F439719

General Info

Members Datasets Scaffolds Average Seq Length
420 272 840 217

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10175659|Ga0081538_101756592
Length 246
Sequence MAHYRLYCIGASGNSYKVALYLNCAGLDWEPIGVDFAGGQMRDEAWRASTNVMGEVPVLEVDGRYMSQSGMILTWLAETTAKFAPVPDQRLEALRWLLFDNHKFTSGYAQHRFANVLTPEPPHPALLAYLKTRAANAFAIVDKHLADRPFMLGDRLTIVDFSLAGYVFYPASETGFDLEAEFPAIHVWRRRLAALPGWKPPYELMNVGNSALPLRSSSYVEAARNADGFEERLVMADNQQGSVVRA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
221 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
222 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
223 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
224 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
225 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
226 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
227 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
228 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
229 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
230 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
231 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
232 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
233 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
234 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
235 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
236 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
237 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
238 2922368715
239 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
240 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
241 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
242 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
243 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
244 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
245 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
246 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
247 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
248 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
249 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
250 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
251 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
252 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
253 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
254 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
255 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
256 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
257 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
258 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
259 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
260 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
261 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
262 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
263 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
264 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
265 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
266 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
267 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
268 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
269 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
270 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
271 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
272 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.83
Metatranscriptomes 0
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 9.29
Rhizoplane 2.14
Rhizosphere 70.71
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10175659 3300005981 Bacteria 926
2 JGI25153J46596_10001920 3300003215 Bacteria 12337
3 JGI25153J46596_10023055 3300003215 Bacteria 2277
4 rootH1_10122699 3300003323 Bacteria 1275
5 rootH1_10246440 3300003323 Bacteria 1109
6 JGI25160J50197_1000631 3300003354 Bacteria 19703
7 JGI25404J52841_10001196 3300003659 Bacteria 4452
8 JGI25404J52841_10005245 3300003659 Bacteria 2673
9 JGI25404J52841_10006512 3300003659 Bacteria 2448
10 JGI25404J52841_10010011 3300003659 Bacteria 2034
11 JGI25404J52841_10014032 3300003659 Bacteria 1738
12 JGI25404J52841_10015205 3300003659 Bacteria 1671
13 Ga0055531_10011002 3300003794 Bacteria 4422
14 Ga0070658_10872674 3300005327 Bacteria 782
