga0081455_10251570 3300005937 Bacteria 1292
43 Ga0081538_10043198 3300005981 Bacteria 2834
44 Ga0081540_1000130 3300005983 Bacteria 80050
45 Ga0081540_1016131 3300005983 Bacteria 4692
46 Ga0070717_10058287 3300006028 Bacteria 3193
47 Ga0070717_10386325 3300006028 Bacteria 1256
48 Ga0070717_10441443 3300006028 Bacteria 1172
49 Ga0070717_10820048 3300006028 Bacteria 846
50 Ga0070717_11499527 3300006028 Bacteria 612
51 Ga0075363_100012740 3300006048 Bacteria 4059
52 Ga0070712_100016122 3300006175 Bacteria 4823
53 Ga0070712_100059723 3300006175 Bacteria 2687
54 Ga0070712_100126560 3300006175 Bacteria 1931
55 Ga0070712_100485373 3300006175 Bacteria 1034
56 Ga0075362_10287746 3300006177 Bacteria 814
57 Ga0075370_10815010 3300006353 Bacteria 569
58 Ga0075428_100032890 3300006844 Bacteria 5727
59 Ga0075430_100566971 3300006846 Bacteria 936
60 Ga0075433_10030800 3300006852 Bacteria 4581
61 Ga0075433_10048168 3300006852 Bacteria 3706
62 Ga0075433_11007276 3300006852 Bacteria 725
63 Ga0068865_100948726 3300006881 Bacteria 751
64 Ga0075436_100024970 3300006914 Bacteria 4109
65 Ga0075436_100040380 3300006914 Bacteria 3220
66 Ga0075436_100123932 3300006914 Bacteria 1810
67 Ga0075436_100201179 3300006914 Bacteria 1411
68 Ga0075435_100009983 3300007076 Bacteria 6920
69 Ga0075435_100043471 3300007076 Bacteria 3596
70 Ga0075435_100715028 3300007076 Bacteria 871
71 Ga0111539_10472691 3300009094 Bacteria 1460
72 Ga0105245_10012894 3300009098 Bacteria 7287
73 Ga0105245_11247474 3300009098 Bacteria 792
74 Ga0105245_13020347 3300009098 Bacteria 521
75 Ga0105247_10387365 3300009101 Bacteria 993
76 Ga0114129_10031084 3300009147 Bacteria 7552
77 Ga0114129_10100996 3300009147 Bacteria 3992
78 Ga0105243_10455944 3300009148 Bacteria 1201
79 Ga0105248_10980754 3300009177 Bacteria 954
80 Ga0157369_11749188 3300013105 Bacteria 632
81 Ga0157372_10932695 3300013307 Bacteria 1007
82 Ga0157375_10597374 3300013308 Bacteria 1263
83 Ga0163163_11531444 3300014325 Bacteria 728
84 Ga0157376_11224571 3300014969 Bacteria 779
85 Ga0163161_10649642 3300017792 Bacteria 874
86 Ga0213873_10000266 3300021358 Bacteria 9027
87 Ga0213874_10389974 3300021377 Bacteria 540
88 Ga0213875_10152863 3300021388 Bacteria 1082
89 Ga0213875_10357126 3300021388 Bacteria 694
90 Ga0228598_1022768 3300024227 Bacteria 1232
91 Ga0207653_10040072 3300025885 Bacteria 1535
92 Ga0207685_10199577 3300025905 Bacteria 939
93 Ga0207693_10055625 3300025915 Bacteria 3104
94 Ga0207693_10236128 3300025915 Bacteria 1435
95 Ga0207663_10751291 3300025916 Bacteria 775
96 Ga0207652_10424940 3300025921 Bacteria 1198
97 Ga0207687_10039374 3300025927 Bacteria 3236
98 Ga0207700_10085844 3300025928 Bacteria 2471
99 Ga0207700_10139043 3300025928 Bacteria 1993
100 Ga0207664_10004460 3300025929 Bacteria 9480
101 Ga0207664_10016179 3300025929 Bacteria 5435
102 Ga0207664_10093615 3300025929 Bacteria 2468
103 Ga0207664_10123893 3300025929 Bacteria 2167
104 Ga0207664_10693549 3300025929 Bacteria 916
105 Ga0207664_11564559 3300025929 Bacteria 581
106 Ga0207706_10505575 3300025933 Bacteria 1043
107 Ga0207709_10814721 3300025935 Bacteria 754
108 Ga0207661_10190036 3300025944 Bacteria 1800
109 Ga0207661_10206369 3300025944 Bacteria 1730
110 Ga0207667_10411952 3300025949 Bacteria 1376
111 Ga0207702_11315904 3300026078 Bacteria 717
112 Ga0207676_10946300 3300026095 Bacteria 847
113 Ga0207674_10547782 3300026116 Bacteria 1117
114 Ga0207675_102031080 3300026118 Bacteria 592
115 Ga0207698_11821523 3300026142 Bacteria 624
116 Ga0268266_10596281 3300028379 Bacteria 1061
117 Ga0268266_11375683 3300028379 Bacteria 681
