F439706

General Info

Members Datasets Scaffolds Average Seq Length
420 247 418 249

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100108699|Ga0070693_1001086992
Length 264
Sequence MRPWLDSAPMNAGADMTTTVGAAGAAAVPHVLVVDDDPTIRELVTDYLEANEIRVSAVADGAAMQVALRKEVVDLVVLDLKLKGEDGMALARKLRDESAIPIVMLTGRAEEADRVMGLELGADDYLTKPFSPRELLARIRTILRRRRAEIHQGKPEGIRAYRFDGWELNLNTRRLVSAQGKPVELSNGEFSLLVVLLGAPNRILSRDQLLDLSRLHNDEVYNRSIDVQILRLRRKIEADPAEPRYIRTERGAGYVFGVAVETVY

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
167 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 0.71
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10067654 3300005328 Bacteria 2136
2 Ga0070670_100004249 3300005331 Bacteria 11983
3 Ga0070677_10071234 3300005333 Bacteria 1463
4 Ga0068869_100152577 3300005334 Bacteria 1793
5 Ga0070666_10151603 3300005335 Bacteria 1617
6 Ga0070680_100021448 3300005336 Bacteria 5134
7 Ga0070680_100025676 3300005336 Bacteria 4710
8 Ga0070680_100030486 3300005336 Bacteria 4332
9 Ga0068868_100040359 3300005338 Bacteria 3633
10 Ga0070689_100009885 3300005340 Bacteria 6784
11 Ga0070689_100119992 3300005340 Bacteria 2099
12 Ga0070689_100187126 3300005340 Bacteria 1685
13 Ga0070691_10028268 3300005341 Bacteria 2618
14 Ga0070687_100147289 3300005343 Bacteria 1378
15 Ga0070661_100131085 3300005344 Bacteria 1883
16 Ga0070692_10001386 3300005345 Bacteria 8761
17 Ga0070692_10026350 3300005345 Bacteria 2873
18 Ga0070692_10044704 3300005345 Bacteria 2282
19 Ga0070669_100005886 3300005353 Bacteria 8846
20 Ga0070675_100012416 3300005354 Bacteria 6673
21 Ga0070675_100037921 3300005354 Bacteria 3927
22 Ga0070674_100096857 3300005356 Bacteria 2142
23 Ga0070673_100253418 3300005364 Bacteria 1535
24 Ga0070688_100094753 3300005365 Bacteria 1958
25 Ga0070659_100126681 3300005366 Bacteria 2072
26 Ga0070703_10065618 3300005406 Bacteria 1199
27 Ga0070701_10001096 3300005438 Bacteria 9882
28 Ga0070705_100121401 3300005440 Bacteria 1688
29 Ga0070705_100161131 3300005440 Bacteria 1500
30 Ga0070700_100001918 3300005441 Bacteria 10510
31 Ga0070700_100006702 3300005441 Bacteria 6169
32 Ga0070694_100001452 3300005444 Bacteria 13894
33 Ga0070694_100037974 3300005444 Bacteria 3197
34 Ga0070694_100087864 3300005444 Bacteria 2175
35 Ga0070708_100019014 3300005445 Bacteria 5761
36 Ga0070662_100234312 3300005457 Bacteria 1470
37 Ga0070681_10083107 3300005458 Bacteria 3156
38 Ga0068867_100000710 3300005459 Bacteria 22213
39 Ga0070706_100139499 3300005467 Bacteria 2263
40 Ga0070698_100714224 3300005471 Bacteria 945
41 Ga0070699_100031426 3300005518 Bacteria 4584
42 Ga0070699_100129441 3300005518 Bacteria 2225
43 Ga0070697_100077002 3300005536 Bacteria 2743
44 Ga0070672_100031405 3300005543 Bacteria 3997
45 Ga0070686_100006853 3300005544 Bacteria 6344
46 Ga0070695_100092245 3300005545 Bacteria 2024
47 Ga0070695_100106288 3300005545 Bacteria 1898
48 Ga0070696_100000365 3300005546 Bacteria 27637
49 Ga0070696_100001987 3300005546 Bacteria 13431
50 Ga0070696_100012794 3300005546 Bacteria 5634
51 Ga0070693_100001304 3300005547 Bacteria 11223
52 Ga0070693_100108699 3300005547 Bacteria 1702
53 Ga0070693_100111545 3300005547 Bacteria 1683
54 Ga0070704_100215587 3300005549 Bacteria 1558
55 Ga0068855_100022689 3300005563 Bacteria 7520
56 Ga0068854_100002726 3300005578 Bacteria 10963
57 Ga0068854_100490584 3300005578 Bacteria 1033
58 Ga0068856_100068590 3300005614 Bacteria 3506
59 Ga0068856_100107457 3300005614 Bacteria 2786
60 Ga0070702_100001395 3300005615 Bacteria 9870
61 Ga0068852_100094024 3300005616 Bacteria 2688
62 Ga0068864_100190254 3300005618 Bacteria 1881
63 Ga0068864_100365410 3300005618 Bacteria 1364
64 Ga0068866_10001256 3300005718 Bacteria 10981
65 Ga0068861_100007236 3300005719 Bacteria 7604
66 Ga0068861_100047848 3300005719 Bacteria 3230
67 Ga0068851_10041768 3300005834 Bacteria 2307
68 Ga0068870_10021799 3300005840 Bacteria 3140
69 Ga0068863_100151287 3300005841 Bacteria 2220
70 Ga0068858_100006080 3300005842 Bacteria 11775
71 Ga0068860_100007085 3300005843 Bacteria 11215
72 Ga0068860_100776610 3300005843 Bacteria 971
73 Ga0068862_100009009 3300005844 Bacteria 8260
74 Ga0081455_10005375 3300005937 Bacteria 14062
75 Ga0081539_10003064 3300005985 Bacteria 21557
76 Ga0070715_10310718 3300006163 Bacteria 847
77 Ga0068871_100012186 3300006358 Bacteria 6330
78 Ga0068871_100013596 3300006358 Bacteria 6044
79 Ga0075428_100001710 3300006844 Bacteria 23433
80 Ga0075428_100003689 3300006844 Bacteria 16791
81 Ga0075428_100006706 3300006844 Bacteria 12806
82 Ga0075428_100351397 3300006844 Bacteria 1582
83 Ga0075430_100000290 3300006846 Bacteria 35396
84 Ga0075430_100000673 3300006846 Bacteria 26104