15 Ga0070676_10043099 3300005328 Bacteria 2622
16 Ga0070676_10073099 3300005328 Bacteria 2063
17 Ga0070690_100186455 3300005330 Bacteria 1436
18 Ga0070670_100066210 3300005331 Bacteria 3100
19 Ga0070677_10008631 3300005333 Bacteria 3435
20 Ga0070677_10057896 3300005333 Bacteria 1590
21 Ga0068869_100073514 3300005334 Bacteria 2535
22 Ga0068869_100213528 3300005334 Unclassified 1526
23 Ga0068869_100377263 3300005334 Bacteria 1161
24 Ga0070666_10085872 3300005335 Bacteria 2156
25 Ga0070682_100060495 3300005337 Bacteria 2396
26 Ga0068868_100040285 3300005338 Bacteria 3635
27 Ga0070668_100080919 3300005347 Bacteria 2546
28 Ga0070668_100140649 3300005347 Bacteria 1945
29 Ga0070668_100164183 3300005347 Bacteria 1804
30 Ga0070668_100583911 3300005347 Bacteria 976
31 Ga0070669_100125660 3300005353 Bacteria 1962
32 Ga0070669_100149581 3300005353 Bacteria 1807
33 Ga0070669_100210967 3300005353 Bacteria 1532
34 Ga0070669_100290743 3300005353 Bacteria 1312
35 Ga0070675_100012133 3300005354 Bacteria 6756
36 Ga0070675_100073858 3300005354 Bacteria 2832
37 Ga0070675_100184604 3300005354 Unclassified 1804
38 Ga0070671_100069551 3300005355 Bacteria 2937
39 Ga0070674_100060707 3300005356 Bacteria 2636
40 Ga0070674_100303546 3300005356 Bacteria 1273
41 Ga0070674_100350496 3300005356 Bacteria 1192
42 Ga0070673_100114863 3300005364 Bacteria 2238
43 Ga0070673_100116267 3300005364 Bacteria 2225
44 Ga0070688_100040575 3300005365 Bacteria 2853
45 Ga0070659_100064021 3300005366 Bacteria 2910
46 Ga0070667_100477516 3300005367 Bacteria 1141
47 Ga0070667_100603241 3300005367 Bacteria 1012
48 Ga0070701_10039597 3300005438 Bacteria 2392
49 Ga0070701_10357417 3300005438 Bacteria 914
50 Ga0070701_10396904 3300005438 Bacteria 873
51 Ga0070700_100123077 3300005441 Unclassified 1741
52 Ga0070700_100260890 3300005441 Bacteria 1248
53 Ga0070694_100249598 3300005444 Bacteria 1342
54 Ga0070663_100028781 3300005455 Bacteria 3787
55 Ga0070663_100166763 3300005455 Bacteria 1699
56 Ga0070663_100636028 3300005455 Bacteria 901
57 Ga0070678_100008155 3300005456 Bacteria 6260
58 Ga0070678_100069204 3300005456 Bacteria 2635
59 Ga0070678_100453320 3300005456 Unclassified 1124
60 Ga0070662_100409196 3300005457 Bacteria 1121
61 Ga0068867_100147627 3300005459 Bacteria 1844
62 Ga0068867_100180340 3300005459 Bacteria 1679
63 Ga0068867_100274076 3300005459 Bacteria 1381
64 Ga0070672_100036600 3300005543 Bacteria 3740
65 Ga0070672_100103919 3300005543 Bacteria 2308
66 Ga0070672_100105503 3300005543 Bacteria 2291
67 Ga0070672_100183505 3300005543 Bacteria 1744
68 Ga0070693_100334614 3300005547 Bacteria 1032
69 Ga0068855_100029724 3300005563 Bacteria 6534
70 Ga0070664_100247447 3300005564 Bacteria 1602
71 Ga0068857_100478995 3300005577 Bacteria 1166
72 Ga0068854_100047556 3300005578 Bacteria 3058
73 Ga0068856_100127792 3300005614 Bacteria 2545
74 Ga0070702_100032226 3300005615 Bacteria 2875
75 Ga0068852_100568054 3300005616 Bacteria 1136
76 Ga0068859_100269779 3300005617 Bacteria 1794
77 Ga0068859_100966573 3300005617 Bacteria 934
78 Ga0068864_100039929 3300005618 Bacteria 4012
79 Ga0068864_100397680 3300005618 Bacteria 1309
80 Ga0068861_100054851 3300005719 Bacteria 3038
81 Ga0068861_100263059 3300005719 Unclassified 1478
82 Ga0068861_100690716 3300005719 Bacteria 947
83 Ga0068870_10095814 3300005840 Unclassified 1668
84 Ga0068870_10132235 3300005840 Bacteria 1451
85 Ga0068870_10331085 3300005840 Bacteria 971
86 Ga0068870_10474273 3300005840 Bacteria 829
87 Ga0068863_100080439 3300005841 Bacteria 3086
88 Ga0068863_100278090 3300005841 Bacteria 1621
89 Ga0068863_101092554 3300005841 Bacteria 802
90 Ga0068858_100073745 3300005842 Bacteria 3168
91 Ga0068860_100075791 3300005843 Bacteria 3199
92 Ga0068860_100966754 3300005843 Bacteria 869
93 Ga0068862_100064950 3300005844 Bacteria 3142
94 Ga0068862_100532523 3300005844 Bacteria 1119
95 Ga0081455_10001565 3300005937 Bacteria 28095
96 Ga0081455_10004386 3300005937 Bacteria 15894
97 Ga0081455_10015618 3300005937 Bacteria 7367
98 Ga0081540_1002055 3300005983 Bacteria 16786
99 Ga0081540_1003766 3300005983 Bacteria 11877
100 Ga0081540_1006639 3300005983 Bacteria 8385
101 Ga0081540_1007518 3300005983 Bacteria 7758
102 Ga0081540_1014624 3300005983 Bacteria 5017
103 Ga0081540_1068119 3300005983 Bacteria 1660
104 Ga0081539_10002516 3300005985 Bacteria 25625
