F439967

General Info

Members Datasets Scaffolds Average Seq Length
421 237 401 450

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10011660|Ga0105245_100116604
Length 485
Sequence MFTLTRQAYDRKHENHLTKSLTALTPPSGPQMSDKGLKMCRQKMADAGVDETAIDVFAHYYRLIQHGETGMIPESSIKPIEIESLADVEVPDETASDAIRTTVVIKLNGGLGTSMGMDRAKSLLCVRRGLSFLDIIARQVLHLRKEYGAPLPLIFMNSFHTSADTLAALARYQDLAVEGLPLEFLQNKEPKLRVDNLEPVSWTIDPALEWCPPGHGDIYTTLRSTGLLDQLIDAGFKRVFVSNSDNLGAVPDARVAGWFAQSGAPFAIEAVRRTASDKKGGHFATRVNDGRIVLRETAQTLPEDLEDLTDLSRHKYASTNNVWFDLEAMRTELDRRDGILGLPLIRNEKTTDPSKVIQIETAMGAAIEVFEGSQLIEVTRDRFVPVKNTSQLLLIRSDVYELGRDFVMDMRPDHAPYVELDDPYALVGEFDKRFPSGAPSLKEAESLVVHGDWTFGEGVSVVGEVTLDAPDGRGRIASGTVLREQ

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221615 Nocardioides sp. Root224 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221641 Nocardioides sp. Root122 Isolate Unclassified
9 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
10 2643221696 Nocardioides sp. Root140 Isolate Unclassified
11 2739367898 Nocardioides sp. CF479 Isolate Unclassified
12 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
13 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
14 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
15 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
16 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
17 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
18 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
19 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.01
Metatranscriptomes 0.24
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 9.5
Nodule 0.24
Rhizoplane 11.16
Rhizosphere 71.97
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010516 3300001979 Bacteria 3557
2 JGI24735J21928_10007506 3300002067 Bacteria 3555
3 JGI24738J21930_10006497 3300002075 Bacteria 2739
4 JGI24744J21845_10002088 3300002077 Bacteria 4053
5 JGI24033J26618_1000030 3300002155 Bacteria 21924
6 rootL2_10054183 3300003322 Bacteria 10345
7 Ga0070658_10037071 3300005327 Bacteria 3929
8 Ga0070658_10152987 3300005327 Bacteria 1932
9 Ga0070683_100025261 3300005329 Bacteria 5332
10 Ga0070683_100033150 3300005329 Bacteria 4707
11 Ga0070666_10022220 3300005335 Bacteria 4118
12 Ga0070682_100013870 3300005337 Bacteria 4646
13 Ga0068868_100013062 3300005338 Bacteria 6080
14 Ga0068868_100067290 3300005338 Bacteria 2851
15 Ga0070660_100013567 3300005339 Bacteria 5850
16 Ga0070660_100019261 3300005339 Bacteria 4997
17 Ga0070660_100041683 3300005339 Bacteria 3500
18 Ga0070660_100132290 3300005339 Bacteria 1997
19 Ga0070689_100093275 3300005340 Bacteria 2376
20 Ga0070661_100005788 3300005344 Bacteria 8500
21 Ga0070692_10008693 3300005345 Bacteria 4540
22 Ga0070671_100013845 3300005355 Bacteria 6508
23 Ga0070674_100014287 3300005356 Bacteria 4934
24 Ga0070659_100034250 3300005366 Bacteria 3949
25 Ga0070659_100114498 3300005366 Bacteria 2179
26 Ga0070667_100037532 3300005367 Bacteria 4062
27 Ga0070701_10004145 3300005438 Bacteria 5827
28 Ga0070700_100004157 3300005441 Bacteria 7549
29 Ga0070663_100095502 3300005455 Bacteria 2210
30 Ga0070678_100057367 3300005456 Bacteria 2853
31 Ga0070662_100053662 3300005457 Bacteria 2919
32 Ga0070681_10070667 3300005458 Bacteria 3456
33 Ga0068867_100006705 3300005459 Bacteria 8139
34 Ga0070685_10041411 3300005466 Bacteria 2624
35 Ga0070698_100007733 3300005471 Bacteria 11628
36 Ga0070684_100007783 3300005535 Bacteria 8356
37 Ga0070684_100097177 3300005535 Bacteria 2626
38 Ga0070672_100070796 3300005543 Bacteria 2772
39 Ga0070665_100001294 3300005548 Bacteria 29946
40 Ga0070665_100005753 3300005548 Bacteria 12729
41 Ga0070704_100063922 3300005549 Bacteria 2643
42 Ga0070664_100162083 3300005564 Bacteria 1979
43 Ga0068856_100036383 3300005614 Bacteria 4827
44 Ga0068852_100193460 3300005616 Bacteria 1921
45 Ga0068864_100081653 3300005618 Bacteria 2834
46 Ga0068861_100005486 3300005719 Bacteria 8596
47 Ga0068870_10040042 3300005840 Bacteria 2428
48 Ga0068863_100000345 3300005841 Bacteria 47228
49 Ga0068863_100149721 3300005841 Bacteria 2233
50 Ga0068858_100014587 3300005842 Bacteria 7404
51 Ga0068860_100000314 3300005843 Bacteria 66294
52 Ga0068860_100001869 3300005843 Bacteria 22379
53 Ga0081455_10000320 3300005937 Bacteria 62754
54 Ga0081455_10005139 3300005937 Bacteria 14424
55 Ga0081455_10017484 3300005937 Bacteria 6870
56 Ga0081538_10002044 3300005981 Bacteria 20138
57 Ga0075365_10003959 3300006038 Bacteria 7758
58 Ga0075365_10012903 3300006038 Bacteria 4980
59 Ga0075365_10067565 3300006038 Bacteria 2400
60 Ga0075365_10147715 3300006038 Bacteria 1634
61 Ga0075368_10002617 3300006042 Bacteria 5907
62 Ga0075368_10002657 3300006042 Bacteria 5880
63 Ga0075368_10006411 3300006042 Bacteria 4108
64 Ga0075363_100019161 3300006048 Bacteria 3418
65 Ga0075363_100065808 3300006048 Bacteria 1960
66 Ga0075363_100085429 3300006048 Bacteria 1731
67 Ga0075364_10053092 3300006051 Bacteria 2649
68 Ga0075364_10056395 3300006051 Bacteria 2572
69 Ga0075362_10029267 3300006177 Bacteria 2372
70 Ga0075367_10004951 3300006178 Bacteria 6566
71 Ga0075367_10006634 3300006178 Bacteria 5866
72 Ga0075370_10000996 3300006353 Bacteria 11704
73 Ga0075370_10006396 3300006353 Bacteria 5920
74 Ga0075370_10050335 3300006353 Bacteria 2363
75 Ga0075428_100081252 3300006844 Bacteria 3537
76 Ga0075431_100002893 3300006847 Bacteria 16604
77 Ga0068865_100008837 3300006881 Bacteria 6230
78 Ga0105240_10002027 3300009093 Bacteria 33415
79 Ga0105240_10035817 3300009093 Bacteria 6392
80 Ga0105245_10005158 3300009098 Bacteria 11479
81 Ga0105245_10011660 3300009098 Bacteria 7649
82 Ga0105245_10079612 3300009098 Bacteria 2992
83 Ga0105243_10029659 3300009148 Bacteria 4208
84 Ga0105248_10020354 3300009177 Bacteria 7351
85 Ga0105237_10016874 3300009545 Bacteria 7576
86 Ga0105249_10088341 3300009553 Bacteria 2895
87 Ga0105249_10099582 3300009553 Bacteria 2732
88 Ga0105249_10201181 3300009553 Bacteria 1949
89 Ga0105239_10015324 3300010375 Bacteria 8493
90 Ga0105239_10141247 3300010375 Bacteria 2683
91 Ga0105239_10194280 3300010375 Bacteria 2272
92 Ga0105246_10002220 3300011119 Bacteria 11718