118 Ga0265336_10008434 3300028666 Bacteria 3615
119 Ga0265338_10007201 3300028800 Bacteria 13906
120 Ga0307513_10063555 3300031456 Bacteria 3895
121 Ga0307513_10130886 3300031456 Bacteria 2455
122 Ga0307408_100065605 3300031548 Bacteria 2663
123 Ga0316578_10025228 3300031728 Bacteria 3340
124 Ga0307410_10106248 3300031852 Bacteria 2023
125 Ga0307406_10251972 3300031901 Bacteria 1331
126 Ga0307406_10890752 3300031901 Bacteria 757
127 Ga0307407_10115607 3300031903 Bacteria 1692
128 Ga0307409_100295948 3300031995 Bacteria 1503
129 Ga0307409_101271856 3300031995 Bacteria 760
130 Ga0316585_10004550 3300032137 Bacteria 3869
131 Ga0316580_10018308 3300032139 Bacteria 2154
132 Ga0307510_10001643 3300033180 Bacteria 24778
133 Ga0373934_0001538 3300035086 Bacteria 8455
134 Ga0373923_0001700 3300035111 Bacteria 6450
135 Ga0373923_0002449 3300035111 Bacteria 5720
136 Ga0373923_0272332 3300035111 Bacteria 796
137 Ga0373932_0003691 3300035112 Bacteria 3661
138 Ga0373936_0046631 3300035113 Bacteria 1747
139 Ga0373936_0333902 3300035113 Bacteria 688
140 Ga0373945_0099971 3300035116 Bacteria 1134
141 Ga0373953_0000043 3300035117 Bacteria 32688
142 Ga0373953_0015447 3300035117 Bacteria 2768
143 Ga0373953_0026757 3300035117 Bacteria 2211
144 Ga0373954_0003585 3300035118 Bacteria 6600
145 Ga0373954_0518706 3300035118 Bacteria 590
146 Ga0373956_0000761 3300035119 Bacteria 13331
147 Ga0373956_0043957 3300035119 Bacteria 1990
148 Ga0373956_0045096 3300035119 Bacteria 1966
149 Ga0373956_0512249 3300035119 Bacteria 573
150 Ga0373957_0000396 3300035120 Bacteria 11058
151 Ga0373960_0250495 3300035121 Bacteria 643
152 Ga0373943_0054532 3300035170 Bacteria 1978
153 Ga0373943_0197648 3300035170 Bacteria 1112
154 Ga0373946_0246786 3300035171 Bacteria 870
155 Ga0373955_0000307 3300035172 Bacteria 20276
156 Ga0373955_0066326 3300035172 Bacteria 2006
157 Ga0373955_0085647 3300035172 Bacteria 1789
158 Ga0373955_0131228 3300035172 Bacteria 1462
159 Ga0316574_0043727 3300035398 Bacteria 2768
160 Ga0373924_0000852 3300035410 Bacteria 9592
161 Ga0373924_0009669 3300035410 Bacteria 3542
162 Ga0373924_0012203 3300035410 Bacteria 3207
163 Ga0373931_0387910 3300035691 Bacteria 882
164 Ga0373931_0595338 3300035691 Bacteria 722
165 Ga0373931_0861207 3300035691 Bacteria 607
166 Ga0373935_0359342 3300035692 Bacteria 1039
167 Ga0373927_0479261 3300035695 Bacteria 822
168 Ga0373933_0000283 3300035724 Bacteria 32966
169 Ga0373933_0111528 3300035724 Bacteria 1706
170 Ga0373947_0176167 3300035725 Bacteria 1390
171 Ga0373947_0251032 3300035725 Bacteria 1170
172 Ga0373937_0000560 3300036401 Bacteria 32978
173 Ga0373937_0065429 3300036401 Bacteria 3346
174 Ga0373937_0103643 3300036401 Bacteria 2642
175 Ga0373937_0189465 3300036401 Bacteria 1932
176 Ga0373925_0060962 3300037068 Bacteria 2833
177 Ga0373925_0204237 3300037068 Bacteria 1572
178 Ga0395900_0160159 3300037418 Bacteria 2296
179 Ga0436364_0325053 3300037853 Bacteria 2704
180 Ga0436364_0429034 3300037853 Bacteria 1067
181 Ga0436364_0707008 3300037853 Bacteria 1551
182 Ga0436364_1223775 3300037853 Bacteria 8203
183 Ga0436364_1370595 3300037853 Bacteria 2045
184 Ga0436365_1821373 3300039437 Bacteria 2748
185 Ga0436363_1416689 3300039450 Bacteria 647
186 Ga0436362_0806084 3300039453 Bacteria 17833
187 Ga0436362_0972282 3300039453 Bacteria 802
188 Ga0451853_0314188 3300041512 Bacteria 859
189 Ga0450903_000333 3300042138 Bacteria 10355
190 Ga0466965_0449555 3300044683 Bacteria 717
191 Ga0466966_0164893 3300044684 Bacteria 1348
192 Ga0466963_0630834 3300044694 Bacteria 756
193 Ga0466964_0182373 3300044706 Bacteria 996