105 Ga0081539_10003162 3300005985 Bacteria 20881
106 Ga0075363_100223946 3300006048 Bacteria 1078
107 Ga0075362_10005740 3300006177 Bacteria 4567
108 Ga0075362_10311514 3300006177 Bacteria 783
109 Ga0075367_10189245 3300006178 Bacteria 1284
110 Ga0075367_10189386 3300006178 Bacteria 1284
111 Ga0075369_10007346 3300006186 Bacteria 4192
112 Ga0075369_10010686 3300006186 Bacteria 3596
113 Ga0075369_10155380 3300006186 Bacteria 1047
114 Ga0075366_10220800 3300006195 Bacteria 1155
115 Ga0075366_10230639 3300006195 Bacteria 1128
116 Ga0075366_10384352 3300006195 Bacteria 863
117 Ga0097621_100043386 3300006237 Bacteria 3625
118 Ga0097621_100125950 3300006237 Bacteria 2176
119 Ga0075370_10035544 3300006353 Bacteria 2797
120 Ga0075370_10058296 3300006353 Bacteria 2196
121 Ga0075370_10239271 3300006353 Bacteria 1075
122 Ga0068871_100044344 3300006358 Bacteria 3576
123 Ga0068871_100063559 3300006358 Bacteria 3019
124 Ga0075430_100387727 3300006846 Bacteria 1153
125 Ga0075434_100204201 3300006871 Bacteria 1996
126 Ga0068865_100028586 3300006881 Unclassified 3693
127 Ga0097620_100269804 3300006931 Bacteria 1794
128 Ga0097620_100966570 3300006931 Bacteria 934
129 Ga0075435_100262519 3300007076 Bacteria 1472
130 Ga0099794_10007017 3300007265 Bacteria 4598
131 Ga0099794_10019932 3300007265 Bacteria 3030
132 Ga0099795_10120267 3300007788 Bacteria 1049
133 Ga0105240_10364075 3300009093 Bacteria 1637
134 Ga0111539_10146679 3300009094 Bacteria 2763
135 Ga0111539_10267121 3300009094 Bacteria 1992
136 Ga0111539_10388540 3300009094 Bacteria 1625
137 Ga0105245_10412616 3300009098 Unclassified 1352
138 Ga0105247_10020247 3300009101 Bacteria 4001
139 Ga0114129_10170059 3300009147 Bacteria 2972
140 Ga0105243_10040441 3300009148 Bacteria 3641
141 Ga0105243_10046275 3300009148 Bacteria 3422
142 Ga0105243_10654209 3300009148 Bacteria 1019
143 Ga0105241_10026860 3300009174 Bacteria 4284
144 Ga0105242_10285582 3300009176 Bacteria 1500
145 Ga0105242_10323153 3300009176 Bacteria 1416
146 Ga0105248_10012317 3300009177 Bacteria 9433
147 Ga0105248_10293773 3300009177 Bacteria 1830
148 Ga0105237_10041548 3300009545 Bacteria 4637
149 Ga0105237_10297943 3300009545 Bacteria 1616
150 Ga0105237_10983977 3300009545 Bacteria 850
151 Ga0105238_10092878 3300009551 Bacteria 3005
152 Ga0105249_10081931 3300009553 Bacteria 3001
153 Ga0105249_10678252 3300009553 Bacteria 1090
154 Ga0099796_10003563 3300010159 Bacteria 3635
155 Ga0105239_10058209 3300010375 Bacteria 4240
156 Ga0105239_10396280 3300010375 Bacteria 1562
157 Ga0105246_10023548 3300011119 Bacteria 3986
158 Ga0157373_10333081 3300013100 Bacteria 1081
159 Ga0157374_10079511 3300013296 Bacteria 3107
160 Ga0157374_10272120 3300013296 Unclassified 1670
161 Ga0157378_10027264 3300013297 Bacteria 5042
162 Ga0157378_10153904 3300013297 Bacteria 2144
163 Ga0163162_10059869 3300013306 Bacteria 3841
164 Ga0163162_10531386 3300013306 Bacteria 1305
165 Ga0157375_10051791 3300013308 Bacteria 4034
166 Ga0157375_10105478 3300013308 Bacteria 2909
167 Ga0157375_10105647 3300013308 Bacteria 2907
168 Ga0157375_10317274 3300013308 Unclassified 1723
169 Ga0157375_10334048 3300013308 Bacteria 1681
170 Ga0157375_11186635 3300013308 Bacteria 895
171 Ga0157375_11243775 3300013308 Bacteria 874
172 Ga0163163_10080682 3300014325 Bacteria 3253
173 Ga0163163_10148889 3300014325 Bacteria 2385
174 Ga0163163_10379616 3300014325 Bacteria 1471
175 Ga0163163_11087010 3300014325 Bacteria 863
176 Ga0157380_10009291 3300014326 Bacteria 7037
177 Ga0157380_10046299 3300014326 Bacteria 3415
178 Ga0157380_10582232 3300014326 Bacteria 1104
179 Ga0157380_11070105 3300014326 Bacteria 844
180 Ga0157377_10078056 3300014745 Bacteria 1929
181 Ga0157379_10549458 3300014968 Bacteria 1074
182 Ga0157379_10892411 3300014968 Unclassified 843
183 Ga0157376_10030357 3300014969 Bacteria 4316
184 Ga0157376_10050131 3300014969 Bacteria 3462
185 Ga0157376_10165456 3300014969 Bacteria 2009
186 Ga0157376_10195187 3300014969 Unclassified 1859
187 Ga0163161_10650743 3300017792 Bacteria 873
188 Ga0207425_1022209 3300025245 Bacteria 1339
189 Ga0209148_1000342 3300025254 Bacteria 61473
190 Ga0209455_1007485 3300025272 Bacteria 3076
191 Ga0209758_1000021 3300025297 Bacteria 697691
192 Ga0209758_1057077 3300025297 Bacteria 1314
193 Ga0209256_1007103 3300025299 Bacteria 5650