93 Ga0157370_10182066 3300013104 Bacteria 1952
94 Ga0157374_10000510 3300013296 Bacteria 34983
95 Ga0157378_10005159 3300013297 Bacteria 11467
96 Ga0163162_10041146 3300013306 Bacteria 4623
97 Ga0163162_10080517 3300013306 Bacteria 3325
98 Ga0157372_10009899 3300013307 Bacteria 10139
99 Ga0157372_10032937 3300013307 Bacteria 5688
100 Ga0157372_10129879 3300013307 Bacteria 2898
101 Ga0157372_10145608 3300013307 Bacteria 2732
102 Ga0157375_10022376 3300013308 Bacteria 5819
103 Ga0157375_10090499 3300013308 Bacteria 3119
104 Ga0163163_10020256 3300014325 Bacteria 6261
105 Ga0163163_10165872 3300014325 Bacteria 2255
106 Ga0157380_10079146 3300014326 Bacteria 2684
107 Ga0157379_10026844 3300014968 Bacteria 5126
108 Ga0157379_10131156 3300014968 Bacteria 2256
109 Ga0157376_10000305 3300014969 Bacteria 32940
110 Ga0163161_10011458 3300017792 Bacteria 6151
111 Ga0163161_10039428 3300017792 Bacteria 3391
112 Ga0206353_11939095 3300020082 Bacteria 3077
113 Ga0207688_10018532 3300025901 Bacteria 3787
114 Ga0207688_10027215 3300025901 Bacteria 3145
115 Ga0207647_10007112 3300025904 Bacteria 8113
116 Ga0207647_10015524 3300025904 Bacteria 5217
117 Ga0207643_10003626 3300025908 Bacteria 8319
118 Ga0207705_10063910 3300025909 Bacteria 2659
119 Ga0207705_10125592 3300025909 Bacteria 1907
120 Ga0207707_10050766 3300025912 Bacteria 3612
121 Ga0207695_10007847 3300025913 Bacteria 13492
122 Ga0207671_10013151 3300025914 Bacteria 6610
123 Ga0207662_10067035 3300025918 Bacteria 2164
124 Ga0207657_10018970 3300025919 Bacteria 6546
125 Ga0207657_10052622 3300025919 Bacteria 3532
126 Ga0207657_10122201 3300025919 Bacteria 2142
127 Ga0207649_10001369 3300025920 Bacteria 14472
128 Ga0207652_10098466 3300025921 Bacteria 2579
129 Ga0207687_10012105 3300025927 Bacteria 5642
130 Ga0207687_10023732 3300025927 Bacteria 4091
131 Ga0207687_10036100 3300025927 Bacteria 3366
132 Ga0207664_10110207 3300025929 Bacteria 2288
133 Ga0207644_10022071 3300025931 Bacteria 4345
134 Ga0207690_10011827 3300025932 Bacteria 5219
135 Ga0207706_10067579 3300025933 Bacteria 3145
136 Ga0207706_10068968 3300025933 Bacteria 3110
137 Ga0207709_10042080 3300025935 Bacteria 2746
138 Ga0207704_10049972 3300025938 Bacteria 2520
139 Ga0207691_10028910 3300025940 Bacteria 5187
140 Ga0207661_10028422 3300025944 Bacteria 4282
141 Ga0207661_10038645 3300025944 Bacteria 3742
142 Ga0207640_10045777 3300025981 Bacteria 2812
143 Ga0207677_10057238 3300026023 Bacteria 2676
144 Ga0207677_10074454 3300026023 Bacteria 2409
145 Ga0207703_10007516 3300026035 Bacteria 8649
146 Ga0207678_10022311 3300026067 Bacteria 5546
147 Ga0207678_10089865 3300026067 Bacteria 2625
148 Ga0207708_10000436 3300026075 Bacteria 32496
149 Ga0207708_10006114 3300026075 Bacteria 8926
150 Ga0207702_10010611 3300026078 Bacteria 7699
151 Ga0207702_10016612 3300026078 Bacteria 6091
152 Ga0207641_10001310 3300026088 Bacteria 24597
153 Ga0207648_10013225 3300026089 Bacteria 7688
154 Ga0207648_10035799 3300026089 Bacteria 4374
155 Ga0207676_10064685 3300026095 Bacteria 2910
156 Ga0207674_10118342 3300026116 Bacteria 2619
157 Ga0207675_100007118 3300026118 Bacteria 10573
158 Ga0207675_100011102 3300026118 Bacteria 8439
159 Ga0207683_10078325 3300026121 Bacteria 2929
160 Ga0207698_10053469 3300026142 Bacteria 3100
161 Ga0209813_10004156 3300027866 Bacteria 3439
162 Ga0209813_10016406 3300027866 Bacteria 2021
163 Ga0207428_10037321 3300027907 Bacteria 3953
164 Ga0268266_10001059 3300028379 Bacteria 34495
165 Ga0268266_10001768 3300028379 Bacteria 24545
166 Ga0268264_10000097 3300028381 Bacteria 229722
167 Ga0268264_10007457 3300028381 Bacteria 9129
168 Ga0316181_1267313 3300030744 Bacteria 2470
169 Ga0316182_1204805 3300030745 Bacteria 2458
170 Ga0307408_100031444 3300031548 Bacteria 3696
171 Ga0316576_10022774 3300031727 Bacteria 4355
172 Ga0316576_10039043 3300031727 Bacteria 3407
173 Ga0316578_10028087 3300031728 Bacteria 3184
174 Ga0316578_10120389 3300031728 Bacteria 1578
175 Ga0307405_10009423 3300031731 Bacteria 5006
176 Ga0307405_10066670 3300031731 Bacteria 2296
177 Ga0307410_10005130 3300031852 Bacteria 6885
178 Ga0307410_10013516 3300031852 Bacteria 4766
179 Ga0307410_10070092 3300031852 Bacteria 2427
180 Ga0307410_10204015 3300031852 Bacteria 1511
181 Ga0307407_10012943 3300031903 Bacteria 4031
182 Ga0307409_100018483 3300031995 Bacteria 4689
183 Ga0307409_100018487 3300031995 Bacteria 4688
184 Ga0307409_100024717 3300031995 Bacteria 4196
185 Ga0307409_100154636 3300031995 Bacteria 1997
186 Ga0307416_100019808 3300032002 Bacteria 4781
187 Ga0307416_100114301 3300032002 Bacteria 2388
188 Ga0307416_100375127 3300032002 Bacteria 1450
189 Ga0307411_10063451 3300032005 Bacteria 2469
190 Ga0307415_100001428 3300032126 Bacteria 11416
191 Ga0307415_100009073 3300032126 Bacteria 5553
192 Ga0307415_100023069 3300032126 Bacteria 3855
193 Ga0307415_100037680 3300032126 Bacteria 3180
194 Ga0373926_0026942 3300035083 Bacteria 2013
195 Ga0316574_0083450 3300035398 Bacteria 2031
196 Ga0373935_0041969 3300035692 Bacteria 2875
197 Ga0316584_0001249 3300036712 Bacteria 15028
198 Ga0316584_0016360 3300036712 Bacteria 5317
199 Ga0373925_0004609 3300037068 Bacteria 10409
200 Ga0395898_0039355 3300037466 Bacteria 4680
201 Ga0395901_0208269 3300038443 Bacteria 2047
202 Ga0439465_0013421 3300041413 Bacteria 2555
203 Ga0451793_0745271 3300041452 Bacteria 5269
204 Ga0451797_0707486 3300041453 Bacteria 3257
205 Ga0451833_1210650 3300041491 Bacteria 33012
206 Ga0451837_0123676 3300041494 Bacteria 3407
207 Ga0451843_0064469 3300041509 Bacteria 5020
208 Ga0466972_0018650 3300044658 Bacteria 3469
209 Ga0466972_0063329 3300044658 Bacteria 1771
210 Ga0466965_0012703 3300044683 Bacteria 3966
211 Ga0466965_0015970 3300044683 Bacteria 3568
212 Ga0466965_0048266 3300044683 Bacteria 2109
213 Ga0466966_0030383 3300044684 Bacteria 3508
214 Ga0466966_0036352 3300044684 Bacteria 3180
215 Ga0466961_0032815 3300044693 Bacteria 3336
216 Ga0466961_0052275 3300044693 Bacteria 2607
217 Ga0466963_0031333 3300044694 Bacteria 3437
218 Ga0466963_0074585 3300044694 Bacteria 2288
219 Ga0466963_0086536 3300044694 Bacteria 2130