194 Ga0466964_0197257 3300044706 Bacteria 964
195 Ga0466971_0095936 3300044719 Bacteria 1360
196 Ga0466968_0001763 3300044735 Bacteria 7807
197 Ga0466968_0020699 3300044735 Bacteria 2658
198 Ga0466968_0038659 3300044735 Bacteria 2006
199 Ga0466970_0037369 3300044765 Bacteria 2573
200 Ga0466970_0300007 3300044765 Bacteria 906
201 Ga0466957_0085330 3300044842 Bacteria 1972
202 Ga0466957_0710385 3300044842 Bacteria 710
203 Ga0466957_0766555 3300044842 Bacteria 684
204 Ga0466960_0012743 3300044901 Bacteria 3556
205 Ga0466959_0154924 3300045049 Bacteria 1613
206 Ga0466959_0689038 3300045049 Bacteria 685
207 Ga0451576_0584294 3300045051 Bacteria 1174
208 Ga0466958_0321319 3300045836 Bacteria 995
209 Ga0466967_0001145 3300045976 Bacteria 14817
210 Ga0466967_0199385 3300045976 Bacteria 1895
211 Ga0466967_0208660 3300045976 Bacteria 1852
212 Ga0466967_1240947 3300045976 Bacteria 742
213 Ga0466967_1700448 3300045976 Bacteria 628
214 Ga0495592_0000403 3300046454 Bacteria 32941
215 Ga0495592_0022861 3300046454 Bacteria 4756
216 Ga0495592_0216172 3300046454 Bacteria 1284
217 Ga0495592_0384980 3300046454 Bacteria 891
218 Ga0495629_0282534 3300046459 Bacteria 1138
219 Ga0495641_0006918 3300046461 Bacteria 7237
220 Ga0495641_0287680 3300046461 Bacteria 740
221 Ga0495651_0000499 3300046462 Bacteria 30439
222 Ga0495651_0305074 3300046462 Bacteria 1066
223 Ga0495653_0013464 3300046463 Bacteria 6664
224 Ga0495653_0025774 3300046463 Bacteria 4717
225 Ga0495653_0035944 3300046463 Bacteria 3906
226 Ga0495653_0171413 3300046463 Bacteria 1497
227 Ga0495653_0313536 3300046463 Bacteria 1019
228 Ga0495582_0003411 3300046473 Bacteria 8946
229 Ga0495582_0185921 3300046473 Bacteria 1184
230 Ga0495639_0030217 3300046475 Bacteria 2408
231 Ga0495639_0244900 3300046475 Bacteria 885
232 Ga0495662_0003231 3300046476 Bacteria 8231
233 Ga0495662_0321012 3300046476 Bacteria 762
234 Ga0495664_0105010 3300046477 Bacteria 1703
235 Ga0495664_0137328 3300046477 Bacteria 1481
236 Ga0495608_0000310 3300046511 Bacteria 34155
237 Ga0495608_0002621 3300046511 Bacteria 12921
238 Ga0495608_0012858 3300046511 Bacteria 5807
239 Ga0495608_0022306 3300046511 Bacteria 4340
240 Ga0495608_0200096 3300046511 Bacteria 1259
241 Ga0495618_0484279 3300046514 Bacteria 747
242 Ga0495628_0005665 3300046516 Bacteria 10938
243 Ga0495628_0012432 3300046516 Bacteria 7180
244 Ga0495628_0038906 3300046516 Bacteria 3805
245 Ga0495628_0218846 3300046516 Bacteria 1430
246 Ga0495630_0037648 3300046517 Bacteria 3617
247 Ga0495630_0381074 3300046517 Bacteria 1080
248 Ga0495666_0154159 3300046526 Bacteria 1067
249 Ga0495652_0003138 3300046529 Bacteria 16506
250 Ga0495652_0076132 3300046529 Bacteria 2784
251 Ga0495652_0207445 3300046529 Bacteria 1482
252 Ga0495665_0024182 3300046531 Bacteria 3263
253 Ga0495665_0180186 3300046531 Bacteria 1098
254 Ga0495640_0016502 3300046533 Bacteria 5522
255 Ga0495640_0041993 3300046533 Bacteria 3193
256 Ga0495586_0168088 3300046535 Bacteria 1238
257 Ga0495587_0000348 3300046536 Bacteria 32978
258 Ga0495587_0016193 3300046536 Bacteria 4640
259 Ga0495587_0035288 3300046536 Bacteria 3012
260 Ga0495587_0270505 3300046536 Bacteria 953
261 Ga0495645_0010662 3300046543 Bacteria 6452
262 Ga0495645_0018414 3300046543 Bacteria 5014
263 Ga0495645_0021510 3300046543 Bacteria 4660
264 Ga0495645_0089127 3300046543 Bacteria 2206
265 Ga0495645_0112974 3300046543 Bacteria 1920
266 Ga0495645_0354463 3300046543 Bacteria 944
267 Ga0495667_0001265 3300046559 Bacteria 16568
268 Ga0495667_0003402 3300046559 Bacteria 10659
269 Ga0495667_0021947 3300046559 Bacteria 4304