194 Ga0207426_1000599 3300025302 Bacteria 47456
195 Ga0207426_1053700 3300025302 Bacteria 1188
196 Ga0209257_1005880 3300025304 Bacteria 8278
197 Ga0207682_10001857 3300025893 Bacteria 9619
198 Ga0207682_10004759 3300025893 Bacteria 5628
199 Ga0207642_10211904 3300025899 Bacteria 1077
200 Ga0207710_10009375 3300025900 Bacteria 4121
201 Ga0207688_10013031 3300025901 Bacteria 4522
202 Ga0207647_10277762 3300025904 Bacteria 956
203 Ga0207645_10206618 3300025907 Bacteria 1293
204 Ga0207643_10174218 3300025908 Bacteria 1299
205 Ga0207654_10014419 3300025911 Bacteria 4083
206 Ga0207671_10064136 3300025914 Bacteria 2731
207 Ga0207657_10027858 3300025919 Bacteria 5167
208 Ga0207649_10119377 3300025920 Bacteria 1775
209 Ga0207681_10031871 3300025923 Bacteria 3446
210 Ga0207681_10111954 3300025923 Bacteria 1987
211 Ga0207681_10264320 3300025923 Bacteria 1348
212 Ga0207694_10368453 3300025924 Bacteria 1191
213 Ga0207650_10201882 3300025925 Bacteria 1593
214 Ga0207650_10410403 3300025925 Bacteria 1122
215 Ga0207659_10445568 3300025926 Unclassified 1090
216 Ga0207659_10646274 3300025926 Bacteria 904
217 Ga0207687_10016506 3300025927 Bacteria 4849
218 Ga0207706_10108099 3300025933 Bacteria 2448
219 Ga0207706_10183997 3300025933 Bacteria 1835
220 Ga0207706_10573579 3300025933 Bacteria 970
221 Ga0207686_10416414 3300025934 Unclassified 1027
222 Ga0207709_10086426 3300025935 Unclassified 2036
223 Ga0207709_10447120 3300025935 Bacteria 998
224 Ga0207669_10056465 3300025937 Bacteria 2384
225 Ga0207691_10005972 3300025940 Bacteria 11759
226 Ga0207691_10058201 3300025940 Bacteria 3515
227 Ga0207691_10100573 3300025940 Bacteria 2580
228 Ga0207711_10211095 3300025941 Bacteria 1773
229 Ga0207711_10714552 3300025941 Bacteria 934
230 Ga0207689_10023656 3300025942 Bacteria 5152
231 Ga0207689_10026612 3300025942 Bacteria 4846
232 Ga0207679_10192425 3300025945 Bacteria 1697
233 Ga0207651_10059112 3300025960 Bacteria 2653
234 Ga0207651_10369928 3300025960 Unclassified 1212
235 Ga0207668_10273478 3300025972 Bacteria 1382
236 Ga0207668_10320630 3300025972 Bacteria 1286
237 Ga0207640_10336336 3300025981 Bacteria 1208
238 Ga0207658_10356541 3300025986 Bacteria 1275
239 Ga0207677_10082261 3300026023 Bacteria 2313
240 Ga0207703_10045737 3300026035 Bacteria 3522
241 Ga0207639_10105763 3300026041 Bacteria 2284
242 Ga0207678_10049928 3300026067 Bacteria 3615
243 Ga0207678_10055053 3300026067 Bacteria 3426
244 Ga0207678_10295421 3300026067 Bacteria 1392
245 Ga0207678_10425961 3300026067 Bacteria 1151
246 Ga0207678_10503412 3300026067 Bacteria 1056
247 Ga0207708_10038868 3300026075 Bacteria 3625
248 Ga0207708_10499790 3300026075 Bacteria 1019
249 Ga0207702_10239344 3300026078 Bacteria 1700
250 Ga0207641_10050703 3300026088 Bacteria 3512
251 Ga0207641_10067100 3300026088 Bacteria 3072
252 Ga0207641_10428005 3300026088 Bacteria 1276
253 Ga0207641_10737943 3300026088 Unclassified 971
254 Ga0207648_10027902 3300026089 Bacteria 5008
255 Ga0207648_10160413 3300026089 Bacteria 1986
256 Ga0207648_10221798 3300026089 Bacteria 1680
257 Ga0207674_10044321 3300026116 Bacteria 4581
258 Ga0207674_10461965 3300026116 Bacteria 1227
259 Ga0207675_100014738 3300026118 Bacteria 7292
260 Ga0207675_100329569 3300026118 Bacteria 1492
261 Ga0207675_100506602 3300026118 Bacteria 1202
262 Ga0207683_10065890 3300026121 Bacteria 3193
263 Ga0207683_10069335 3300026121 Bacteria 3114
264 Ga0207683_10081380 3300026121 Bacteria 2874
265 Ga0207683_10098110 3300026121 Bacteria 2614
266 Ga0207698_10690088 3300026142 Bacteria 1015
267 Ga0209588_1010512 3300027671 Bacteria 2783
268 Ga0209588_1026217 3300027671 Bacteria 1849
269 Ga0268266_10082792 3300028379 Bacteria 2799
270 Ga0268266_10924152 3300028379 Bacteria 844
271 Ga0268265_10394566 3300028380 Bacteria 1277
272 Ga0268264_10476213 3300028381 Bacteria 1214
273 Ga0307517_10002211 3300028786 Bacteria 31433
274 Ga0307517_10352377 3300028786 Bacteria 799
275 Ga0307515_10059503 3300028794 Bacteria 5472
276 Ga0307515_10451389 3300028794 Bacteria 901
277 Ga0265330_10160073 3300031235 Bacteria 956
278 Ga0307513_10460412 3300031456 Bacteria 995
279 Ga0307509_10011051 3300031507 Bacteria 10994
280 Ga0307508_10274079 3300031616 Bacteria 1281
281 Ga0307510_10225746 3300033180 Bacteria 1380
282 Ga0451807_0714266 3300041486 Bacteria 4019