220 Ga0466964_0008678 3300044706 Bacteria 3821
221 Ga0466964_0057635 3300044706 Bacteria 1608
222 Ga0466970_0011729 3300044765 Bacteria 4470
223 Ga0466970_0037153 3300044765 Bacteria 2581
224 Ga0466957_0080676 3300044842 Bacteria 2026
225 Ga0466957_0082140 3300044842 Bacteria 2008
226 Ga0466960_0005340 3300044901 Bacteria 5083
227 Ga0466960_0009006 3300044901 Bacteria 4104
228 Ga0466960_0009869 3300044901 Bacteria 3947
229 Ga0466960_0053401 3300044901 Bacteria 1958
230 Ga0466958_0032754 3300045836 Bacteria 3093
231 Ga0466958_0071242 3300045836 Bacteria 2128
232 Ga0466958_0118815 3300045836 Bacteria 1654
233 Ga0466967_0030259 3300045976 Bacteria 4542
234 Ga0466967_0049571 3300045976 Bacteria 3672
235 Ga0466967_0070249 3300045976 Bacteria 3132
236 Ga0466967_0192597 3300045976 Bacteria 1928
237 Ga0495664_0115778 3300046477 Bacteria 1620
238 Ga0495665_0054289 3300046531 Bacteria 2117
239 Ga0495586_0073698 3300046535 Bacteria 1868
240 Ga0495581_0034756 3300047315 Bacteria 2917
241 Ga0495680_0139903 3300047322 Bacteria 1772
242 Ga0496101_0050926 3300048904 Bacteria 2982
243 Ga0496101_0090841 3300048904 Bacteria 2272
244 Ga0496102_0006399 3300048905 Bacteria 10041
245 Ga0496102_0033422 3300048905 Bacteria 4622
246 Ga0496103_0104739 3300048906 Bacteria 1793
247 Ga0496104_0001342 3300048907 Bacteria 21301
248 Ga0496104_0169091 3300048907 Bacteria 2096
249 Ga0496105_0000943 3300048908 Bacteria 19878
250 Ga0496105_0036759 3300048908 Bacteria 4035
251 Ga0496105_0111833 3300048908 Bacteria 2254
252 Ga0496106_0023086 3300048909 Bacteria 4620
253 Ga0496106_0038616 3300048909 Bacteria 3574
254 Ga0496106_0045510 3300048909 Bacteria 3296
255 Ga0496106_0111913 3300048909 Bacteria 2127
256 Ga0496107_0090248 3300048910 Bacteria 2238
257 Ga0496108_0000623 3300048911 Bacteria 27762
258 Ga0496108_0055561 3300048911 Bacteria 3325
259 Ga0496108_0154978 3300048911 Bacteria 1978
260 Ga0496108_0163245 3300048911 Bacteria 1926
261 Ga0496108_0193607 3300048911 Bacteria 1763
262 Ga0496109_0010470 3300048912 Bacteria 7924
263 Ga0496109_0032232 3300048912 Bacteria 4710
264 Ga0496109_0040746 3300048912 Bacteria 4207
265 Ga0496109_0041435 3300048912 Bacteria 4171
266 Ga0496109_0042483 3300048912 Bacteria 4118
267 Ga0496109_0067225 3300048912 Bacteria 3283
268 Ga0496109_0109435 3300048912 Bacteria 2568
269 Ga0496109_0111662 3300048912 Bacteria 2542
270 Ga0496111_0000994 3300048914 Bacteria 15537
271 Ga0496111_0013490 3300048914 Bacteria 5563
272 Ga0496111_0053799 3300048914 Bacteria 2909
273 Ga0496111_0054894 3300048914 Bacteria 2881
274 Ga0496111_0167154 3300048914 Bacteria 1634
275 Ga0496113_0090336 3300048916 Bacteria 2359
276 Ga0496114_0007308 3300048917 Bacteria 8726
277 Ga0496114_0019334 3300048917 Bacteria 5519
278 Ga0496114_0019342 3300048917 Bacteria 5517
279 Ga0496114_0075541 3300048917 Bacteria 2838
280 Ga0496114_0116348 3300048917 Bacteria 2295
281 Ga0496114_0118867 3300048917 Bacteria 2271
282 Ga0496114_0162224 3300048917 Bacteria 1944
283 Ga0496114_0171829 3300048917 Bacteria 1889
284 Ga0496115_0024531 3300048918 Bacteria 4689
285 Ga0496115_0055118 3300048918 Bacteria 3193
286 Ga0496115_0071321 3300048918 Bacteria 2817
287 Ga0496121_0026211 3300048924 Bacteria 5502
288 Ga0496122_0000098 3300048925 Bacteria 198547
289 Ga0496123_0000420 3300048926 Bacteria 77105
290 Ga0496124_0000179 3300048927 Bacteria 125772
291 Ga0496125_0000480 3300048928 Bacteria 70815
292 Ga0496126_0000026 3300048929 Bacteria 422310
293 Ga0496126_0032757 3300048929 Bacteria 4893
294 Ga0501031_0004544 3300049568 Bacteria 8996
295 Ga0501031_0023779 3300049568 Bacteria 3994
296 Ga0501032_0000222 3300049569 Bacteria 47180
297 Ga0501032_0007594 3300049569 Bacteria 7913
298 Ga0501033_0000001 3300049570 Bacteria 795921
299 Ga0501033_0007864 3300049570 Bacteria 8262
300 Ga0501033_0048562 3300049570 Bacteria 3152
301 Ga0501034_0006864 3300049571 Bacteria 12176
302 Ga0501034_0177311 3300049571 Bacteria 2097
303 Ga0501034_0328788 3300049571 Bacteria 1460
304 Ga0501036_0015193 3300049572 Bacteria 6429
305 Ga0501036_0073285 3300049572 Bacteria 2895
306 Ga0501036_0134448 3300049572 Bacteria 2087
307 Ga0501037_0004316 3300049573 Bacteria 10312
308 Ga0501037_0023504 3300049573 Bacteria 4558
309 Ga0501038_0009746 3300049574 Bacteria 8807
310 Ga0501038_0015953 3300049574 Bacteria 6827
311 Ga0501038_0019445 3300049574 Bacteria 6121
312 Ga0501039_0001126 3300049575 Bacteria 19670
313 Ga0501040_0021700 3300049576 Bacteria 4292
314 Ga0501042_0003218 3300049578 Bacteria 10204
315 Ga0501042_0006510 3300049578 Bacteria 7587
316 Ga0501042_0009337 3300049578 Bacteria 6533
317 Ga0501042_0018294 3300049578 Bacteria 4849
318 Ga0501043_0008473 3300049579 Bacteria 8093
319 Ga0501043_0153084 3300049579 Bacteria 1804
320 Ga0501046_0000508 3300049580 Bacteria 38646
321 Ga0501046_0037754 3300049580 Bacteria 3880
322 Ga0501046_0040256 3300049580 Bacteria 3736
323 Ga0501047_0014569 3300049581 Bacteria 7480
324 Ga0501047_0095206 3300049581 Bacteria 2856
325 Ga0501048_0001793 3300049582 Bacteria 16318
326 Ga0501048_0036566 3300049582 Bacteria 3529
327 Ga0501048_0042764 3300049582 Bacteria 3243
328 Ga0501048_0105409 3300049582 Bacteria 1990
329 Ga0501067_0000956 3300049583 Bacteria 15478
330 Ga0501067_0015872 3300049583 Bacteria 4166
331 Ga0501067_0028434 3300049583 Bacteria 3097
332 Ga0501067_0028697 3300049583 Bacteria 3083
333 Ga0501067_0035204 3300049583 Bacteria 2780
334 Ga0501068_0029323 3300049584 Bacteria 3257
335 Ga0501068_0042046 3300049584 Bacteria 2748
336 Ga0501069_0018119 3300049585 Bacteria 3799
337 Ga0501069_0085645 3300049585 Bacteria 1778
338 Ga0501069_0150183 3300049585 Bacteria 1339
339 Ga0501070_0003521 3300049586 Bacteria 13544
340 Ga0501070_0018991 3300049586 Bacteria 5765
341 Ga0501070_0052721 3300049586 Bacteria 3376
342 Ga0501070_0061294 3300049586 Bacteria 3117
343 Ga0501070_0126952 3300049586 Bacteria 2108
344 Ga0501071_0006177 3300049587 Bacteria 7767
345 Ga0501071_0177493 3300049587 Bacteria 1595
346 Ga0501072_0001497 3300049588 Bacteria 17492
347 Ga0501072_0004451 3300049588 Bacteria 10643
348 Ga0501072_0021324 3300049588 Bacteria 5025