270 Ga0495667_0588933 3300046559 Bacteria 693
271 Ga0495634_0010472 3300046642 Bacteria 6790
272 Ga0495634_0025311 3300046642 Bacteria 4155
273 Ga0495634_0104076 3300046642 Bacteria 1831
274 Ga0495635_0008583 3300046663 Bacteria 7134
275 Ga0495635_0072767 3300046663 Bacteria 2354
276 Ga0495635_0382824 3300046663 Bacteria 936
277 Ga0495657_0002176 3300046675 Bacteria 16618
278 Ga0495657_0007423 3300046675 Bacteria 8471
279 Ga0495657_0034774 3300046675 Bacteria 3497
280 Ga0495657_0044758 3300046675 Bacteria 3008
281 Ga0495599_0000267 3300046678 Bacteria 32878
282 Ga0495599_0027562 3300046678 Bacteria 3560
283 Ga0495599_0059476 3300046678 Bacteria 2390
284 Ga0495599_0553308 3300046678 Bacteria 673
285 Ga0495623_0001940 3300046679 Bacteria 13892
286 Ga0495623_0026178 3300046679 Bacteria 3756
287 Ga0495646_0016133 3300046680 Bacteria 4740
288 Ga0495646_0084089 3300046680 Bacteria 1848
289 Ga0495646_0091054 3300046680 Bacteria 1760
290 Ga0495646_0335387 3300046680 Bacteria 794
291 Ga0495647_0385163 3300046681 Bacteria 642
292 Ga0495613_0008514 3300046689 Bacteria 7613
293 Ga0495613_0410277 3300046689 Bacteria 923
294 Ga0495624_0006575 3300046690 Bacteria 8231
295 Ga0495624_0129151 3300046690 Bacteria 1550
296 Ga0495624_0182816 3300046690 Bacteria 1277
297 Ga0495600_0015461 3300046809 Bacteria 4823
298 Ga0495600_0037485 3300046809 Bacteria 3152
299 Ga0495600_0038159 3300046809 Bacteria 3125
300 Ga0495581_0057475 3300047315 Bacteria 2245
301 Ga0495581_0071920 3300047315 Bacteria 2001
302 Ga0495604_0000550 3300047317 Bacteria 32980
303 Ga0495604_0006645 3300047317 Bacteria 9166
304 Ga0495604_0068647 3300047317 Bacteria 2690
305 Ga0495604_0122220 3300047317 Bacteria 1883
306 Ga0495604_0450759 3300047317 Bacteria 841
307 Ga0495674_0045028 3300047319 Bacteria 3920
308 Ga0495674_0050608 3300047319 Bacteria 3666
309 Ga0495674_0419340 3300047319 Bacteria 1078
310 Ga0495674_0420475 3300047319 Bacteria 1077
311 Ga0495674_1061465 3300047319 Bacteria 618
312 Ga0495672_0003832 3300047320 Bacteria 12658
313 Ga0495672_0036265 3300047320 Bacteria 3029
314 Ga0495672_0143873 3300047320 Bacteria 1243
315 Ga0495676_0274026 3300047321 Bacteria 1144
316 Ga0495680_0000904 3300047322 Bacteria 32976
317 Ga0495680_0062246 3300047322 Bacteria 2869
318 Ga0495680_0084182 3300047322 Bacteria 2397
319 Ga0495680_0087726 3300047322 Bacteria 2339
320 Ga0495680_0552805 3300047322 Bacteria 775
321 Ga0495680_0757168 3300047322 Bacteria 637
322 Ga0495675_0003819 3300047444 Bacteria 9125
323 Ga0495675_0007497 3300047444 Bacteria 6721
324 Ga0495675_0021199 3300047444 Bacteria 4137
325 Ga0495675_0088125 3300047444 Bacteria 1949
326 Ga0495684_0001747 3300047471 Bacteria 17467
327 Ga0495593_0047316 3300047673 Bacteria 2288
328 Ga0495602_0000631 3300048088 Bacteria 32978
329 Ga0495602_0014122 3300048088 Bacteria 8122
330 Ga0495602_0085215 3300048088 Bacteria 2641
331 Ga0495602_0309790 3300048088 Bacteria 1152
332 Ga0495614_0119068 3300048089 Bacteria 1163
333 Ga0496100_0024554 3300048903 Bacteria 3677
334 Ga0496101_0019186 3300048904 Bacteria 4664
335 Ga0496101_0977209 3300048904 Bacteria 666
336 Ga0496102_0188577 3300048905 Bacteria 1943
337 Ga0496104_1066500 3300048907 Bacteria 712
338 Ga0496105_0356934 3300048908 Bacteria 1167
339 Ga0496105_0460470 3300048908 Bacteria 1003
340 Ga0496106_0030007 3300048909 Bacteria 4054
341 Ga0496107_0077801 3300048910 Bacteria 2416
342 Ga0496108_0821329 3300048911 Bacteria 801
343 Ga0496108_1658748 3300048911 Bacteria 527
344 Ga0496109_0094233 3300048912 Bacteria 2771
345 Ga0496110_0116644 3300048913 Bacteria 2404