85 Ga0075430_100063875 3300006846 Bacteria 3092
86 Ga0075430_100075714 3300006846 Bacteria 2821
87 Ga0075431_100016230 3300006847 Bacteria 7555
88 Ga0075431_100074091 3300006847 Bacteria 3513
89 Ga0075431_100217287 3300006847 Bacteria 1951
90 Ga0075433_10013801 3300006852 Bacteria 6583
91 Ga0075434_100023219 3300006871 Bacteria 6043
92 Ga0075434_100610542 3300006871 Bacteria 1110
93 Ga0075429_100000745 3300006880 Bacteria 25575
94 Ga0075429_100048656 3300006880 Bacteria 3686
95 Ga0068865_100007839 3300006881 Bacteria 6590
96 Ga0075436_100001134 3300006914 Bacteria 18009
97 Ga0075436_100002669 3300006914 Bacteria 12264
98 Ga0075436_100003033 3300006914 Bacteria 11504
99 Ga0075436_100018004 3300006914 Bacteria 4838
100 Ga0075436_100051129 3300006914 Bacteria 2852
101 Ga0075435_100018225 3300007076 Bacteria 5332
102 Ga0075435_100051665 3300007076 Bacteria 3311
103 Ga0075435_100060443 3300007076 Bacteria 3072
104 Ga0099794_10006521 3300007265 Bacteria 4734
105 Ga0099794_10036244 3300007265 Bacteria 2331
106 Ga0099794_10093414 3300007265 Bacteria 1495
107 Ga0099794_10145309 3300007265 Bacteria 1202
108 Ga0099795_10106887 3300007788 Bacteria 1104
109 Ga0105240_10425417 3300009093 Bacteria 1491
110 Ga0111539_10011559 3300009094 Bacteria 11080
111 Ga0111539_10014565 3300009094 Bacteria 9818
112 Ga0111539_10038095 3300009094 Bacteria 5800
113 Ga0111539_10152470 3300009094 Bacteria 2705
114 Ga0111539_10192683 3300009094 Bacteria 2378
115 Ga0105245_10001883 3300009098 Bacteria 19039
116 Ga0105245_11149223 3300009098 Bacteria 823
117 Ga0114129_10080092 3300009147 Bacteria 4540
118 Ga0114129_10190115 3300009147 Bacteria 2788
119 Ga0114129_10200876 3300009147 Bacteria 2700
120 Ga0114129_10263701 3300009147 Bacteria 2308
121 Ga0105243_10125571 3300009148 Bacteria 2170
122 Ga0105241_10052978 3300009174 Bacteria 3101
123 Ga0105241_10417212 3300009174 Bacteria 1180
124 Ga0105242_10020835 3300009176 Bacteria 5143
125 Ga0105248_10079475 3300009177 Bacteria 3686
126 Ga0105248_10360667 3300009177 Bacteria 1636
127 Ga0105238_10134243 3300009551 Bacteria 2453
128 Ga0105249_10005590 3300009553 Bacteria 10869
129 Ga0105249_10037952 3300009553 Bacteria 4372
130 Ga0105239_10033405 3300010375 Bacteria 5650
131 Ga0157378_10005928 3300013297 Bacteria 10709
132 Ga0157378_10956535 3300013297 Bacteria 889
133 Ga0163162_10166369 3300013306 Bacteria 2329
134 Ga0163162_10673793 3300013306 Bacteria 1157
135 Ga0157380_10025901 3300014326 Bacteria 4450
136 Ga0182008_10000113 3300014497 Bacteria 61507
137 Ga0157376_10046254 3300014969 Bacteria 3588
138 Ga0182006_1048270 3300015261 Bacteria 1647
139 Ga0182007_10000575 3300015262 Bacteria 21620
140 Ga0182005_1026452 3300015265 Bacteria 1584
141 Ga0207697_10100379 3300025315 Bacteria 1233
142 Ga0207656_10002197 3300025321 Bacteria 6531
143 Ga0207653_10075295 3300025885 Bacteria 1160
144 Ga0207642_10007526 3300025899 Bacteria 3684
145 Ga0207688_10144874 3300025901 Bacteria 1400
146 Ga0207645_10012487 3300025907 Bacteria 5760
147 Ga0207643_10020168 3300025908 Bacteria 3657
148 Ga0207684_10116427 3300025910 Bacteria 2290
149 Ga0207684_10140019 3300025910 Bacteria 2079
150 Ga0207654_10012806 3300025911 Bacteria 4304
151 Ga0207707_10160485 3300025912 Bacteria 1966
152 Ga0207660_10007883 3300025917 Bacteria 6893
153 Ga0207662_10000052 3300025918 Bacteria 50640
154 Ga0207662_10105753 3300025918 Bacteria 1749
155 Ga0207649_10127066 3300025920 Bacteria 1727
156 Ga0207681_10002941 3300025923 Bacteria 10751
157 Ga0207681_10460857 3300025923 Bacteria 1035
158 Ga0207650_10021377 3300025925 Bacteria 4572
159 Ga0207659_10006731 3300025926 Bacteria 7061
160 Ga0207659_10030569 3300025926 Bacteria 3681
161 Ga0207687_10007853 3300025927 Bacteria 6994
162 Ga0207706_10066192 3300025933 Bacteria 3180
163 Ga0207686_10082426 3300025934 Bacteria 2102
164 Ga0207709_10015104 3300025935 Bacteria 4278
165 Ga0207670_10005456 3300025936 Bacteria 6978
166 Ga0207704_10001239 3300025938 Bacteria 11377
167 Ga0207665_10190174 3300025939 Bacteria 1491
168 Ga0207665_10316178 3300025939 Bacteria 1170
169 Ga0207665_10512992 3300025939 Bacteria 927
170 Ga0207691_10045999 3300025940 Bacteria 4012
171 Ga0207691_10053201 3300025940 Bacteria 3697
172 Ga0207711_10036073 3300025941 Bacteria 4194
173 Ga0207711_10244612 3300025941 Bacteria 1646
174 Ga0207689_10000447 3300025942 Bacteria 38790
175 Ga0207689_10021384 3300025942 Bacteria 5440
176 Ga0207679_10204976 3300025945 Bacteria 1650
177 Ga0207667_10009076 3300025949 Bacteria 11758
178 Ga0207667_10703436 3300025949 Bacteria 1013
179 Ga0207651_10054262 3300025960 Bacteria 2745