349 Ga0501072_0031915 3300049588 Bacteria 4123
350 Ga0501074_0003804 3300049590 Bacteria 10731
351 Ga0501074_0004962 3300049590 Bacteria 9537
352 Ga0501074_0029037 3300049590 Bacteria 4006
353 Ga0501074_0057723 3300049590 Bacteria 2796
354 Ga0501075_0091317 3300049591 Bacteria 2311
355 Ga0501076_0012633 3300049592 Bacteria 6319
356 Ga0501077_0030577 3300049593 Bacteria 3426
357 Ga0501079_0017553 3300049741 Bacteria 5465
358 Ga0501079_0111841 3300049741 Bacteria 2122
359 Ga0501080_0004244 3300049742 Bacteria 12714
360 Ga0501080_0007872 3300049742 Bacteria 9645
361 Ga0501080_0058924 3300049742 Bacteria 3574
362 Ga0501080_0062550 3300049742 Bacteria 3464
363 Ga0501080_0083049 3300049742 Bacteria 2976
364 Ga0501080_0187635 3300049742 Bacteria 1901
365 Ga0501081_0016795 3300049743 Bacteria 4840
366 Ga0501081_0077282 3300049743 Bacteria 2326
367 Ga0501081_0191325 3300049743 Bacteria 1482
368 Ga0501083_0001725 3300049744 Bacteria 14895
369 Ga0501035_0005416 3300049822 Bacteria 12065
370 Ga0501035_0072054 3300049822 Bacteria 3059
371 Ga0501035_0154605 3300049822 Bacteria 1988
372 Ga0501044_0057316 3300049823 Bacteria 3998
373 Ga0501045_0052475 3300049824 Bacteria 2977
374 nmdc:mga03n38_18097_c1 3300050490 Bacteria 2775
375 nmdc:mga03n38_4704_c1 3300050490 Bacteria 4558
376 nmdc:mga00v17_30468_c1 3300050491 Bacteria 3175
377 nmdc:mga0yw44_106773_c1 3300050492 Bacteria 1790
378 nmdc:mga0yw44_137120_c1 3300050492 Bacteria 1588
379 nmdc:mga0yw44_14501_c1 3300050492 Bacteria 4187
380 nmdc:mga0yw44_156042_c1 3300050492 Bacteria 1492
381 nmdc:mga0yw44_41042_c1 3300050492 Bacteria 2753
382 nmdc:mga0yw44_50150_c1 3300050492 Bacteria 2523
383 nmdc:mga0yw44_57526_c1 3300050492 Bacteria 2372
384 nmdc:mga0yw44_71988_c1 3300050492 Bacteria 2147
385 nmdc:mga0yw44_73021_c1 3300050492 Bacteria 2134
386 nmdc:mga06z11_779_c1 3300050494 Bacteria 11626
387 nmdc:mga04h51_20204_c1 3300050495 Bacteria 1984
388 nmdc:mga04h51_3378_c1 3300050495 Bacteria 3878
389 nmdc:mga07m45_33464_c1 3300050496 Bacteria 2854
390 nmdc:mga06r32_27273_c1 3300050510 Bacteria 5334
391 nmdc:mga08y16_200207_c1 3300050511 Bacteria 2070
392 Ga0495619_0116550 3300053085 Bacteria 1829
393 Ga0500644_0000003 3300053088 Bacteria 199121
394 Ga0500556_0000390 3300053104 Bacteria 32128
395 Ga0500593_000321 3300053117 Bacteria 19315
396 Ga0500573_0016030 3300053140 Bacteria 4251
397 Ga0501084_0236132 3300054114 Bacteria 1543
398 Ga0501082_0012545 3300060353 Bacteria 7281
399 Ga0501082_0024280 3300060353 Bacteria 5226
400 Ga0501082_0039627 3300060353 Bacteria 4064
401 Ga0466962_0011037 3300061719 Bacteria 4349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0024280 Ga0501082_0024280_4064_5200 343
2 3300035692 Ga0373935_0041969 Ga0373935_0041969_1700_2845 350
3 3300048924 Ga0496121_0026211 Ga0496121_0026211_4350_5477 350
4 3300049585 Ga0501069_0150183 Ga0501069_0150183_20_1180 357
5 3300049743 Ga0501081_0191325 Ga0501081_0191325_338_1471 358
6 3300049569 Ga0501032_0000222 Ga0501032_0000222_11388_12710 371
7 3300049570 Ga0501033_0000001 Ga0501033_0000001_167481_168803 371
8 3300048904 Ga0496101_0050926 Ga0496101_0050926_26_1252 377
9 3300002077 JGI24744J21845_10002088 JGI24744J21845_100020882 378
10 3300049742 Ga0501080_0187635 Ga0501080_0187635_38_1255 387
11 3300049578 Ga0501042_0018294 Ga0501042_0018294_323_1675 392
12 3300049588 Ga0501072_0021324 Ga0501072_0021324_3461_4813 392
13 3300049743 Ga0501081_0077282 Ga0501081_0077282_344_1696 392
14 3300048929 Ga0496126_0000026 Ga0496126_0000026_232859_234214 393
15 3300049582 Ga0501048_0105409 Ga0501048_0105409_23_1270 395
16 3300044842 Ga0466957_0082140 Ga0466957_0082140_722_1990 402
17 3300050492 nmdc:mga0yw44_73021_c1 nmdc:mga0yw44_73021_c1_36_1301 402
18 3300005339 Ga0070660_100013567 Ga0070660_1000135672 410
19 3300005366 Ga0070659_100034250 Ga0070659_1000342504 410
20 3300025904 Ga0207647_10015524 Ga0207647_100155242 410
21 3300025919 Ga0207657_10018970 Ga0207657_100189703 410
22 3300025932 Ga0207690_10011827 Ga0207690_100118272 410
23 3300049743 Ga0501081_0016795 Ga0501081_0016795_659_2017 412
24 3300050492 nmdc:mga0yw44_14501_c1 nmdc:mga0yw44_14501_c1_612_1952 412
25 3300005327 Ga0070658_10037071 Ga0070658_100370714 413
26 3300005339 Ga0070660_100041683 Ga0070660_1000416833 413
27 3300005535 Ga0070684_100007783 Ga0070684_10000778310 413
28 3300005616 Ga0068852_100193460 Ga0068852_1001934602 413
29 3300005618 Ga0068864_100081653 Ga0068864_1000816532 413
30 3300005841 Ga0068863_100149721 Ga0068863_1001497212 413
31 3300006881 Ga0068865_100008837 Ga0068865_1000088377 413
32 3300017792 Ga0163161_10011458 Ga0163161_100114583 413
33 3300025901 Ga0207688_10027215 Ga0207688_100272152 413
34 3300025909 Ga0207705_10063910 Ga0207705_100639102 413
35 3300025919 Ga0207657_10052622 Ga0207657_100526223 413
36 3300025927 Ga0207687_10012105 Ga0207687_100121053 413
37 3300025944 Ga0207661_10028422 Ga0207661_100284224 413
38 3300026067 Ga0207678_10089865 Ga0207678_100898653 413
39 3300026078 Ga0207702_10016612 Ga0207702_100166123 413
40 3300026089 Ga0207648_10035799 Ga0207648_100357993 413
41 3300026095 Ga0207676_10064685 Ga0207676_100646852 413
42 3300026116 Ga0207674_10118342 Ga0207674_101183423 413
43 3300049823 Ga0501044_0057316 Ga0501044_0057316_2060_3427 413
44 3300002155 JGI24033J26618_1000030 JGI24033J26618_100003021 414
45 3300005344 Ga0070661_100005788 Ga0070661_1000057883 414
46 3300025920 Ga0207649_10001369 Ga0207649_1000136912 414
47 3300044683 Ga0466965_0048266 Ga0466965_0048266_625_2034 414
48 3300049570 Ga0501033_0048562 Ga0501033_0048562_1513_2865 414
49 3300049587 Ga0501071_0177493 Ga0501071_0177493_111_1463 414
50 3300049590 Ga0501074_0029037 Ga0501074_0029037_2469_3821 414
51 3300049592 Ga0501076_0012633 Ga0501076_0012633_656_2008 414
52 3300049741 Ga0501079_0111841 Ga0501079_0111841_242_1594 414
53 3300031548 Ga0307408_100031444 Ga0307408_1000314442 415
54 3300031903 Ga0307407_10012943 Ga0307407_100129433 415
55 3300049571 Ga0501034_0006864 Ga0501034_0006864_4447_5787 415
56 3300049571 Ga0501034_0328788 Ga0501034_0328788_73_1413 415