346 Ga0496110_0374596 3300048913 Bacteria 1297
347 Ga0496110_0491100 3300048913 Bacteria 1118
348 Ga0496111_0026742 3300048914 Bacteria 4076
349 Ga0496111_0099585 3300048914 Bacteria 2135
350 Ga0496111_0146456 3300048914 Bacteria 1751
351 Ga0496111_0251359 3300048914 Bacteria 1312
352 Ga0496111_0518151 3300048914 Bacteria 877
353 Ga0496112_0227330 3300048915 Bacteria 1821
354 Ga0496112_0368294 3300048915 Bacteria 1378
355 Ga0496113_0831564 3300048916 Bacteria 733
356 Ga0496114_0004969 3300048917 Bacteria 10371
357 Ga0496114_0320852 3300048917 Bacteria 1369
358 Ga0496114_0347185 3300048917 Bacteria 1312
359 Ga0496114_0817655 3300048917 Bacteria 811
360 Ga0496114_0818351 3300048917 Bacteria 811
361 Ga0496114_1318308 3300048917 Bacteria 609
362 Ga0496115_0070884 3300048918 Bacteria 2826
363 Ga0496123_0425275 3300048926 Bacteria 598
364 Ga0496124_0501027 3300048927 Bacteria 814
365 Ga0501031_0236839 3300049568 Bacteria 1187
366 Ga0501037_0848425 3300049573 Bacteria 601
367 Ga0501041_0522613 3300049577 Bacteria 756
368 Ga0501068_0010769 3300049584 Bacteria 5142
369 Ga0501069_0075311 3300049585 Bacteria 1895
370 Ga0501070_0294551 3300049586 Bacteria 1322
371 Ga0501072_0113359 3300049588 Bacteria 2159
372 Ga0501072_1019362 3300049588 Bacteria 645
373 Ga0501073_0184541 3300049589 Bacteria 1444
374 Ga0501074_0117103 3300049590 Bacteria 1906
375 Ga0501080_0022598 3300049742 Bacteria 5826
376 Ga0501080_0122615 3300049742 Bacteria 2408
377 Ga0501080_0138488 3300049742 Bacteria 2251
378 Ga0501080_0212178 3300049742 Bacteria 1774
379 Ga0501083_0081578 3300049744 Bacteria 2144
380 Ga0501083_1039374 3300049744 Bacteria 533
381 nmdc:mga00v17_258001_c1 3300050491 Bacteria 1131
382 nmdc:mga0yw44_214055_c1 3300050492 Bacteria 1275
383 nmdc:mga09592_1644171_c1 3300050508 Bacteria 519
384 nmdc:mga0qj67_196981_c1 3300050509 Bacteria 1637
385 nmdc:mga06r32_181105_c1 3300050510 Bacteria 2093
386 nmdc:mga08y16_1666278_c1 3300050511 Bacteria 594
387 nmdc:mga0n895_59112_c1 3300050512 Bacteria 3783
388 nmdc:mga0rr50_40570_c1 3300050513 Bacteria 3386
389 nmdc:mga08x19_274597_c1 3300050514 Bacteria 1167
390 nmdc:mga0a205_211132_c1 3300050515 Bacteria 1829
391 nmdc:mga0a205_988558_c1 3300050515 Bacteria 688
392 Ga0495601_0011138 3300053077 Bacteria 5372
393 Ga0495601_0082527 3300053077 Bacteria 2064
394 Ga0495601_0390876 3300053077 Bacteria 902
395 Ga0495612_0083491 3300053078 Bacteria 1344
396 Ga0495595_0005391 3300053084 Bacteria 5181
397 Ga0495595_0011030 3300053084 Bacteria 3771
398 Ga0495595_0019592 3300053084 Bacteria 2937
399 Ga0495595_0064394 3300053084 Bacteria 1723
400 Ga0495595_0311393 3300053084 Bacteria 792
401 Ga0495619_0002373 3300053085 Bacteria 12385
402 Ga0495619_0008638 3300053085 Bacteria 6445
403 Ga0495619_0023339 3300053085 Bacteria 3965
404 Ga0495619_0095146 3300053085 Bacteria 2021
405 Ga0500583_0211116 3300053092 Bacteria 964
406 Ga0501082_0132864 3300060353 Bacteria 2159
407 Ga0501082_0191275 3300060353 Bacteria 1780
408 Ga0530510_0369882 3300061734 Bacteria 1078
409 2528202830 2527291627 Bacteria 5309833
410 2528213206 2527291629 Bacteria 5267418
411 2546947656 2546825537 Bacteria 5389291
412 2552107313 2551306166 Bacteria 9731570
413 2558913983 2558860112 Bacteria 9931328
414 2579748358 2576861822 Bacteria 5004595
415 2644090254 2643221615 Bacteria 5487866
416 2644320099 2643221657 Bacteria 5490246
417 2686542138 2684623036 Bacteria 5199090
418 2710605090 2710264753 Bacteria 5455564
419 2774864213 2773857924 Bacteria 5256821
420 2928143590 2928142448 Bacteria 5288925
421 637877545 637000116 Bacteria 5433628