180 Ga0207712_10028152 3300025961 Bacteria 3757
181 Ga0207712_10165357 3300025961 Bacteria 1724
182 Ga0207668_10029664 3300025972 Bacteria 3587
183 Ga0207640_10009443 3300025981 Bacteria 5463
184 Ga0207640_10386800 3300025981 Bacteria 1135
185 Ga0207677_10026639 3300026023 Bacteria 3630
186 Ga0207677_10027047 3300026023 Bacteria 3606
187 Ga0207703_10014976 3300026035 Bacteria 6052
188 Ga0207639_10106100 3300026041 Bacteria 2280
189 Ga0207708_10000209 3300026075 Bacteria 46480
190 Ga0207708_10591458 3300026075 Bacteria 939
191 Ga0207702_10141480 3300026078 Bacteria 2178
192 Ga0207702_10494738 3300026078 Bacteria 1191
193 Ga0207702_10594999 3300026078 Bacteria 1085
194 Ga0207648_10000386 3300026089 Bacteria 48841
195 Ga0207648_10000431 3300026089 Bacteria 46287
196 Ga0207676_10086724 3300026095 Bacteria 2558
197 Ga0207676_10333226 3300026095 Bacteria 1397
198 Ga0207675_100000443 3300026118 Bacteria 40373
199 Ga0207675_100006922 3300026118 Bacteria 10729
200 Ga0207675_100292757 3300026118 Bacteria 1584
201 Ga0207683_10117871 3300026121 Bacteria 2381
202 Ga0207698_10058683 3300026142 Bacteria 2984
203 Ga0207698_10069952 3300026142 Bacteria 2778
204 Ga0209969_1001207 3300027360 Bacteria 3556
205 Ga0209967_1002777 3300027364 Bacteria 2280
206 Ga0209981_1004250 3300027378 Bacteria 1874
207 Ga0210000_1000692 3300027462 Bacteria 4677
208 Ga0209968_1013225 3300027526 Bacteria 1293
209 Ga0209999_1005698 3300027543 Bacteria 2239
210 Ga0209588_1046042 3300027671 Bacteria 1411
211 Ga0209971_1014000 3300027682 Bacteria 1901
212 Ga0209966_1000793 3300027695 Bacteria 6333
213 Ga0207428_10009403 3300027907 Bacteria 8766
214 Ga0207428_10018198 3300027907 Bacteria 6007
215 Ga0207428_10132363 3300027907 Bacteria 1907
216 Ga0268265_10002339 3300028380 Bacteria 14386
217 Ga0268265_10093203 3300028380 Bacteria 2412
218 Ga0268264_10044437 3300028381 Bacteria 3685
219 Ga0268264_10544864 3300028381 Bacteria 1137
220 Ga0307515_10337885 3300028794 Bacteria 1160
221 Ga0265316_10095559 3300031344 Bacteria 2263
222 Ga0307513_10019885 3300031456 Bacteria 7978
223 Ga0307408_100036908 3300031548 Bacteria 3439
224 Ga0307408_100141421 3300031548 Bacteria 1889
225 Ga0307405_10075385 3300031731 Bacteria 2185
226 Ga0307409_100000230 3300031995 Bacteria 22510
227 Ga0307416_100009392 3300032002 Bacteria 6398
228 Ga0373948_0012419 3300034817 Bacteria 1520
229 Ga0373950_0024349 3300034818 Bacteria 1088
230 Ga0373958_0006947 3300034819 Bacteria 1785
231 Ga0373926_0152682 3300035083 Bacteria 879
232 Ga0373928_0008197 3300035084 Bacteria 2025
233 Ga0373940_0001221 3300035088 Bacteria 4541
234 Ga0373952_0019334 3300035092 Bacteria 1417
235 Ga0373923_0095864 3300035111 Bacteria 1303
236 Ga0373932_0023058 3300035112 Bacteria 1660
237 Ga0373945_0015754 3300035116 Bacteria 2546
238 Ga0373943_0019735 3300035170 Bacteria 3102
239 Ga0373946_0004787 3300035171 Bacteria 4871
240 Ga0373942_0003671 3300035207 Bacteria 3600
241 Ga0373942_0011113 3300035207 Bacteria 2129
242 Ga0373961_0015549 3300035241 Bacteria 1948
243 Ga0373924_0004837 3300035410 Bacteria 4734
244 Ga0373924_0029656 3300035410 Bacteria 2188
245 Ga0373931_0024247 3300035691 Bacteria 3071
246 Ga0373931_0053326 3300035691 Bacteria 2157
247 Ga0373927_0340141 3300035695 Bacteria 988
248 Ga0373933_0105486 3300035724 Bacteria 1753
249 Ga0373925_0243230 3300037068 Bacteria 1441
250 Ga0439441_003364 3300042001 Bacteria 2353
251 Ga0450913_003918 3300042117 Bacteria 999
252 Ga0439446_0014945 3300042156 Bacteria 2148
253 Ga0439446_0085536 3300042156 Bacteria 981
254 Ga0439435_0000448 3300042436 Bacteria 6475
255 Ga0439435_0004549 3300042436 Bacteria 2998
256 Ga0439435_0033895 3300042436 Bacteria 1401
257 Ga0439460_0023248 3300042461 Bacteria 1707
258 Ga0450893_0014398 3300042532 Bacteria 1326
259 Ga0451577_0018965 3300042876 Bacteria 6333
260 Ga0466972_0106454 3300044658 Unclassified 1326
261 Ga0451576_0001772 3300045051 Bacteria 35352
262 Ga0495603_0006156 3300046455 Bacteria 7174
263 Ga0495603_0006754 3300046455 Bacteria 6885
264 Ga0495651_0179729 3300046462 Bacteria 1498
265 Ga0495580_0005855 3300046472 Bacteria 10087
266 Ga0495580_0017099 3300046472 Bacteria 5432
267 Ga0495582_0009220 3300046473 Bacteria 5443
268 Ga0495639_0035106 3300046475 Bacteria 2243
269 Ga0495628_0090463 3300046516 Bacteria 2369
270 Ga0495644_0093494 3300046523 Bacteria 1136
271 Ga0495648_0043778 3300046524 Bacteria 2802
272 Ga0495666_0019721 3300046526 Bacteria 3344
273 Ga0495642_0062069 3300046528 Bacteria 1552
274 Ga0495652_0001775 3300046529 Bacteria 23036
275 Ga0495665_0000698 3300046531 Bacteria 17261
276 Ga0495665_0072694 3300046531 Bacteria 1811