57 3300049584 Ga0501068_0029323 Ga0501068_0029323_1350_2690 415
58 3300049585 Ga0501069_0085645 Ga0501069_0085645_119_1459 415
59 3300049586 Ga0501070_0018991 Ga0501070_0018991_3015_4355 415
60 3300049587 Ga0501071_0006177 Ga0501071_0006177_4759_6099 415
61 3300049588 Ga0501072_0001497 Ga0501072_0001497_14303_15643 415
62 3300049590 Ga0501074_0004962 Ga0501074_0004962_2464_3804 415
63 3300049593 Ga0501077_0030577 Ga0501077_0030577_442_1782 415
64 3300049741 Ga0501079_0017553 Ga0501079_0017553_3788_5128 415
65 3300049742 Ga0501080_0004244 Ga0501080_0004244_990_2330 415
66 3300049742 Ga0501080_0007872 Ga0501080_0007872_8061_9401 415
67 3300054114 Ga0501084_0236132 Ga0501084_0236132_133_1473 415
68 3300060353 Ga0501082_0039627 Ga0501082_0039627_2383_3723 415
69 3300031731 Ga0307405_10066670 Ga0307405_100666701 416
70 3300037466 Ga0395898_0039355 Ga0395898_0039355_967_2316 417
71 3300038443 Ga0395901_0208269 Ga0395901_0208269_475_1824 417
72 3300046477 Ga0495664_0115778 Ga0495664_0115778_10_1359 417
73 3300005457 Ga0070662_100053662 Ga0070662_1000536621 418
74 3300025933 Ga0207706_10068968 Ga0207706_100689683 418
75 3300045836 Ga0466958_0032754 Ga0466958_0032754_389_1738 419
76 3300005937 Ga0081455_10005139 Ga0081455_1000513911 420
77 3300013306 Ga0163162_10080517 Ga0163162_100805173 420
78 3300048911 Ga0496108_0055561 Ga0496108_0055561_1761_3119 420
79 3300048914 Ga0496111_0167154 Ga0496111_0167154_244_1602 420
80 3300025913 Ga0207695_10007847 Ga0207695_100078473 421
81 3300046535 Ga0495586_0073698 Ga0495586_0073698_412_1773 421
82 3300003322 rootL2_10054183 rootL2_100541839 422
83 3300005937 Ga0081455_10000320 Ga0081455_1000032042 422
84 3300032002 Ga0307416_100375127 Ga0307416_1003751271 422
85 3300013297 Ga0157378_10005159 Ga0157378_100051592 423
86 3300014325 Ga0163163_10165872 Ga0163163_101658722 424
87 3300030745 Ga0316182_1204805 Ga0316182_12048052 424
88 3300041413 Ga0439465_0013421 Ga0439465_0013421_876_2273 424
89 3300048908 Ga0496105_0111833 Ga0496105_0111833_606_1985 424
90 3300048918 Ga0496115_0024531 Ga0496115_0024531_2878_4257 424
91 3300049568 Ga0501031_0023779 Ga0501031_0023779_566_1960 424
92 3300049572 Ga0501036_0073285 Ga0501036_0073285_615_2009 424
93 3300049574 Ga0501038_0015953 Ga0501038_0015953_1640_3034 424
94 3300049578 Ga0501042_0003218 Ga0501042_0003218_3645_5039 424
95 3300049588 Ga0501072_0031915 Ga0501072_0031915_2094_3488 424
96 3300049742 Ga0501080_0058924 Ga0501080_0058924_27_1421 424
97 3300049822 Ga0501035_0072054 Ga0501035_0072054_147_1541 424
98 3300049824 Ga0501045_0052475 Ga0501045_0052475_669_2063 424
99 3300009098 Ga0105245_10005158 Ga0105245_100051589 425
100 3300009553 Ga0105249_10088341 Ga0105249_100883412 425
101 3300011119 Ga0105246_10002220 Ga0105246_1000222015 425
102 3300013306 Ga0163162_10041146 Ga0163162_100411462 425
103 3300013307 Ga0157372_10009899 Ga0157372_1000989910 425
104 3300013308 Ga0157375_10022376 Ga0157375_100223762 425
105 3300014968 Ga0157379_10026844 Ga0157379_100268445 425
106 3300031995 Ga0307409_100018483 Ga0307409_1000184832 425
107 3300044684 Ga0466966_0030383 Ga0466966_0030383_1222_2598 425
108 3300045976 Ga0466967_0030259 Ga0466967_0030259_2607_4037 425
109 3300048905 Ga0496102_0033422 Ga0496102_0033422_2540_3916 425
110 3300048914 Ga0496111_0013490 Ga0496111_0013490_3832_5208 425
111 3300048916 Ga0496113_0090336 Ga0496113_0090336_736_2115 425
112 3300049586 Ga0501070_0061294 Ga0501070_0061294_1301_2677 425
113 iso_pu_bacteria 2643221615 2644094083 425
114 iso_pu_bacteria 2643221657 2644323926 425
115 3300009093 Ga0105240_10035817 Ga0105240_100358173 426
116 3300009545 Ga0105237_10016874 Ga0105237_100168747 426
117 3300010375 Ga0105239_10015324 Ga0105239_100153247 426
118 3300044684 Ga0466966_0036352 Ga0466966_0036352_65_1465 426
119 3300044693 Ga0466961_0032815 Ga0466961_0032815_1360_2760 426
120 3300044694 Ga0466963_0086536 Ga0466963_0086536_335_1735 426
121 3300045836 Ga0466958_0071242 Ga0466958_0071242_372_1772 426
122 3300045976 Ga0466967_0049571 Ga0466967_0049571_1422_2822 426
123 3300048929 Ga0496126_0032757 Ga0496126_0032757_2384_3733 426
124 3300049588 Ga0501072_0004451 Ga0501072_0004451_4450_5826 426
125 3300061719 Ga0466962_0011037 Ga0466962_0011037_455_1855 426
126 3300005339 Ga0070660_100019261 Ga0070660_1000192613 427
127 3300009553 Ga0105249_10099582 Ga0105249_100995823 427
128 3300010375 Ga0105239_10194280 Ga0105239_101942801 427
129 3300025919 Ga0207657_10122201 Ga0207657_101222012 427
130 3300031727 Ga0316576_10022774 Ga0316576_100227743 427
131 3300031728 Ga0316578_10028087 Ga0316578_100280873 427
132 3300031852 Ga0307410_10070092 Ga0307410_100700922 427
133 3300032005 Ga0307411_10063451 Ga0307411_100634512 427
134 3300036712 Ga0316584_0001249 Ga0316584_0001249_1273_2673 427
135 3300044765 Ga0466970_0037153 Ga0466970_0037153_1110_2495 427
136 3300045836 Ga0466958_0118815 Ga0466958_0118815_33_1379 427
137 3300049583 Ga0501067_0000956 Ga0501067_0000956_13701_15077 427
138 3300049590 Ga0501074_0003804 Ga0501074_0003804_3753_5129 427
139 3300049744 Ga0501083_0001725 Ga0501083_0001725_5411_6787 427
140 iso_pu_bacteria 2891968417 2891973141 427
141 3300013308 Ga0157375_10090499 Ga0157375_100904993 428
142 3300020082 Ga0206353_11939095 Ga0206353_119390952 428
143 3300048904 Ga0496101_0090841 Ga0496101_0090841_190_1560 428
144 3300048906 Ga0496103_0104739 Ga0496103_0104739_86_1456 428
145 3300048907 Ga0496104_0169091 Ga0496104_0169091_24_1403 428
146 3300048908 Ga0496105_0036759 Ga0496105_0036759_1289_2668 428
147 3300048909 Ga0496106_0023086 Ga0496106_0023086_2184_3554 428
148 3300048910 Ga0496107_0090248 Ga0496107_0090248_43_1422 428
149 3300048912 Ga0496109_0010470 Ga0496109_0010470_5142_6521 428
150 3300048912 Ga0496109_0109435 Ga0496109_0109435_76_1446 428
151 3300048917 Ga0496114_0075541 Ga0496114_0075541_1345_2724 428
152 3300048917 Ga0496114_0171829 Ga0496114_0171829_66_1445 428
153 3300048918 Ga0496115_0071321 Ga0496115_0071321_242_1621 428
154 3300049582 Ga0501048_0042764 Ga0501048_0042764_1558_2955 428
155 3300049583 Ga0501067_0015872 Ga0501067_0015872_1344_2714 428