283 Ga0466965_0009353 3300044683 Bacteria 4553
284 Ga0466960_0219600 3300044901 Bacteria 1045
285 Ga0495603_0037423 3300046455 Bacteria 2911
286 Ga0495590_0004157 3300046457 Bacteria 5859
287 Ga0495639_0047666 3300046475 Bacteria 1942
288 Ga0495584_0095723 3300046491 Bacteria 1499
289 Ga0495596_0143938 3300046500 Bacteria 926
290 Ga0495596_0180071 3300046500 Unclassified 821
291 Ga0495583_0038275 3300046506 Bacteria 2267
292 Ga0495606_0011059 3300046507 Bacteria 7403
293 Ga0495631_0161582 3300046518 Bacteria 961
294 Ga0495632_0028363 3300046519 Archaea 2922
295 Ga0495644_0082009 3300046523 Bacteria 1216
296 Ga0495648_0085962 3300046524 Bacteria 1775
297 Ga0495666_0113060 3300046526 Bacteria 1275
298 Ga0495633_0244843 3300046558 Bacteria 818
299 Ga0495656_0167253 3300046615 Bacteria 1072
300 Ga0495668_0066826 3300046616 Bacteria 1978
301 Ga0495611_0202362 3300046648 Bacteria 926
302 Ga0495625_0154774 3300046660 Bacteria 1539
303 Ga0495625_0196217 3300046660 Bacteria 1335
304 Ga0495659_0033514 3300046664 Bacteria 1803
305 Ga0495588_0029145 3300046674 Bacteria 2767
306 Ga0495588_0067897 3300046674 Bacteria 1851
307 Ga0495669_0138986 3300046684 Bacteria 1146
308 Ga0495670_0062667 3300046691 Bacteria 1871
309 Ga0495671_0323777 3300046692 Bacteria 740
310 Ga0495649_0016886 3300046694 Unclassified 4131
311 Ga0495649_0108198 3300046694 Bacteria 1475
312 Ga0495672_0008522 3300047320 Bacteria 7550
313 Ga0495676_0095783 3300047321 Bacteria 2208
314 Ga0495683_0105988 3300047323 Bacteria 1347
315 Ga0495681_0150958 3300047470 Bacteria 975
316 Ga0496104_0010884 3300048907 Bacteria 8137
317 Ga0496105_0239921 3300048908 Bacteria 1471
318 Ga0496106_0019638 3300048909 Bacteria 5013
319 Ga0496108_0389945 3300048911 Bacteria 1216
320 Ga0496109_0040504 3300048912 Bacteria 4220
321 Ga0496112_0014209 3300048915 Bacteria 7379
322 Ga0496113_0205335 3300048916 Bacteria 1567
323 Ga0496113_0218024 3300048916 Bacteria 1520
324 Ga0496119_0090961 3300048922 Bacteria 1734
325 Ga0496121_0037479 3300048924 Bacteria 4306
326 Ga0496121_0072077 3300048924 Bacteria 2774
327 Ga0496121_0078169 3300048924 Bacteria 2631
328 Ga0496121_0205443 3300048924 Bacteria 1400
329 Ga0496121_0320059 3300048924 Bacteria 1045
330 Ga0496124_0173766 3300048927 Bacteria 1665
331 Ga0496125_0163093 3300048928 Bacteria 1511
332 Ga0496126_0047952 3300048929 Bacteria 3908
333 Ga0496126_0240937 3300048929 Bacteria 1511
334 Ga0496126_0325563 3300048929 Bacteria 1262
335 Ga0495682_0056444 3300049460 Bacteria 1423
336 Ga0501039_0244780 3300049575 Bacteria 1410
337 Ga0501042_0085484 3300049578 Bacteria 2262
338 Ga0501042_0342378 3300049578 Bacteria 1081
339 Ga0501068_0001172 3300049584 Bacteria 13929
340 Ga0501070_0612928 3300049586 Bacteria 867
341 Ga0501071_0053895 3300049587 Bacteria 2901
342 Ga0501072_0010261 3300049588 Bacteria 7136
343 Ga0501072_0251832 3300049588 Bacteria 1406
344 Ga0501073_0001217 3300049589 Bacteria 18755
345 Ga0501074_0224704 3300049590 Bacteria 1336
346 Ga0501077_0084740 3300049593 Bacteria 2009
347 Ga0501079_0002929 3300049741 Bacteria 12466
348 Ga0501080_0021085 3300049742 Bacteria 6031
349 Ga0501083_0029189 3300049744 Bacteria 3796
350 nmdc:mga03683_6005_c1 3300050489 Bacteria 3597
351 nmdc:mga03n38_239607_c1 3300050490 Bacteria 954
352 nmdc:mga0yw44_298078_c1 3300050492 Bacteria 1080
353 nmdc:mga0k408_219383_c1 3300050493 Bacteria 1135
354 nmdc:mga0k408_441802_c1 3300050493 Bacteria 773
355 nmdc:mga07m45_279781_c1 3300050496 Bacteria 970
356 nmdc:mga07m45_2850_c1 3300050496 Bacteria 5629
357 nmdc:mga05p37_113442_c1 3300050507 Bacteria 3332
358 nmdc:mga08y16_297723_c1 3300050511 Bacteria 1663
359 nmdc:mga08y16_443989_c1 3300050511 Bacteria 1324
360 nmdc:mga0sz30_113385_c1 3300050516 Bacteria 1189
361 nmdc:mga0sz30_521_c1 3300050516 Bacteria 14404
362 Ga0500646_0094326 3300053090 Bacteria 931
363 Ga0500566_0044603 3300053094 Bacteria 2553
364 Ga0500641_0086711 3300053096 Bacteria 1333
365 Ga0500595_103432 3300053119 Bacteria 814
366 Ga0500627_0070132 3300053158 Bacteria 1552
367 Ga0501084_0004559 3300054114 Bacteria 11325
368 Ga0500661_009639 3300055283 Bacteria 1765
369 2507508646 2507262055 Bacteria 8048963
370 2511397778 2511231028 Bacteria 8046582
371 2513694943 2513237101 Bacteria 7952346
372 2524436648 2524023205 Bacteria 8918781
373 2644245165 2643221644 Bacteria 6865017