277 Ga0495586_0004334 3300046535 Bacteria 7580
278 Ga0495586_0007163 3300046535 Bacteria 5945
279 Ga0495598_0030487 3300046537 Bacteria 1511
280 Ga0495645_0103519 3300046543 Bacteria 2022
281 Ga0495667_0395192 3300046559 Bacteria 871
282 Ga0495588_0013661 3300046674 Bacteria 3870
283 Ga0495599_0266199 3300046678 Bacteria 1041
284 Ga0495646_0062822 3300046680 Bacteria 2207
285 Ga0495647_0013374 3300046681 Bacteria 2843
286 Ga0495658_0002156 3300046683 Bacteria 9965
287 Ga0495674_0002182 3300047319 Bacteria 19228
288 Ga0495676_0036993 3300047321 Bacteria 4069
289 Ga0495676_0258995 3300047321 Bacteria 1184
290 Ga0495602_0016989 3300048088 Bacteria 7301
291 Ga0495602_0401151 3300048088 Bacteria 978
292 Ga0495614_0027429 3300048089 Bacteria 2456
293 Ga0496105_0182095 3300048908 Bacteria 1720
294 Ga0496106_0249224 3300048909 Bacteria 1420
295 Ga0496108_0360649 3300048911 Bacteria 1269
296 Ga0501031_0011874 3300049568 Bacteria 5678
297 Ga0501032_0035394 3300049569 Bacteria 3414
298 Ga0501033_0021323 3300049570 Bacteria 4887
299 Ga0501036_0024832 3300049572 Bacteria 5053
300 Ga0501036_0292320 3300049572 Bacteria 1363
301 Ga0501036_0603402 3300049572 Bacteria 910
302 Ga0501037_0073876 3300049573 Bacteria 2479
303 Ga0501037_0091718 3300049573 Bacteria 2197
304 Ga0501038_0030709 3300049574 Bacteria 4750
305 Ga0501038_0102805 3300049574 Bacteria 2377
306 Ga0501039_0003908 3300049575 Bacteria 11194
307 Ga0501039_0006093 3300049575 Bacteria 9156
308 Ga0501039_0103563 3300049575 Bacteria 2222
309 Ga0501039_0107056 3300049575 Bacteria 2184
310 Ga0501039_0118703 3300049575 Bacteria 2072
311 Ga0501039_0159418 3300049575 Bacteria 1773
312 Ga0501040_0016376 3300049576 Bacteria 4907
313 Ga0501040_0021146 3300049576 Bacteria 4340
314 Ga0501040_0030311 3300049576 Bacteria 3654
315 Ga0501040_0083198 3300049576 Bacteria 2220
316 Ga0501041_0014191 3300049577 Bacteria 4729
317 Ga0501041_0058815 3300049577 Bacteria 2352
318 Ga0501041_0078547 3300049577 Bacteria 2031
319 Ga0501041_0098525 3300049577 Bacteria 1808
320 Ga0501041_0169556 3300049577 Bacteria 1366
321 Ga0501042_0044529 3300049578 Bacteria 3162
322 Ga0501042_0054695 3300049578 Bacteria 2847
323 Ga0501042_0103618 3300049578 Bacteria 2047
324 Ga0501042_0215673 3300049578 Bacteria 1384
325 Ga0501042_0612161 3300049578 Bacteria 792
326 Ga0501043_0067823 3300049579 Bacteria 2801
327 Ga0501046_0036077 3300049580 Bacteria 3980
328 Ga0501046_0117511 3300049580 Bacteria 2026
329 Ga0501047_0942111 3300049581 Bacteria 677
330 Ga0501048_0013439 3300049582 Bacteria 6076
331 Ga0501048_0084942 3300049582 Bacteria 2232
332 Ga0501048_0310818 3300049582 Bacteria 1122
333 Ga0501068_0105956 3300049584 Bacteria 1745
334 Ga0501068_0150759 3300049584 Bacteria 1461
335 Ga0501068_0166571 3300049584 Bacteria 1390
336 Ga0501070_0201399 3300049586 Bacteria 1635
337 Ga0501071_0011417 3300049587 Bacteria 5984
338 Ga0501071_0032500 3300049587 Bacteria 3705
339 Ga0501071_0261564 3300049587 Bacteria 1307
340 Ga0501072_0007007 3300049588 Bacteria 8557
341 Ga0501072_0014814 3300049588 Bacteria 5979
342 Ga0501072_0076564 3300049588 Bacteria 2647
343 Ga0501072_0077614 3300049588 Bacteria 2629
344 Ga0501072_0177615 3300049588 Bacteria 1698
345 Ga0501073_0071361 3300049589 Bacteria 2420
346 Ga0501073_0325892 3300049589 Bacteria 1060
347 Ga0501074_0025155 3300049590 Bacteria 4325
348 Ga0501074_0365136 3300049590 Bacteria 1024
349 Ga0501075_0012958 3300049591 Bacteria 5940
350 Ga0501075_0017685 3300049591 Bacteria 5149
351 Ga0501075_0021354 3300049591 Bacteria 4717
352 Ga0501075_0098968 3300049591 Bacteria 2214
353 Ga0501075_0273586 3300049591 Bacteria 1287
354 Ga0501076_0014204 3300049592 Bacteria 5992
355 Ga0501076_0029745 3300049592 Bacteria 4250
356 Ga0501076_0352661 3300049592 Bacteria 1208
357 Ga0501076_0368759 3300049592 Bacteria 1180
358 Ga0501077_0006033 3300049593 Bacteria 7399
359 Ga0501077_0090524 3300049593 Bacteria 1939
360 Ga0501079_0014450 3300049741 Bacteria 6019
361 Ga0501079_0017635 3300049741 Bacteria 5452
362 Ga0501080_0016201 3300049742 Bacteria 6881
363 Ga0501080_0028019 3300049742 Bacteria 5239
364 Ga0501080_0035690 3300049742 Bacteria 4641
365 Ga0501081_0008564 3300049743 Bacteria 6646
366 Ga0501083_0181050 3300049744 Bacteria 1376
367 Ga0501083_0233142 3300049744 Bacteria 1199
368 Ga0501035_0451738 3300049822 Bacteria 1063
369 Ga0501044_0329918 3300049823 Bacteria 1449
370 Ga0501045_0005879 3300049824 Bacteria 8488
371 Ga0501045_0080757 3300049824 Bacteria 2398
372 Ga0501045_0120225 3300049824 Bacteria 1950
373 nmdc:mga03683_61775_c1 3300050489 Bacteria 1585
374 nmdc:mga05p37_159590_c1 3300050507 Bacteria 2754