156 3300049585 Ga0501069_0018119 Ga0501069_0018119_2242_3612 428
157 3300050492 nmdc:mga0yw44_41042_c1 nmdc:mga0yw44_41042_c1_831_2171 428
158 3300060353 Ga0501082_0012545 Ga0501082_0012545_5208_6554 428
159 3300005329 Ga0070683_100025261 Ga0070683_1000252615 429
160 3300005471 Ga0070698_100007733 Ga0070698_1000077336 429
161 3300006038 Ga0075365_10147715 Ga0075365_101477152 429
162 3300031852 Ga0307410_10204015 Ga0307410_102040151 429
163 3300031995 Ga0307409_100018487 Ga0307409_1000184874 429
164 3300032126 Ga0307415_100001428 Ga0307415_1000014286 429
165 3300032126 Ga0307415_100023069 Ga0307415_1000230693 429
166 3300044683 Ga0466965_0012703 Ga0466965_0012703_541_1887 429
167 3300045976 Ga0466967_0070249 Ga0466967_0070249_881_2221 429
168 3300046531 Ga0495665_0054289 Ga0495665_0054289_23_1408 429
169 3300048905 Ga0496102_0006399 Ga0496102_0006399_7125_8510 429
170 3300048907 Ga0496104_0001342 Ga0496104_0001342_9799_11184 429
171 3300048908 Ga0496105_0000943 Ga0496105_0000943_16786_18171 429
172 3300048911 Ga0496108_0000623 Ga0496108_0000623_10761_12146 429
173 3300048912 Ga0496109_0111662 Ga0496109_0111662_674_2059 429
174 3300048914 Ga0496111_0000994 Ga0496111_0000994_7700_9085 429
175 3300048917 Ga0496114_0007308 Ga0496114_0007308_6786_8171 429
176 3300048917 Ga0496114_0162224 Ga0496114_0162224_362_1747 429
177 3300049573 Ga0501037_0023504 Ga0501037_0023504_712_2070 429
178 3300049574 Ga0501038_0009746 Ga0501038_0009746_3419_4777 429
179 3300049578 Ga0501042_0006510 Ga0501042_0006510_1910_3268 429
180 3300049580 Ga0501046_0040256 Ga0501046_0040256_1175_2533 429
181 3300049581 Ga0501047_0014569 Ga0501047_0014569_2018_3376 429
182 3300049822 Ga0501035_0005416 Ga0501035_0005416_3886_5244 429
183 3300050490 nmdc:mga03n38_18097_c1 nmdc:mga03n38_18097_c1_1233_2579 429
184 3300050494 nmdc:mga06z11_779_c1 nmdc:mga06z11_779_c1_3576_4922 429
185 3300050495 nmdc:mga04h51_3378_c1 nmdc:mga04h51_3378_c1_719_2065 429
186 3300053104 Ga0500556_0000390 Ga0500556_0000390_4875_6227 429
187 3300006038 Ga0075365_10067565 Ga0075365_100675652 430
188 3300006844 Ga0075428_100081252 Ga0075428_1000812522 430
189 3300027907 Ga0207428_10037321 Ga0207428_100373214 430
190 3300047322 Ga0495680_0139903 Ga0495680_0139903_227_1606 430
191 3300050511 nmdc:mga08y16_200207_c1 nmdc:mga08y16_200207_c1_464_1858 430
192 3300053085 Ga0495619_0116550 Ga0495619_0116550_297_1676 430
193 3300005335 Ga0070666_10022220 Ga0070666_100222202 431
194 3300005355 Ga0070671_100013845 Ga0070671_1000138452 431
195 3300005548 Ga0070665_100005753 Ga0070665_1000057536 431
196 3300005841 Ga0068863_100000345 Ga0068863_10000034541 431
197 3300005842 Ga0068858_100014587 Ga0068858_1000145874 431
198 3300005843 Ga0068860_100001869 Ga0068860_1000018698 431
199 3300009553 Ga0105249_10201181 Ga0105249_102011811 431
200 3300013296 Ga0157374_10000510 Ga0157374_100005103 431
201 3300014969 Ga0157376_10000305 Ga0157376_100003052 431
202 3300025931 Ga0207644_10022071 Ga0207644_100220712 431
203 3300026035 Ga0207703_10007516 Ga0207703_100075166 431
204 3300026088 Ga0207641_10001310 Ga0207641_1000131017 431
205 3300028379 Ga0268266_10001768 Ga0268266_100017685 431
206 3300028381 Ga0268264_10000097 Ga0268264_100000978 431
207 3300005466 Ga0070685_10041411 Ga0070685_100414112 432
208 3300005549 Ga0070704_100063922 Ga0070704_1000639222 432
209 3300009098 Ga0105245_10079612 Ga0105245_100796123 432
210 3300009148 Ga0105243_10029659 Ga0105243_100296594 432
211 3300014968 Ga0157379_10131156 Ga0157379_101311561 432
212 3300025927 Ga0207687_10036100 Ga0207687_100361002 432
213 3300026023 Ga0207677_10074454 Ga0207677_100744542 432
214 3300026089 Ga0207648_10013225 Ga0207648_1001322510 432
215 3300031995 Ga0307409_100154636 Ga0307409_1001546361 432
216 3300048909 Ga0496106_0038616 Ga0496106_0038616_1269_2630 432
217 3300048912 Ga0496109_0032232 Ga0496109_0032232_2696_4084 432
218 3300048917 Ga0496114_0019334 Ga0496114_0019334_270_1658 432
219 3300053088 Ga0500644_0000003 Ga0500644_0000003_111088_112473 432
220 3300005338 Ga0068868_100013062 Ga0068868_1000130626 433
221 3300009093 Ga0105240_10002027 Ga0105240_1000202713 433
222 3300025981 Ga0207640_10045777 Ga0207640_100457771 433
223 3300035083 Ga0373926_0026942 Ga0373926_0026942_115_1518 433
224 3300037068 Ga0373925_0004609 Ga0373925_0004609_133_1536 433
225 3300041491 Ga0451833_1210650 Ga0451833_1210650_3793_5160 433
226 3300044693 Ga0466961_0052275 Ga0466961_0052275_472_1848 433
227 3300044694 Ga0466963_0031333 Ga0466963_0031333_1369_2745 433
228 3300044706 Ga0466964_0057635 Ga0466964_0057635_42_1418 433
229 3300014325 Ga0163163_10020256 Ga0163163_100202562 434
230 3300031852 Ga0307410_10013516 Ga0307410_100135161 434
231 3300032126 Ga0307415_100009073 Ga0307415_1000090735 434
232 3300013307 Ga0157372_10032937 Ga0157372_100329373 435
233 3300013307 Ga0157372_10145608 Ga0157372_101456082 435
234 3300048911 Ga0496108_0193607 Ga0496108_0193607_220_1605 435
235 3300048917 Ga0496114_0019342 Ga0496114_0019342_3191_4576 435
236 3300049583 Ga0501067_0028434 Ga0501067_0028434_1650_3053 435
237 3300002075 JGI24738J21930_10006497 JGI24738J21930_100064972 436
238 3300005329 Ga0070683_100033150 Ga0070683_1000331503 436
239 3300005337 Ga0070682_100013870 Ga0070682_1000138703 436
240 3300005338 Ga0068868_100067290 Ga0068868_1000672902 436
241 3300005340 Ga0070689_100093275 Ga0070689_1000932752 436
242 3300005345 Ga0070692_10008693 Ga0070692_100086933 436
243 3300005356 Ga0070674_100014287 Ga0070674_1000142873 436
244 3300005366 Ga0070659_100114498 Ga0070659_1001144982 436
245 3300005438 Ga0070701_10004145 Ga0070701_100041456 436
246 3300005441 Ga0070700_100004157 Ga0070700_1000041572 436
247 3300005459 Ga0068867_100006705 Ga0068867_1000067053 436
248 3300005543 Ga0070672_100070796 Ga0070672_1000707962 436
249 3300005719 Ga0068861_100005486 Ga0068861_1000054865 436
250 3300005840 Ga0068870_10040042 Ga0068870_100400423 436
251 3300009098 Ga0105245_10011660 Ga0105245_100116604 436
252 3300009177 Ga0105248_10020354 Ga0105248_1002035410 436
253 3300010375 Ga0105239_10141247 Ga0105239_101412472 436