422 Ga0105247_10783095
423 Ga0070658_11223282
424 Ga0070676_10000090
425 Ga0070683_100103278
426 Ga0070683_100162957
427 Ga0070683_100169593
428 Ga0070683_100596435
429 Ga0068869_100254460
430 Ga0070682_100553340
431 Ga0068868_100140957
432 Ga0070692_10135167
433 Ga0070669_100041445
434 Ga0070659_100910645
435 Ga0070709_10044184
436 Ga0070714_100032466
437 Ga0070714_100032967
438 Ga0070714_100065596
439 Ga0070714_100107364
440 Ga0070714_101255868
441 Ga0070713_100156595
442 Ga0070713_100164018
443 Ga0070713_100262146
444 Ga0070713_100360492
445 Ga0070713_101604735
446 Ga0070710_10452177
447 Ga0070711_100858193
448 Ga0070708_100941374
449 Ga0070678_100717782
450 Ga0070662_100262357
451 Ga0070681_10087343
452 Ga0070681_11576064
453 Ga0070706_100075464
454 Ga0070698_100634065
455 Ga0070679_100196634
456 Ga0070679_100733233
457 Ga0070684_100180889
458 Ga0070684_100431733
459 Ga0070684_100670965
460 Ga0070686_100305625
461 Ga0068857_100391535
462 Ga0068870_10488086
463 Ga0081455_10251570
464 Ga0081538_10043198
465 Ga0081540_1000130
466 Ga0081540_1016131
467 Ga0070717_10058287
468 Ga0070717_10386325
469 Ga0070717_10441443
470 Ga0070717_10820048
471 Ga0070717_11499527
472 Ga0075363_100012740
473 Ga0070712_100016122
474 Ga0070712_100059723
475 Ga0070712_100126560
476 Ga0070712_100485373
477 Ga0075362_10287746
478 Ga0075370_10815010
479 Ga0075428_100032890
480 Ga0075430_100566971
481 Ga0075433_10030800
482 Ga0075433_10048168
483 Ga0075433_11007276
484 Ga0068865_100948726
485 Ga0075436_100024970
486 Ga0075436_100040380
487 Ga0075436_100123932
488 Ga0075436_100201179
489 Ga0075435_100009983
490 Ga0075435_100043471
491 Ga0075435_100715028
492 Ga0111539_10472691
493 Ga0105245_10012894
494 Ga0105245_11247474
495 Ga0105245_13020347
496 Ga0105247_10387365
497 Ga0114129_10031084
498 Ga0114129_10100996
499 Ga0105243_10455944
500 Ga0105248_10980754
501 Ga0157369_11749188
502 Ga0157372_10932695
503 Ga0157375_10597374
504 Ga0163163_11531444
505 Ga0157376_11224571
506 Ga0163161_10649642
507 Ga0213873_10000266
508 Ga0213874_10389974
509 Ga0213875_10152863
510 Ga0213875_10357126
511 Ga0228598_1022768
512 Ga0207653_10040072
513 Ga0207685_10199577
514 Ga0207693_10055625
515 Ga0207693_10236128
516 Ga0207663_10751291
517 Ga0207652_10424940
518 Ga0207687_10039374
519 Ga0207700_10085844
520 Ga0207700_10139043
521 Ga0207664_10004460
522 Ga0207664_10016179
523 Ga0207664_10093615
524 Ga0207664_10123893
525 Ga0207664_10693549
526 Ga0207664_11564559
527 Ga0207706_10505575
528 Ga0207709_10814721
529 Ga0207661_10190036
530 Ga0207661_10206369
531 Ga0207667_10411952
532 Ga0207702_11315904
533 Ga0207676_10946300
534 Ga0207674_10547782
535 Ga0207675_102031080
536 Ga0207698_11821523
537 Ga0268266_10596281
538 Ga0268266_11375683
539 Ga0265336_10008434
540 Ga0265338_10007201
541 Ga0307513_10063555
542 Ga0307513_10130886
543 Ga0307408_100065605
544 Ga0316578_10025228
545 Ga0307410_10106248
546 Ga0307406_10251972
547 Ga0307406_10890752
548 Ga0307407_10115607
549 Ga0307409_100295948
550 Ga0307409_101271856
551 Ga0316585_10004550
552 Ga0316580_10018308
553 Ga0307510_10001643
554 Ga0373934_0001538
555 Ga0373923_0001700
556 Ga0373923_0002449
557 Ga0373923_0272332
558 Ga0373932_0003691
559 Ga0373936_0046631
560 Ga0373936_0333902
561 Ga0373945_0099971
562 Ga0373953_0000043
563 Ga0373953_0015447
564 Ga0373953_0026757
565 Ga0373954_0003585
566 Ga0373954_0518706
567 Ga0373956_0000761
568 Ga0373956_0043957
569 Ga0373956_0045096
570 Ga0373956_0512249
571 Ga0373957_0000396
572 Ga0373960_0250495
573 Ga0373943_0054532
574 Ga0373943_0197648
575 Ga0373946_0246786