375 nmdc:mga05p37_258101_c1 3300050507 Bacteria 2087
376 nmdc:mga05p37_316266_c1 3300050507 Bacteria 1849
377 nmdc:mga05p37_8266_c1 3300050507 Bacteria 12304
378 nmdc:mga09592_102052_c1 3300050508 Bacteria 2458
379 nmdc:mga09592_18384_c1 3300050508 Bacteria 5733
380 nmdc:mga09592_41790_c1 3300050508 Bacteria 3856
381 nmdc:mga09592_568448_c1 3300050508 Bacteria 973
382 nmdc:mga09592_9992_c1 3300050508 Bacteria 7719
383 nmdc:mga0qj67_176802_c1 3300050509 Bacteria 1733
384 nmdc:mga0qj67_29789_c1 3300050509 Bacteria 3106
385 nmdc:mga0qj67_47819_c1 3300050509 Bacteria 3380
386 nmdc:mga0qj67_585_c1 3300050509 Bacteria 24826
387 nmdc:mga06r32_13524_c1 3300050510 Bacteria 7396
388 nmdc:mga06r32_188912_c1 3300050510 Bacteria 2047
389 nmdc:mga06r32_218071_c1 3300050510 Bacteria 1896
390 nmdc:mga06r32_28864_c1 3300050510 Bacteria 5194
391 nmdc:mga08y16_120288_c1 3300050511 Bacteria 2733
392 nmdc:mga08y16_36647_c1 3300050511 Bacteria 5151
393 nmdc:mga08y16_385680_c1 3300050511 Bacteria 1436
394 nmdc:mga08y16_409111_c1 3300050511 Bacteria 1388
395 nmdc:mga08y16_8745_c1 3300050511 Bacteria 10623
396 nmdc:mga0n895_216342_c1 3300050512 Bacteria 1946
397 nmdc:mga0n895_367627_c1 3300050512 Bacteria 1456
398 nmdc:mga0n895_5948_c1 3300050512 Bacteria 10264
399 nmdc:mga0rr50_336063_c1 3300050513 Bacteria 1269
400 nmdc:mga0rr50_37313_c1 3300050513 Bacteria 3507
401 nmdc:mga0rr50_9655_c1 3300050513 Bacteria 6082
402 nmdc:mga08x19_2444_c1 3300050514 Bacteria 11285
403 nmdc:mga08x19_41786_c1 3300050514 Bacteria 2920
404 nmdc:mga08x19_565_c1 3300050514 Bacteria 24233
405 nmdc:mga08x19_7204_c1 3300050514 Bacteria 6606
406 nmdc:mga0a205_315007_c1 3300050515 Bacteria 1436
407 nmdc:mga0a205_5613_c1 3300050515 Bacteria 11302
408 Ga0500644_0002123 3300053088 Bacteria 5021
409 Ga0500644_0003466 3300053088 Bacteria 3902
410 Ga0500568_0010282 3300053139 Bacteria 4391
411 Ga0501084_0029538 3300054114 Bacteria 4585
412 Ga0501084_0136471 3300054114 Bacteria 2065
413 Ga0501084_0293713 3300054114 Bacteria 1372
414 Ga0501084_0550660 3300054114 Bacteria 975
415 Ga0501082_0046150 3300060353 Bacteria 3756
416 Ga0501082_0277855 3300060353 Bacteria 1458
417 Ga0530510_0004722 3300061734 Bacteria 9424
418 Ga0530510_0031028 3300061734 Bacteria 3841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0942111 Ga0501047_0942111_13_609 197
2 3300025939 Ga0207665_10512992 Ga0207665_105129922 216
3 3300025923 Ga0207681_10460857 Ga0207681_104608572 219
4 3300044658 Ga0466972_0106454 Ga0466972_0106454_67_768 232
5 3300049575 Ga0501039_0003908 Ga0501039_0003908_4635_5339 234
6 3300049576 Ga0501040_0021146 Ga0501040_0021146_2788_3492 234
7 3300049578 Ga0501042_0044529 Ga0501042_0044529_118_822 234
8 3300049582 Ga0501048_0084942 Ga0501048_0084942_203_907 234
9 3300049586 Ga0501070_0201399 Ga0501070_0201399_898_1602 234
10 3300049588 Ga0501072_0014814 Ga0501072_0014814_2055_2759 234
11 3300049591 Ga0501075_0012958 Ga0501075_0012958_4077_4781 234
12 3300049741 Ga0501079_0017635 Ga0501079_0017635_1286_1990 234
13 3300049742 Ga0501080_0028019 Ga0501080_0028019_1357_2061 234
14 3300060353 Ga0501082_0277855 Ga0501082_0277855_455_1159 234
15 3300061734 Ga0530510_0004722 Ga0530510_0004722_3053_3757 234
16 3300061734 Ga0530510_0031028 Ga0530510_0031028_34_738 234
17 3300031548 Ga0307408_100036908 Ga0307408_1000369084 235
18 3300031731 Ga0307405_10075385 Ga0307405_100753852 235
19 3300031995 Ga0307409_100000230 Ga0307409_10000023015 235
20 3300032002 Ga0307416_100009392 Ga0307416_1000093925 235
21 3300005444 Ga0070694_100037974 Ga0070694_1000379748 236
22 3300031344 Ga0265316_10095559 Ga0265316_100955592 236
23 3300005331 Ga0070670_100004249 Ga0070670_10000424911 237
24 3300005354 Ga0070675_100012416 Ga0070675_1000124164 237
25 3300005364 Ga0070673_100253418 Ga0070673_1002534182 237
26 3300005543 Ga0070672_100031405 Ga0070672_1000314052 237
27 3300005618 Ga0068864_100190254 Ga0068864_1001902543 237
28 3300006846 Ga0075430_100063875 Ga0075430_1000638753 237
29 3300009177 Ga0105248_10079475 Ga0105248_100794752 237
30 3300013306 Ga0163162_10166369 Ga0163162_101663693 237
31 3300025315 Ga0207697_10100379 Ga0207697_101003791 237
32 3300025925 Ga0207650_10021377 Ga0207650_100213773 237
33 3300025926 Ga0207659_10006731 Ga0207659_100067317 237
34 3300025940 Ga0207691_10045999 Ga0207691_100459992 237
35 3300025941 Ga0207711_10036073 Ga0207711_100360731 237
36 3300025960 Ga0207651_10054262 Ga0207651_100542622 237
37 3300026095 Ga0207676_10333226 Ga0207676_103332262 237
38 3300050509 nmdc:mga0qj67_29789_c1 nmdc:mga0qj67_29789_c1_1564_2307 237
39 3300027671 Ga0209588_1046042 Ga0209588_10460422 238