254 3300013104 Ga0157370_10182066 Ga0157370_101820661 436
255 3300014326 Ga0157380_10079146 Ga0157380_100791462 436
256 3300025901 Ga0207688_10018532 Ga0207688_100185323 436
257 3300025908 Ga0207643_10003626 Ga0207643_100036268 436
258 3300025918 Ga0207662_10067035 Ga0207662_100670352 436
259 3300025927 Ga0207687_10023732 Ga0207687_100237323 436
260 3300025935 Ga0207709_10042080 Ga0207709_100420802 436
261 3300025938 Ga0207704_10049972 Ga0207704_100499722 436
262 3300025940 Ga0207691_10028910 Ga0207691_100289103 436
263 3300026023 Ga0207677_10057238 Ga0207677_100572382 436
264 3300026075 Ga0207708_10000436 Ga0207708_1000043617 436
265 3300026118 Ga0207675_100011102 Ga0207675_1000111029 436
266 3300026142 Ga0207698_10053469 Ga0207698_100534692 436
267 3300048912 Ga0496109_0041435 Ga0496109_0041435_293_1765 436
268 3300048917 Ga0496114_0116348 Ga0496114_0116348_165_1637 436
269 3300049568 Ga0501031_0004544 Ga0501031_0004544_3825_5219 436
270 3300049573 Ga0501037_0004316 Ga0501037_0004316_7734_9128 436
271 3300049574 Ga0501038_0019445 Ga0501038_0019445_4309_5703 436
272 3300049578 Ga0501042_0009337 Ga0501042_0009337_3834_5228 436
273 3300049580 Ga0501046_0037754 Ga0501046_0037754_1184_2578 436
274 3300049581 Ga0501047_0095206 Ga0501047_0095206_945_2339 436
275 3300049582 Ga0501048_0001793 Ga0501048_0001793_8244_9638 436
276 3300049583 Ga0501067_0028697 Ga0501067_0028697_130_1524 436
277 3300049586 Ga0501070_0052721 Ga0501070_0052721_692_2086 436
278 3300049822 Ga0501035_0154605 Ga0501035_0154605_511_1905 436
279 iso_pu_bacteria 2643221561 2643827449 436
280 iso_pu_bacteria 2643221696 2644533723 436
281 iso_pu_bacteria 2773857762 2774394794 436
282 iso_pu_bacteria 2808606439 2809194345 436
283 iso_pu_bacteria 2811994878 2812349108 436
284 iso_pu_bacteria 2984576629 2984577489 436
285 iso_pu_bacteria 2990256926 2990259649 436
286 3300032126 Ga0307415_100037680 Ga0307415_1000376802 437
287 3300044842 Ga0466957_0080676 Ga0466957_0080676_154_1530 437
288 iso_pu_bacteria 2855386786 2855388318 437
289 3300005614 Ga0068856_100036383 Ga0068856_1000363833 438
290 3300006048 Ga0075363_100085429 Ga0075363_1000854292 438
291 3300025914 Ga0207671_10013151 Ga0207671_100131513 438
292 3300026078 Ga0207702_10010611 Ga0207702_100106115 438
293 3300050490 nmdc:mga03n38_4704_c1 nmdc:mga03n38_4704_c1_3133_4503 438
294 3300005455 Ga0070663_100095502 Ga0070663_1000955022 439
295 3300005564 Ga0070664_100162083 Ga0070664_1001620832 439
296 3300005937 Ga0081455_10017484 Ga0081455_100174847 439
297 3300006847 Ga0075431_100002893 Ga0075431_1000028934 439
298 3300025933 Ga0207706_10067579 Ga0207706_100675793 439
299 3300026067 Ga0207678_10022311 Ga0207678_100223116 439
300 3300031731 Ga0307405_10009423 Ga0307405_100094235 439
301 3300031852 Ga0307410_10005130 Ga0307410_100051306 439
302 3300031995 Ga0307409_100024717 Ga0307409_1000247174 439
303 3300032002 Ga0307416_100019808 Ga0307416_1000198083 439
304 3300035398 Ga0316574_0083450 Ga0316574_0083450_94_1473 439
305 3300044658 Ga0466972_0063329 Ga0466972_0063329_180_1562 439
306 3300044901 Ga0466960_0009006 Ga0466960_0009006_1003_2385 439
307 3300044901 Ga0466960_0009869 Ga0466960_0009869_713_2095 439
308 3300048912 Ga0496109_0067225 Ga0496109_0067225_361_1761 439
309 3300048914 Ga0496111_0054894 Ga0496111_0054894_245_1645 439
310 3300050510 nmdc:mga06r32_27273_c1 nmdc:mga06r32_27273_c1_2796_4175 439
311 iso_pu_bacteria 2643221576 2643892068 439
312 iso_pu_bacteria 2643221590 2643961120 439
313 iso_pu_bacteria 2643221604 2644031834 439
314 iso_pu_bacteria 2643221617 2644099804 439
315 iso_pu_bacteria 2643221620 2644117410 439
316 3300005456 Ga0070678_100057367 Ga0070678_1000573672 440
317 3300005981 Ga0081538_10002044 Ga0081538_1000204417 440
318 3300026121 Ga0207683_10078325 Ga0207683_100783252 440
319 3300030744 Ga0316181_1267313 Ga0316181_12673132 440
320 3300041452 Ga0451793_0745271 Ga0451793_0745271_2443_3828 440
321 3300041453 Ga0451797_0707486 Ga0451797_0707486_963_2348 440
322 3300041494 Ga0451837_0123676 Ga0451837_0123676_406_1791 440
323 3300041509 Ga0451843_0064469 Ga0451843_0064469_721_2106 440
324 3300044765 Ga0466970_0011729 Ga0466970_0011729_2835_4214 440
325 3300044901 Ga0466960_0053401 Ga0466960_0053401_178_1584 440
326 3300048925 Ga0496122_0000098 Ga0496122_0000098_108085_109467 440
327 3300048926 Ga0496123_0000420 Ga0496123_0000420_20136_21518 440
328 3300048927 Ga0496124_0000179 Ga0496124_0000179_55519_56901 440
329 3300048928 Ga0496125_0000480 Ga0496125_0000480_49490_50872 440
330 3300049571 Ga0501034_0177311 Ga0501034_0177311_283_1665 440
331 3300049572 Ga0501036_0134448 Ga0501036_0134448_240_1640 440
332 iso_pu_bacteria 2643221641 2644228580 440
333 iso_pu_bacteria 2739367898 2740166054 440
334 iso_pu_bacteria 2857481737 2857486326 440
335 iso_pu_bacteria 8054609563 8054609866 440
336 3300001979 JGI24740J21852_10010516 JGI24740J21852_100105164 441
337 3300002067 JGI24735J21928_10007506 JGI24735J21928_100075062 441
338 3300005327 Ga0070658_10152987 Ga0070658_101529871 441
339 3300005339 Ga0070660_100132290 Ga0070660_1001322901 441
340 3300005367 Ga0070667_100037532 Ga0070667_1000375323 441
341 3300005458 Ga0070681_10070667 Ga0070681_100706672 441
342 3300005535 Ga0070684_100097177 Ga0070684_1000971772 441
343 3300005548 Ga0070665_100001294 Ga0070665_1000012948 441
344 3300005843 Ga0068860_100000314 Ga0068860_10000031465 441
345 3300006038 Ga0075365_10003959 Ga0075365_100039593 441
346 3300006038 Ga0075365_10012903 Ga0075365_100129033 441
347 3300006042 Ga0075368_10002617 Ga0075368_100026173 441
348 3300006042 Ga0075368_10002657 Ga0075368_100026576 441
349 3300006042 Ga0075368_10006411 Ga0075368_100064113 441
350 3300006048 Ga0075363_100019161 Ga0075363_1000191612 441
351 3300006048 Ga0075363_100065808 Ga0075363_1000658082 441
352 3300006051 Ga0075364_10053092 Ga0075364_100530922 441
353 3300006051 Ga0075364_10056395 Ga0075364_100563952 441
354 3300006177 Ga0075362_10029267 Ga0075362_100292672 441
355 3300006178 Ga0075367_10004951 Ga0075367_100049519 441
356 3300006178 Ga0075367_10006634 Ga0075367_100066343 441
357 3300006353 Ga0075370_10000996 Ga0075370_100009963 441