576 Ga0373955_0000307
577 Ga0373955_0066326
578 Ga0373955_0085647
579 Ga0373955_0131228
580 Ga0316574_0043727
581 Ga0373924_0000852
582 Ga0373924_0009669
583 Ga0373924_0012203
584 Ga0373931_0387910
585 Ga0373931_0595338
586 Ga0373931_0861207
587 Ga0373935_0359342
588 Ga0373927_0479261
589 Ga0373933_0000283
590 Ga0373933_0111528
591 Ga0373947_0176167
592 Ga0373947_0251032
593 Ga0373937_0000560
594 Ga0373937_0065429
595 Ga0373937_0103643
596 Ga0373937_0189465
597 Ga0373925_0060962
598 Ga0373925_0204237
599 Ga0395900_0160159
600 Ga0436364_0325053
601 Ga0436364_0429034
602 Ga0436364_0707008
603 Ga0436364_1223775
604 Ga0436364_1370595
605 Ga0436365_1821373
606 Ga0436363_1416689
607 Ga0436362_0806084
608 Ga0436362_0972282
609 Ga0451853_0314188
610 Ga0450903_000333
611 Ga0466965_0449555
612 Ga0466966_0164893
613 Ga0466963_0630834
614 Ga0466964_0182373
615 Ga0466964_0197257
616 Ga0466971_0095936
617 Ga0466968_0001763
618 Ga0466968_0020699
619 Ga0466968_0038659
620 Ga0466970_0037369
621 Ga0466970_0300007
622 Ga0466957_0085330
623 Ga0466957_0710385
624 Ga0466957_0766555
625 Ga0466960_0012743
626 Ga0466959_0154924
627 Ga0466959_0689038
628 Ga0451576_0584294
629 Ga0466958_0321319
630 Ga0466967_0001145
631 Ga0466967_0199385
632 Ga0466967_0208660
633 Ga0466967_1240947
634 Ga0466967_1700448
635 Ga0495592_0000403
636 Ga0495592_0022861
637 Ga0495592_0216172
638 Ga0495592_0384980
639 Ga0495629_0282534
640 Ga0495641_0006918
641 Ga0495641_0287680
642 Ga0495651_0000499
643 Ga0495651_0305074
644 Ga0495653_0013464
645 Ga0495653_0025774
646 Ga0495653_0035944
647 Ga0495653_0171413
648 Ga0495653_0313536
649 Ga0495582_0003411
650 Ga0495582_0185921
651 Ga0495639_0030217
652 Ga0495639_0244900
653 Ga0495662_0003231
654 Ga0495662_0321012
655 Ga0495664_0105010
656 Ga0495664_0137328
657 Ga0495608_0000310
658 Ga0495608_0002621
659 Ga0495608_0012858
660 Ga0495608_0022306
661 Ga0495608_0200096
662 Ga0495618_0484279
663 Ga0495628_0005665
664 Ga0495628_0012432
665 Ga0495628_0038906
666 Ga0495628_0218846
667 Ga0495630_0037648
668 Ga0495630_0381074
669 Ga0495666_0154159
670 Ga0495652_0003138
671 Ga0495652_0076132
672 Ga0495652_0207445
673 Ga0495665_0024182
674 Ga0495665_0180186
675 Ga0495640_0016502
676 Ga0495640_0041993
677 Ga0495586_0168088
678 Ga0495587_0000348
679 Ga0495587_0016193
680 Ga0495587_0035288
681 Ga0495587_0270505
682 Ga0495645_0010662
683 Ga0495645_0018414
684 Ga0495645_0021510
685 Ga0495645_0089127
686 Ga0495645_0112974
687 Ga0495645_0354463
688 Ga0495667_0001265
689 Ga0495667_0003402
690 Ga0495667_0021947
691 Ga0495667_0588933
692 Ga0495634_0010472
693 Ga0495634_0025311
694 Ga0495634_0104076
695 Ga0495635_0008583
696 Ga0495635_0072767
697 Ga0495635_0382824
698 Ga0495657_0002176
699 Ga0495657_0007423
700 Ga0495657_0034774
701 Ga0495657_0044758
702 Ga0495599_0000267
703 Ga0495599_0027562
704 Ga0495599_0059476
705 Ga0495599_0553308
706 Ga0495623_0001940
707 Ga0495623_0026178
708 Ga0495646_0016133
709 Ga0495646_0084089
710 Ga0495646_0091054
711 Ga0495646_0335387
712 Ga0495647_0385163
713 Ga0495613_0008514
714 Ga0495613_0410277
715 Ga0495624_0006575
716 Ga0495624_0129151
717 Ga0495624_0182816
718 Ga0495600_0015461
719 Ga0495600_0037485
720 Ga0495600_0038159
721 Ga0495581_0057475
722 Ga0495581_0071920
723 Ga0495604_0000550
724 Ga0495604_0006645
725 Ga0495604_0068647
726 Ga0495604_0122220
727 Ga0495604_0450759
728 Ga0495674_0045028
729 Ga0495674_0050608
730 Ga0495674_0419340
731 Ga0495674_0420475
732 Ga0495674_1061465
733 Ga0495672_0003832
734 Ga0495672_0036265
735 Ga0495672_0143873
736 Ga0495676_0274026
737 Ga0495680_0000904
738 Ga0495680_0062246