40 3300042156 Ga0439446_0085536 Ga0439446_0085536_126_842 238
41 3300046523 Ga0495644_0093494 Ga0495644_0093494_335_1054 239
42 3300050489 nmdc:mga03683_61775_c1 nmdc:mga03683_61775_c1_667_1386 239
43 3300049574 Ga0501038_0030709 Ga0501038_0030709_184_906 240
44 3300031548 Ga0307408_100141421 Ga0307408_1001414213 241
45 3300046559 Ga0495667_0395192 Ga0495667_0395192_123_848 241
46 3300049573 Ga0501037_0073876 Ga0501037_0073876_851_1579 241
47 3300049574 Ga0501038_0102805 Ga0501038_0102805_812_1540 241
48 3300049575 Ga0501039_0159418 Ga0501039_0159418_293_1021 241
49 3300049577 Ga0501041_0058815 Ga0501041_0058815_1459_2187 241
50 3300049578 Ga0501042_0215673 Ga0501042_0215673_534_1262 241
51 3300049591 Ga0501075_0273586 Ga0501075_0273586_38_766 241
52 3300049592 Ga0501076_0368759 Ga0501076_0368759_421_1149 241
53 3300049822 Ga0501035_0451738 Ga0501035_0451738_140_868 241
54 3300053139 Ga0500568_0010282 Ga0500568_0010282_1840_2568 241
55 3300006846 Ga0075430_100000290 Ga0075430_10000029023 242
56 3300006847 Ga0075431_100217287 Ga0075431_1002172873 242
57 3300050508 nmdc:mga09592_568448_c1 nmdc:mga09592_568448_c1_179_910 242
58 3300050509 nmdc:mga0qj67_585_c1 nmdc:mga0qj67_585_c1_11240_11968 242
59 3300050510 nmdc:mga06r32_218071_c1 nmdc:mga06r32_218071_c1_699_1427 242
60 3300005333 Ga0070677_10071234 Ga0070677_100712342 244
61 3300006846 Ga0075430_100000673 Ga0075430_10000067314 244
62 3300006847 Ga0075431_100016230 Ga0075431_1000162305 244
63 3300050510 nmdc:mga06r32_13524_c1 nmdc:mga06r32_13524_c1_389_1126 244
64 3300005338 Ga0068868_100040359 Ga0068868_1000403593 245
65 3300005616 Ga0068852_100094024 Ga0068852_1000940242 245
66 3300005834 Ga0068851_10041768 Ga0068851_100417682 245
67 3300006358 Ga0068871_100013596 Ga0068871_1000135962 245
68 3300009093 Ga0105240_10425417 Ga0105240_104254172 245
69 3300009551 Ga0105238_10134243 Ga0105238_101342432 245
70 3300025321 Ga0207656_10002197 Ga0207656_1000219710 245
71 3300025981 Ga0207640_10386800 Ga0207640_103868001 245
72 3300026023 Ga0207677_10027047 Ga0207677_100270474 245
73 3300026142 Ga0207698_10069952 Ga0207698_100699522 245
74 3300048908 Ga0496105_0182095 Ga0496105_0182095_644_1402 245
75 3300046524 Ga0495648_0043778 Ga0495648_0043778_1839_2579 246
76 3300005366 Ga0070659_100126681 Ga0070659_1001266813 247
77 3300005614 Ga0068856_100068590 Ga0068856_1000685901 247
78 3300005937 Ga0081455_10005375 Ga0081455_1000537510 247
79 3300009174 Ga0105241_10417212 Ga0105241_104172122 247
80 3300014497 Ga0182008_10000113 Ga0182008_1000011347 247
81 3300014497 Ga0182008_10000113 Ga0182008_1000011352 247
82 3300015261 Ga0182006_1048270 Ga0182006_10482702 247
83 3300015262 Ga0182007_10000575 Ga0182007_100005751 247
84 3300015262 Ga0182007_10000575 Ga0182007_100005756 247
85 3300015265 Ga0182005_1026452 Ga0182005_10264521 247
86 3300025949 Ga0207667_10703436 Ga0207667_107034361 247
87 3300026078 Ga0207702_10594999 Ga0207702_105949991 247
88 3300053088 Ga0500644_0002123 Ga0500644_0002123_2183_2929 247
89 3300053088 Ga0500644_0003466 Ga0500644_0003466_2310_3056 247
90 3300005343 Ga0070687_100147289 Ga0070687_1001472892 248
91 3300007265 Ga0099794_10093414 Ga0099794_100934143 248
92 3300009094 Ga0111539_10038095 Ga0111539_100380956 248
93 3300009098 Ga0105245_11149223 Ga0105245_111492231 248
94 3300028794 Ga0307515_10337885 Ga0307515_103378851 248
95 3300031456 Ga0307513_10019885 Ga0307513_100198855 248
96 3300046455 Ga0495603_0006156 Ga0495603_0006156_2825_3592 248
97 3300046472 Ga0495580_0017099 Ga0495580_0017099_99_866 248
98 3300046516 Ga0495628_0090463 Ga0495628_0090463_976_1743 248
99 3300046526 Ga0495666_0019721 Ga0495666_0019721_2328_3095 248
100 3300046529 Ga0495652_0001775 Ga0495652_0001775_9193_9960 248
101 3300046531 Ga0495665_0000698 Ga0495665_0000698_9652_10419 248
102 3300046535 Ga0495586_0007163 Ga0495586_0007163_3866_4633 248
103 3300046543 Ga0495645_0103519 Ga0495645_0103519_158_925 248
104 3300046678 Ga0495599_0266199 Ga0495599_0266199_149_916 248
105 3300046680 Ga0495646_0062822 Ga0495646_0062822_646_1413 248
106 3300047319 Ga0495674_0002182 Ga0495674_0002182_15903_16670 248
107 3300047321 Ga0495676_0258995 Ga0495676_0258995_34_801 248
108 3300048088 Ga0495602_0016989 Ga0495602_0016989_4602_5369 248
109 3300048089 Ga0495614_0027429 Ga0495614_0027429_115_882 248
110 3300048909 Ga0496106_0249224 Ga0496106_0249224_481_1227 248
111 3300005328 Ga0070676_10067654 Ga0070676_100676543 249
112 3300005334 Ga0068869_100152577 Ga0068869_1001525773 249
113 3300005335 Ga0070666_10151603 Ga0070666_101516032 249
114 3300005336 Ga0070680_100021448 Ga0070680_1000214483 249
115 3300005336 Ga0070680_100025676 Ga0070680_1000256763 249