358 3300006353 Ga0075370_10006396 Ga0075370_100063964 441
359 3300006353 Ga0075370_10050335 Ga0075370_100503352 441
360 3300013307 Ga0157372_10129879 Ga0157372_101298792 441
361 3300017792 Ga0163161_10039428 Ga0163161_100394282 441
362 3300025904 Ga0207647_10007112 Ga0207647_100071129 441
363 3300025909 Ga0207705_10125592 Ga0207705_101255921 441
364 3300025912 Ga0207707_10050766 Ga0207707_100507662 441
365 3300025921 Ga0207652_10098466 Ga0207652_100984661 441
366 3300025929 Ga0207664_10110207 Ga0207664_101102072 441
367 3300025944 Ga0207661_10038645 Ga0207661_100386452 441
368 3300026075 Ga0207708_10006114 Ga0207708_100061145 441
369 3300026118 Ga0207675_100007118 Ga0207675_10000711810 441
370 3300027866 Ga0209813_10004156 Ga0209813_100041564 441
371 3300027866 Ga0209813_10016406 Ga0209813_100164062 441
372 3300028379 Ga0268266_10001059 Ga0268266_1000105915 441
373 3300028381 Ga0268264_10007457 Ga0268264_100074577 441
374 3300031727 Ga0316576_10039043 Ga0316576_100390432 441
375 3300031728 Ga0316578_10120389 Ga0316578_101203891 441
376 3300032002 Ga0307416_100114301 Ga0307416_1001143012 441
377 3300036712 Ga0316584_0016360 Ga0316584_0016360_1887_3290 441
378 3300044658 Ga0466972_0018650 Ga0466972_0018650_1420_2805 441
379 3300044683 Ga0466965_0015970 Ga0466965_0015970_1046_2434 441
380 3300044694 Ga0466963_0074585 Ga0466963_0074585_278_1654 441
381 3300044706 Ga0466964_0008678 Ga0466964_0008678_263_1639 441
382 3300044901 Ga0466960_0005340 Ga0466960_0005340_2215_3597 441
383 3300045976 Ga0466967_0192597 Ga0466967_0192597_320_1702 441
384 3300047315 Ga0495581_0034756 Ga0495581_0034756_391_1767 441
385 3300048909 Ga0496106_0045510 Ga0496106_0045510_1046_2425 441
386 3300048909 Ga0496106_0111913 Ga0496106_0111913_459_1871 441
387 3300048911 Ga0496108_0154978 Ga0496108_0154978_206_1585 441
388 3300048911 Ga0496108_0163245 Ga0496108_0163245_378_1757 441
389 3300048912 Ga0496109_0040746 Ga0496109_0040746_2786_4165 441
390 3300048912 Ga0496109_0042483 Ga0496109_0042483_452_1831 441
391 3300048914 Ga0496111_0053799 Ga0496111_0053799_489_1868 441
392 3300048917 Ga0496114_0118867 Ga0496114_0118867_803_2185 441
393 3300048918 Ga0496115_0055118 Ga0496115_0055118_67_1446 441
394 3300049569 Ga0501032_0007594 Ga0501032_0007594_2554_3948 441
395 3300049570 Ga0501033_0007864 Ga0501033_0007864_4808_6202 441
396 3300049572 Ga0501036_0015193 Ga0501036_0015193_1072_2466 441
397 3300049575 Ga0501039_0001126 Ga0501039_0001126_7458_8852 441
398 3300049576 Ga0501040_0021700 Ga0501040_0021700_1708_3090 441
399 3300049579 Ga0501043_0008473 Ga0501043_0008473_2740_4134 441
400 3300049579 Ga0501043_0153084 Ga0501043_0153084_73_1467 441
401 3300049580 Ga0501046_0000508 Ga0501046_0000508_28957_30351 441
402 3300049582 Ga0501048_0036566 Ga0501048_0036566_1700_3082 441
403 3300049583 Ga0501067_0035204 Ga0501067_0035204_664_2046 441
404 3300049584 Ga0501068_0042046 Ga0501068_0042046_1028_2410 441
405 3300049586 Ga0501070_0003521 Ga0501070_0003521_2519_3895 441
406 3300049586 Ga0501070_0126952 Ga0501070_0126952_293_1690 441
407 3300049590 Ga0501074_0057723 Ga0501074_0057723_1367_2743 441
408 3300049591 Ga0501075_0091317 Ga0501075_0091317_220_1602 441
409 3300049742 Ga0501080_0062550 Ga0501080_0062550_1695_3089 441
410 3300049742 Ga0501080_0083049 Ga0501080_0083049_30_1406 441
411 3300050491 nmdc:mga00v17_30468_c1 nmdc:mga00v17_30468_c1_30_1409 441
412 3300050492 nmdc:mga0yw44_106773_c1 nmdc:mga0yw44_106773_c1_352_1734 441
413 3300050492 nmdc:mga0yw44_137120_c1 nmdc:mga0yw44_137120_c1_192_1571 441
414 3300050492 nmdc:mga0yw44_156042_c1 nmdc:mga0yw44_156042_c1_94_1479 441
415 3300050492 nmdc:mga0yw44_50150_c1 nmdc:mga0yw44_50150_c1_521_1924 441
416 3300050492 nmdc:mga0yw44_57526_c1 nmdc:mga0yw44_57526_c1_58_1440 441
417 3300050492 nmdc:mga0yw44_71988_c1 nmdc:mga0yw44_71988_c1_595_1974 441
418 3300050495 nmdc:mga04h51_20204_c1 nmdc:mga04h51_20204_c1_127_1530 441
419 3300050496 nmdc:mga07m45_33464_c1 nmdc:mga07m45_33464_c1_1156_2541 441
420 3300053117 Ga0500593_000321 Ga0500593_000321_1240_2628 441
421 3300053140 Ga0500573_0016030 Ga0500573_0016030_2675_4057 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01704

UDPGP

UTP--glucose-1-phosphate uridylyltransferase

54

462

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqj-assembly1.cif.gz_A crystal structure of uridine-diphospho-n-acetylglucosamine pyrophosphorylase from candida albicans, in the reaction-completed form 0.8628 46 370
2yqs-assembly1.cif.gz_A crystal structure of uridine-diphospho-n-acetylglucosamine pyrophosphorylase from candida albicans, in the product-binding form 0.8599 44 364
2yqj-assembly2.cif.gz_B crystal structure of uridine-diphospho-n-acetylglucosamine pyrophosphorylase from candida albicans, in the reaction-completed form 0.8561 46 370
2yqh-assembly1.cif.gz_A crystal structure of uridine-diphospho-n-acetylglucosamine pyrophosphorylase from candida albicans, in the substrate-binding form 0.8483 46 359
3gue-assembly1.cif.gz_A crystal structure of udp-glucose phosphorylase from trypanosoma brucei, (tb10.389.0330) 0.8341 5 441
ID Description Score Start End Superfamily
5nzkA01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9149 4 360 3.90.550.10
af_B6T4R3_1_363_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9104 1 360 3.90.550.10
af_B6T4R3_1_363_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8936 1 360 3.90.550.10
af_P08800_53_398_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8926 16 360 3.90.550.10
af_A0A0P0V0U6_60_308_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8847 37 262 3.90.550.10
ID Description Score Start End GO Terms
AF-W4UJT8-F1-model_v4 deleted 0.9916 13 386
AF-A0A1L5L407-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase 0.9749 13 350 GO:0003983
GO:0006011
AF-A0A847MS76-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase 0.9722 1 383 GO:0003983
GO:0006011
AF-W4TMK0-F1-model_v4 deleted 0.9706 171 386
AF-A0A3E2BT90-F1-model_v4 deleted 0.9695 77 357

Feature Viewer

pLDDT pTM Quality
90.17 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map