374 2745079278 2744054633 Bacteria 8678936
375 2793062456 2791355196 Bacteria 7323613
376 2824671066 2824661429 Bacteria 9877870
377 2824714162 2824704595 Bacteria 9667483
378 2824763556 2824753945 Bacteria 9787441
379 2824773255 2824763712 Bacteria 9792355
380 2874631791 2874628541 Bacteria 8630250
381 2876768904 2876761206 Bacteria 10111113
382 2879103301 2879099564 Bacteria 10442239
383 2885392672 2885383462 Bacteria 9473874
384 2903778173 2903768456 Bacteria 9749579
385 2904714556 2904711408 Bacteria 9771557
386 2922374327
387 2929618001 2929615660 Bacteria 9193770
388 2929627682 2929624759 Bacteria 9339455
389 2932788219 2932784394 Bacteria 9704911
390 2932810631 2932809354 Bacteria 9135765
391 2932821223 2932818245 Bacteria 9955613
392 2933579929 2933577622 Bacteria 9116884
393 2935642348 2935638405 Bacteria 10015038
394 2935649985 2935648319 Bacteria 8801166
395 2935661863 2935656913 Bacteria 8965014
396 2935668349 2935665750 Bacteria 9571747
397 2935680482 2935675223 Bacteria 9928132
398 2935692848 2935684952 Bacteria 9590419
399 2935706204 2935703347 Bacteria 10242284
400 2935721427 2935713505 Bacteria 9608509
401 2935730345 2935722832 Bacteria 9608746
402 2935740358 2935732158 Bacteria 9706831
403 2935749622 2935741537 Bacteria 9707219
404 2935759065 2935750917 Bacteria 9590372
405 2935762605 2935760218 Bacteria 9817913
406 2935814524 2935810662 Bacteria 9401221
407 2935831662 2935827899 Bacteria 10038562
408 2935960372 2935959822 Bacteria 7869783
409 2936007612 2936002035 Bacteria 9362176
410 2936012532 2936011229 Bacteria 8801034
411 2936021096 2936019824 Bacteria 8804134
412 2936029825 2936028420 Bacteria 8965941
413 2936040081 2936037263 Bacteria 9446081
414 2936047290 2936046547 Bacteria 8903709
415 2936057552 2936055302 Bacteria 8785755
416 2940564930 2940556831 Bacteria 9590747
417 8006932196 8006926726 Bacteria 6749210
418 8016640412 8016630954 Bacteria 9217207
419 8019652200 8019648815 Bacteria 10014479
420 8055746410 8055742211 Bacteria 9226248
421 Ga0081538_10175659
422 JGI25153J46596_10001920
423 JGI25153J46596_10023055
424 rootH1_10122699
425 rootH1_10246440
426 JGI25160J50197_1000631
427 JGI25404J52841_10001196
428 JGI25404J52841_10005245
429 JGI25404J52841_10006512
430 JGI25404J52841_10010011
431 JGI25404J52841_10014032
432 JGI25404J52841_10015205
433 Ga0055531_10011002
434 Ga0070658_10872674
435 Ga0070676_10043099
436 Ga0070676_10073099
437 Ga0070690_100186455
438 Ga0070670_100066210
439 Ga0070677_10008631
440 Ga0070677_10057896
441 Ga0068869_100073514
442 Ga0068869_100213528
443 Ga0068869_100377263
444 Ga0070666_10085872
445 Ga0070682_100060495
446 Ga0068868_100040285
447 Ga0070668_100080919
448 Ga0070668_100140649
449 Ga0070668_100164183
450 Ga0070668_100583911
451 Ga0070669_100125660
452 Ga0070669_100149581
453 Ga0070669_100210967
454 Ga0070669_100290743
455 Ga0070675_100012133
456 Ga0070675_100073858
457 Ga0070675_100184604
458 Ga0070671_100069551
459 Ga0070674_100060707
460 Ga0070674_100303546
461 Ga0070674_100350496
462 Ga0070673_100114863
463 Ga0070673_100116267
464 Ga0070688_100040575
465 Ga0070659_100064021
466 Ga0070667_100477516
467 Ga0070667_100603241
468 Ga0070701_10039597
469 Ga0070701_10357417
470 Ga0070701_10396904
471 Ga0070700_100123077
472 Ga0070700_100260890
473 Ga0070694_100249598
474 Ga0070663_100028781
475 Ga0070663_100166763
476 Ga0070663_100636028
477 Ga0070678_100008155
478 Ga0070678_100069204
479 Ga0070678_100453320
480 Ga0070662_100409196
481 Ga0068867_100147627
482 Ga0068867_100180340
483 Ga0068867_100274076
484 Ga0070672_100036600
485 Ga0070672_100103919
486 Ga0070672_100105503
487 Ga0070672_100183505
488 Ga0070693_100334614
489 Ga0068855_100029724
490 Ga0070664_100247447
491 Ga0068857_100478995
492 Ga0068854_100047556
493 Ga0068856_100127792
494 Ga0070702_100032226
495 Ga0068852_100568054
496 Ga0068859_100269779
497 Ga0068859_100966573
498 Ga0068864_100039929
499 Ga0068864_100397680
500 Ga0068861_100054851
501 Ga0068861_100263059
502 Ga0068861_100690716
503 Ga0068870_10095814
504 Ga0068870_10132235
505 Ga0068870_10331085
506 Ga0068870_10474273
507 Ga0068863_100080439
508 Ga0068863_100278090
509 Ga0068863_101092554
510 Ga0068858_100073745
511 Ga0068860_100075791
512 Ga0068860_100966754
513 Ga0068862_100064950
514 Ga0068862_100532523
515 Ga0081455_10001565