116 3300005336 Ga0070680_100030486 Ga0070680_1000304865 249
117 3300005340 Ga0070689_100009885 Ga0070689_1000098859 249
118 3300005340 Ga0070689_100119992 Ga0070689_1001199922 249
119 3300005340 Ga0070689_100187126 Ga0070689_1001871262 249
120 3300005341 Ga0070691_10028268 Ga0070691_100282683 249
121 3300005344 Ga0070661_100131085 Ga0070661_1001310852 249
122 3300005345 Ga0070692_10001386 Ga0070692_100013868 249
123 3300005345 Ga0070692_10026350 Ga0070692_100263502 249
124 3300005345 Ga0070692_10044704 Ga0070692_100447043 249
125 3300005353 Ga0070669_100005886 Ga0070669_10000588610 249
126 3300005354 Ga0070675_100037921 Ga0070675_1000379213 249
127 3300005356 Ga0070674_100096857 Ga0070674_1000968573 249
128 3300005365 Ga0070688_100094753 Ga0070688_1000947532 249
129 3300005406 Ga0070703_10065618 Ga0070703_100656182 249
130 3300005438 Ga0070701_10001096 Ga0070701_100010969 249
131 3300005440 Ga0070705_100121401 Ga0070705_1001214012 249
132 3300005440 Ga0070705_100161131 Ga0070705_1001611312 249
133 3300005441 Ga0070700_100001918 Ga0070700_1000019189 249
134 3300005441 Ga0070700_100006702 Ga0070700_1000067023 249
135 3300005444 Ga0070694_100001452 Ga0070694_10000145211 249
136 3300005444 Ga0070694_100087864 Ga0070694_1000878641 249
137 3300005445 Ga0070708_100019014 Ga0070708_1000190143 249
138 3300005457 Ga0070662_100234312 Ga0070662_1002343122 249
139 3300005458 Ga0070681_10083107 Ga0070681_100831072 249
140 3300005459 Ga0068867_100000710 Ga0068867_10000071018 249
141 3300005467 Ga0070706_100139499 Ga0070706_1001394992 249
142 3300005471 Ga0070698_100714224 Ga0070698_1007142241 249
143 3300005518 Ga0070699_100031426 Ga0070699_1000314265 249
144 3300005518 Ga0070699_100129441 Ga0070699_1001294414 249
145 3300005536 Ga0070697_100077002 Ga0070697_1000770023 249
146 3300005544 Ga0070686_100006853 Ga0070686_1000068532 249
147 3300005545 Ga0070695_100092245 Ga0070695_1000922452 249
148 3300005545 Ga0070695_100106288 Ga0070695_1001062882 249
149 3300005546 Ga0070696_100000365 Ga0070696_1000003658 249
150 3300005546 Ga0070696_100001987 Ga0070696_1000019878 249
151 3300005546 Ga0070696_100012794 Ga0070696_1000127943 249
152 3300005547 Ga0070693_100001304 Ga0070693_1000013048 249
153 3300005547 Ga0070693_100108699 Ga0070693_1001086992 249
154 3300005547 Ga0070693_100111545 Ga0070693_1001115453 249
155 3300005549 Ga0070704_100215587 Ga0070704_1002155873 249
156 3300005563 Ga0068855_100022689 Ga0068855_10002268910 249
157 3300005578 Ga0068854_100002726 Ga0068854_10000272615 249
158 3300005578 Ga0068854_100490584 Ga0068854_1004905842 249
159 3300005614 Ga0068856_100107457 Ga0068856_1001074571 249
160 3300005615 Ga0070702_100001395 Ga0070702_10000139512 249
161 3300005618 Ga0068864_100365410 Ga0068864_1003654102 249
162 3300005718 Ga0068866_10001256 Ga0068866_100012568 249
163 3300005719 Ga0068861_100007236 Ga0068861_1000072369 249
164 3300005719 Ga0068861_100047848 Ga0068861_1000478486 249
165 3300005840 Ga0068870_10021799 Ga0068870_100217992 249
166 3300005841 Ga0068863_100151287 Ga0068863_1001512875 249
167 3300005842 Ga0068858_100006080 Ga0068858_1000060808 249
168 3300005843 Ga0068860_100007085 Ga0068860_1000070858 249
169 3300005843 Ga0068860_100776610 Ga0068860_1007766102 249
170 3300005844 Ga0068862_100009009 Ga0068862_1000090091 249
171 3300005985 Ga0081539_10003064 Ga0081539_1000306416 249
172 3300006163 Ga0070715_10310718 Ga0070715_103107181 249
173 3300006358 Ga0068871_100012186 Ga0068871_1000121862 249
174 3300006844 Ga0075428_100001710 Ga0075428_10000171016 249
175 3300006844 Ga0075428_100003689 Ga0075428_1000036893 249
176 3300006844 Ga0075428_100006706 Ga0075428_10000670610 249
177 3300006844 Ga0075428_100351397 Ga0075428_1003513972 249
178 3300006846 Ga0075430_100075714 Ga0075430_1000757142 249
179 3300006847 Ga0075431_100074091 Ga0075431_1000740913 249
180 3300006852 Ga0075433_10013801 Ga0075433_100138013 249
181 3300006871 Ga0075434_100023219 Ga0075434_1000232191 249
182 3300006871 Ga0075434_100610542 Ga0075434_1006105421 249
183 3300006880 Ga0075429_100000745 Ga0075429_10000074530 249
184 3300006880 Ga0075429_100048656 Ga0075429_1000486563 249
185 3300006881 Ga0068865_100007839 Ga0068865_1000078392 249
186 3300006914 Ga0075436_100001134 Ga0075436_1000011349 249
187 3300006914 Ga0075436_100002669 Ga0075436_10000266915 249
188 3300006914 Ga0075436_100003033 Ga0075436_1000030336 249
189 3300006914 Ga0075436_100018004 Ga0075436_1000180042 249
190 3300006914 Ga0075436_100051129 Ga0075436_1000511293 249
191 3300007076 Ga0075435_100018225 Ga0075435_1000182256 249
192 3300007076 Ga0075435_100051665 Ga0075435_1000516652 249