739 Ga0495680_0084182
740 Ga0495680_0087726
741 Ga0495680_0552805
742 Ga0495680_0757168
743 Ga0495675_0003819
744 Ga0495675_0007497
745 Ga0495675_0021199
746 Ga0495675_0088125
747 Ga0495684_0001747
748 Ga0495593_0047316
749 Ga0495602_0000631
750 Ga0495602_0014122
751 Ga0495602_0085215
752 Ga0495602_0309790
753 Ga0495614_0119068
754 Ga0496100_0024554
755 Ga0496101_0019186
756 Ga0496101_0977209
757 Ga0496102_0188577
758 Ga0496104_1066500
759 Ga0496105_0356934
760 Ga0496105_0460470
761 Ga0496106_0030007
762 Ga0496107_0077801
763 Ga0496108_0821329
764 Ga0496108_1658748
765 Ga0496109_0094233
766 Ga0496110_0116644
767 Ga0496110_0374596
768 Ga0496110_0491100
769 Ga0496111_0026742
770 Ga0496111_0099585
771 Ga0496111_0146456
772 Ga0496111_0251359
773 Ga0496111_0518151
774 Ga0496112_0227330
775 Ga0496112_0368294
776 Ga0496113_0831564
777 Ga0496114_0004969
778 Ga0496114_0320852
779 Ga0496114_0347185
780 Ga0496114_0817655
781 Ga0496114_0818351
782 Ga0496114_1318308
783 Ga0496115_0070884
784 Ga0496123_0425275
785 Ga0496124_0501027
786 Ga0501031_0236839
787 Ga0501037_0848425
788 Ga0501041_0522613
789 Ga0501068_0010769
790 Ga0501069_0075311
791 Ga0501070_0294551
792 Ga0501072_0113359
793 Ga0501072_1019362
794 Ga0501073_0184541
795 Ga0501074_0117103
796 Ga0501080_0022598
797 Ga0501080_0122615
798 Ga0501080_0138488
799 Ga0501080_0212178
800 Ga0501083_0081578
801 Ga0501083_1039374
802 nmdc:mga00v17_258001_c1
803 nmdc:mga0yw44_214055_c1
804 nmdc:mga09592_1644171_c1
805 nmdc:mga0qj67_196981_c1
806 nmdc:mga06r32_181105_c1
807 nmdc:mga08y16_1666278_c1
808 nmdc:mga0n895_59112_c1
809 nmdc:mga0rr50_40570_c1
810 nmdc:mga08x19_274597_c1
811 nmdc:mga0a205_211132_c1
812 nmdc:mga0a205_988558_c1
813 Ga0495601_0011138
814 Ga0495601_0082527
815 Ga0495601_0390876
816 Ga0495612_0083491
817 Ga0495595_0005391
818 Ga0495595_0011030
819 Ga0495595_0019592
820 Ga0495595_0064394
821 Ga0495595_0311393
822 Ga0495619_0002373
823 Ga0495619_0008638
824 Ga0495619_0023339
825 Ga0495619_0095146
826 Ga0500583_0211116
827 Ga0501082_0132864
828 Ga0501082_0191275
829 Ga0530510_0369882
830 2528202830
831 2528213206
832 2546947656
833 2552107313
834 2558913983
835 2579748358
836 2644090254
837 2644320099
838 2686542138
839 2710605090
840 2774864213
841 2928143590
842 637877545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

30

158

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yf5-assembly1.cif.gz_A crystal structure of rv1284 in the presence of polycarpine at acidic ph 0.97 1 162
4yf5-assembly1.cif.gz_A crystal structure of rv1284 in the presence of polycarpine at acidic ph 0.9642 1 162
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9362 1 162
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9307 1 162
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.9211 1 162
ID Description Score Start End Superfamily
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9716 1 162 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9657 1 162 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9487 1 162 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9362 1 162 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9307 1 162 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A5N0UMF2-F1-model_v4 Carbonic anhydrase 0.998 36 162 GO:0004089
GO:0008270
AF-A0A7X3VUN9-F1-model_v4 Carbonic anhydrase 0.9959 36 162 GO:0004089
GO:0008270
AF-A0A7L7MHV6-F1-model_v4 Carbonic anhydrase 0.9902 24 162 GO:0004089
GO:0008270
AF-A0A5N0UMF2-F1-model_v4 Carbonic anhydrase 0.9902 36 162 GO:0004089
GO:0008270
AF-X8C1Z8-F1-model_v4 deleted 0.9899 33 148

Map