516 Ga0081455_10004386
517 Ga0081455_10015618
518 Ga0081540_1002055
519 Ga0081540_1003766
520 Ga0081540_1006639
521 Ga0081540_1007518
522 Ga0081540_1014624
523 Ga0081540_1068119
524 Ga0081539_10002516
525 Ga0081539_10003162
526 Ga0075363_100223946
527 Ga0075362_10005740
528 Ga0075362_10311514
529 Ga0075367_10189245
530 Ga0075367_10189386
531 Ga0075369_10007346
532 Ga0075369_10010686
533 Ga0075369_10155380
534 Ga0075366_10220800
535 Ga0075366_10230639
536 Ga0075366_10384352
537 Ga0097621_100043386
538 Ga0097621_100125950
539 Ga0075370_10035544
540 Ga0075370_10058296
541 Ga0075370_10239271
542 Ga0068871_100044344
543 Ga0068871_100063559
544 Ga0075430_100387727
545 Ga0075434_100204201
546 Ga0068865_100028586
547 Ga0097620_100269804
548 Ga0097620_100966570
549 Ga0075435_100262519
550 Ga0099794_10007017
551 Ga0099794_10019932
552 Ga0099795_10120267
553 Ga0105240_10364075
554 Ga0111539_10146679
555 Ga0111539_10267121
556 Ga0111539_10388540
557 Ga0105245_10412616
558 Ga0105247_10020247
559 Ga0114129_10170059
560 Ga0105243_10040441
561 Ga0105243_10046275
562 Ga0105243_10654209
563 Ga0105241_10026860
564 Ga0105242_10285582
565 Ga0105242_10323153
566 Ga0105248_10012317
567 Ga0105248_10293773
568 Ga0105237_10041548
569 Ga0105237_10297943
570 Ga0105237_10983977
571 Ga0105238_10092878
572 Ga0105249_10081931
573 Ga0105249_10678252
574 Ga0099796_10003563
575 Ga0105239_10058209
576 Ga0105239_10396280
577 Ga0105246_10023548
578 Ga0157373_10333081
579 Ga0157374_10079511
580 Ga0157374_10272120
581 Ga0157378_10027264
582 Ga0157378_10153904
583 Ga0163162_10059869
584 Ga0163162_10531386
585 Ga0157375_10051791
586 Ga0157375_10105478
587 Ga0157375_10105647
588 Ga0157375_10317274
589 Ga0157375_10334048
590 Ga0157375_11186635
591 Ga0157375_11243775
592 Ga0163163_10080682
593 Ga0163163_10148889
594 Ga0163163_10379616
595 Ga0163163_11087010
596 Ga0157380_10009291
597 Ga0157380_10046299
598 Ga0157380_10582232
599 Ga0157380_11070105
600 Ga0157377_10078056
601 Ga0157379_10549458
602 Ga0157379_10892411
603 Ga0157376_10030357
604 Ga0157376_10050131
605 Ga0157376_10165456
606 Ga0157376_10195187
607 Ga0163161_10650743
608 Ga0207425_1022209
609 Ga0209148_1000342
610 Ga0209455_1007485
611 Ga0209758_1000021
612 Ga0209758_1057077
613 Ga0209256_1007103
614 Ga0207426_1000599
615 Ga0207426_1053700
616 Ga0209257_1005880
617 Ga0207682_10001857
618 Ga0207682_10004759
619 Ga0207642_10211904
620 Ga0207710_10009375
621 Ga0207688_10013031
622 Ga0207647_10277762
623 Ga0207645_10206618
624 Ga0207643_10174218
625 Ga0207654_10014419
626 Ga0207671_10064136
627 Ga0207657_10027858
628 Ga0207649_10119377
629 Ga0207681_10031871
630 Ga0207681_10111954
631 Ga0207681_10264320
632 Ga0207694_10368453
633 Ga0207650_10201882
634 Ga0207650_10410403
635 Ga0207659_10445568
636 Ga0207659_10646274
637 Ga0207687_10016506
638 Ga0207706_10108099
639 Ga0207706_10183997
640 Ga0207706_10573579
641 Ga0207686_10416414
642 Ga0207709_10086426
643 Ga0207709_10447120
644 Ga0207669_10056465
645 Ga0207691_10005972
646 Ga0207691_10058201
647 Ga0207691_10100573
648 Ga0207711_10211095
649 Ga0207711_10714552
650 Ga0207689_10023656
651 Ga0207689_10026612
652 Ga0207679_10192425
653 Ga0207651_10059112
654 Ga0207651_10369928
655 Ga0207668_10273478
656 Ga0207668_10320630
657 Ga0207640_10336336
658 Ga0207658_10356541
659 Ga0207677_10082261
660 Ga0207703_10045737
661 Ga0207639_10105763
662 Ga0207678_10049928
663 Ga0207678_10055053
664 Ga0207678_10295421
665 Ga0207678_10425961
666 Ga0207678_10503412
667 Ga0207708_10038868
668 Ga0207708_10499790
669 Ga0207702_10239344
670 Ga0207641_10050703
671 Ga0207641_10067100
672 Ga0207641_10428005
673 Ga0207641_10737943
674 Ga0207648_10027902
675 Ga0207648_10160413
676 Ga0207648_10221798
677 Ga0207674_10044321
678 Ga0207674_10461965
679 Ga0207675_100014738
680 Ga0207675_100329569
681 Ga0207675_100506602
682 Ga0207683_10065890
683 Ga0207683_10069335
684 Ga0207683_10081380
685 Ga0207683_10098110
686 Ga0207698_10690088
687 Ga0209588_1010512
688 Ga0209588_1026217
689 Ga0268266_10082792
690 Ga0268266_10924152
691 Ga0268265_10394566
692 Ga0268264_10476213
693 Ga0307517_10002211
694 Ga0307517_10352377
695 Ga0307515_10059503
696 Ga0307515_10451389
697 Ga0265330_10160073
698 Ga0307513_10460412
699 Ga0307509_10011051
700 Ga0307508_10274079
701 Ga0307510_10225746
702 Ga0451807_0714266
703 Ga0466965_0009353
704 Ga0466960_0219600
705 Ga0495603_0037423
706 Ga0495590_0004157
707 Ga0495639_0047666
708 Ga0495584_0095723
709 Ga0495596_0143938
710 Ga0495596_0180071
711 Ga0495583_0038275
712 Ga0495606_0011059
713 Ga0495631_0161582
714 Ga0495632_0028363
715 Ga0495644_0082009
716 Ga0495648_0085962
717 Ga0495666_0113060
718 Ga0495633_0244843
719 Ga0495656_0167253
720 Ga0495668_0066826
721 Ga0495611_0202362
722 Ga0495625_0154774
723 Ga0495625_0196217
724 Ga0495659_0033514
725 Ga0495588_0029145
726 Ga0495588_0067897
727 Ga0495669_0138986
728 Ga0495670_0062667
729 Ga0495671_0323777
730 Ga0495649_0016886
731 Ga0495649_0108198
732 Ga0495672_0008522
733 Ga0495676_0095783
734 Ga0495683_0105988
735 Ga0495681_0150958
736 Ga0496104_0010884
737 Ga0496105_0239921
738 Ga0496106_0019638
739 Ga0496108_0389945
740 Ga0496109_0040504
741 Ga0496112_0014209
742 Ga0496113_0205335
743 Ga0496113_0218024
744 Ga0496119_0090961
745 Ga0496121_0037479
746 Ga0496121_0072077
747 Ga0496121_0078169
748 Ga0496121_0205443
749 Ga0496121_0320059
750 Ga0496124_0173766
751 Ga0496125_0163093
752 Ga0496126_0047952
753 Ga0496126_0240937
754 Ga0496126_0325563
755 Ga0495682_0056444
756 Ga0501039_0244780
757 Ga0501042_0085484
758 Ga0501042_0342378
759 Ga0501068_0001172
760 Ga0501070_0612928
761 Ga0501071_0053895
762 Ga0501072_0010261
763 Ga0501072_0251832
764 Ga0501073_0001217
765 Ga0501074_0224704
766 Ga0501077_0084740
767 Ga0501079_0002929
768 Ga0501080_0021085
769 Ga0501083_0029189
770 nmdc:mga03683_6005_c1
771 nmdc:mga03n38_239607_c1
772 nmdc:mga0yw44_298078_c1
773 nmdc:mga0k408_219383_c1
774 nmdc:mga0k408_441802_c1
775 nmdc:mga07m45_279781_c1
776 nmdc:mga07m45_2850_c1
777 nmdc:mga05p37_113442_c1
778 nmdc:mga08y16_297723_c1
779 nmdc:mga08y16_443989_c1
780 nmdc:mga0sz30_113385_c1
781 nmdc:mga0sz30_521_c1
782 Ga0500646_0094326
783 Ga0500566_0044603
784 Ga0500641_0086711
785 Ga0500595_103432
786 Ga0500627_0070132
787 Ga0501084_0004559
788 Ga0500661_009639
789 2507508646
790 2511397778
791 2513694943
792 2524436648
793 2644245165
794 2745079278
795 2793062456
796 2824671066
797 2824714162
798 2824763556
799 2824773255
800 2874631791
801 2876768904
802 2879103301
803 2885392672
804 2903778173
805 2904714556
806 2922374327
807 2929618001
808 2929627682
809 2932788219
810 2932810631
811 2932821223
812 2933579929
813 2935642348
814 2935649985
815 2935661863
816 2935668349
817 2935680482
818 2935692848
819 2935706204
820 2935721427
821 2935730345
822 2935740358
823 2935749622
824 2935759065
825 2935762605
826 2935814524
827 2935831662
828 2935960372
829 2936007612
830 2936012532
831 2936021096
832 2936029825
833 2936040081
834 2936047290
835 2936057552
836 2940564930
837 8006932196
838 8016640412
839 8019652200
840 8055746410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

130

191

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

78

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

11

79

0.91

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

106

196

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

109

200

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

6

83

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8951 4 201
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8919 4 201
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8904 4 201
4zb8-assembly1.cif.gz_A crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with oxidized glutathione. 0.8871 2 197
4hz2-assembly1.cif.gz_A crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 0.8867 4 203
ID Description Score Start End Superfamily
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9399 4 80 3.40.30.10
5zfgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9264 4 80 3.40.30.10
4f0bB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9181 90 194 1.20.1050.10
af_E1JJS1_28_122_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9179 3 79 3.40.30.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9164 6 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7T7Y4T2-F1-model_v4 deleted 0.988 1 215
AF-A0A512NPG9-F1-model_v4 Glutathione S-transferase 0.982 1 212 GO:0016740
AF-A0A519ETN1-F1-model_v4 Glutathione S-transferase 0.9747 1 205 GO:0016740
AF-A0A7T7Y4T2-F1-model_v4 deleted 0.9745 1 215
AF-A0A4V1VAY0-F1-model_v4 deleted 0.9657 3 212

Map