193 3300007076 Ga0075435_100060443 Ga0075435_1000604433 249
194 3300007265 Ga0099794_10006521 Ga0099794_100065214 249
195 3300007265 Ga0099794_10036244 Ga0099794_100362443 249
196 3300007265 Ga0099794_10145309 Ga0099794_101453091 249
197 3300007788 Ga0099795_10106887 Ga0099795_101068872 249
198 3300009094 Ga0111539_10011559 Ga0111539_100115592 249
199 3300009094 Ga0111539_10014565 Ga0111539_1001456514 249
200 3300009094 Ga0111539_10152470 Ga0111539_101524702 249
201 3300009094 Ga0111539_10192683 Ga0111539_101926833 249
202 3300009098 Ga0105245_10001883 Ga0105245_1000188316 249
203 3300009147 Ga0114129_10080092 Ga0114129_100800923 249
204 3300009147 Ga0114129_10190115 Ga0114129_101901153 249
205 3300009147 Ga0114129_10200876 Ga0114129_102008763 249
206 3300009147 Ga0114129_10263701 Ga0114129_102637013 249
207 3300009148 Ga0105243_10125571 Ga0105243_101255712 249
208 3300009174 Ga0105241_10052978 Ga0105241_100529782 249
209 3300009176 Ga0105242_10020835 Ga0105242_100208357 249
210 3300009177 Ga0105248_10360667 Ga0105248_103606672 249
211 3300009553 Ga0105249_10005590 Ga0105249_1000559010 249
212 3300009553 Ga0105249_10037952 Ga0105249_100379523 249
213 3300010375 Ga0105239_10033405 Ga0105239_100334052 249
214 3300013297 Ga0157378_10005928 Ga0157378_100059288 249
215 3300013297 Ga0157378_10956535 Ga0157378_109565351 249
216 3300013306 Ga0163162_10673793 Ga0163162_106737932 249
217 3300014326 Ga0157380_10025901 Ga0157380_100259013 249
218 3300014969 Ga0157376_10046254 Ga0157376_100462543 249
219 3300025885 Ga0207653_10075295 Ga0207653_100752951 249
220 3300025899 Ga0207642_10007526 Ga0207642_100075263 249
221 3300025901 Ga0207688_10144874 Ga0207688_101448742 249
222 3300025907 Ga0207645_10012487 Ga0207645_100124873 249
223 3300025908 Ga0207643_10020168 Ga0207643_100201683 249
224 3300025910 Ga0207684_10116427 Ga0207684_101164271 249
225 3300025910 Ga0207684_10140019 Ga0207684_101400193 249
226 3300025911 Ga0207654_10012806 Ga0207654_100128067 249
227 3300025912 Ga0207707_10160485 Ga0207707_101604852 249
228 3300025917 Ga0207660_10007883 Ga0207660_100078835 249
229 3300025918 Ga0207662_10000052 Ga0207662_1000005255 249
230 3300025918 Ga0207662_10105753 Ga0207662_101057533 249
231 3300025920 Ga0207649_10127066 Ga0207649_101270662 249
232 3300025923 Ga0207681_10002941 Ga0207681_1000294112 249
233 3300025926 Ga0207659_10030569 Ga0207659_100305695 249
234 3300025927 Ga0207687_10007853 Ga0207687_100078532 249
235 3300025933 Ga0207706_10066192 Ga0207706_100661923 249
236 3300025934 Ga0207686_10082426 Ga0207686_100824262 249
237 3300025935 Ga0207709_10015104 Ga0207709_100151047 249
238 3300025936 Ga0207670_10005456 Ga0207670_100054563 249
239 3300025938 Ga0207704_10001239 Ga0207704_100012394 249
240 3300025939 Ga0207665_10190174 Ga0207665_101901742 249
241 3300025939 Ga0207665_10316178 Ga0207665_103161781 249
242 3300025940 Ga0207691_10053201 Ga0207691_100532013 249
243 3300025941 Ga0207711_10244612 Ga0207711_102446123 249
244 3300025942 Ga0207689_10000447 Ga0207689_1000044712 249
245 3300025942 Ga0207689_10021384 Ga0207689_100213844 249
246 3300025945 Ga0207679_10204976 Ga0207679_102049762 249
247 3300025949 Ga0207667_10009076 Ga0207667_100090766 249
248 3300025961 Ga0207712_10028152 Ga0207712_100281526 249
249 3300025961 Ga0207712_10165357 Ga0207712_101653573 249
250 3300025972 Ga0207668_10029664 Ga0207668_100296643 249
251 3300025981 Ga0207640_10009443 Ga0207640_100094439 249
252 3300026023 Ga0207677_10026639 Ga0207677_100266393 249
253 3300026035 Ga0207703_10014976 Ga0207703_100149765 249
254 3300026041 Ga0207639_10106100 Ga0207639_101061004 249
255 3300026075 Ga0207708_10000209 Ga0207708_1000020950 249
256 3300026075 Ga0207708_10591458 Ga0207708_105914581 249
257 3300026078 Ga0207702_10141480 Ga0207702_101414803 249
258 3300026078 Ga0207702_10494738 Ga0207702_104947381 249
259 3300026089 Ga0207648_10000386 Ga0207648_1000038654 249
260 3300026089 Ga0207648_10000431 Ga0207648_1000043111 249
261 3300026095 Ga0207676_10086724 Ga0207676_100867242 249
262 3300026118 Ga0207675_100000443 Ga0207675_10000044313 249
263 3300026118 Ga0207675_100006922 Ga0207675_1000069223 249
264 3300026118 Ga0207675_100292757 Ga0207675_1002927572 249
265 3300026121 Ga0207683_10117871 Ga0207683_101178712 249
266 3300026142 Ga0207698_10058683 Ga0207698_100586832 249
267 3300027360 Ga0209969_1001207 Ga0209969_10012075 249
268 3300027364 Ga0209967_1002777 Ga0209967_10027772 249
269 3300027378 Ga0209981_1004250 Ga0209981_10042502 249
270 3300027462 Ga0210000_1000692 Ga0210000_10006924 249
271 3300027526 Ga0209968_1013225 Ga0209968_10132252 249
272 3300027543 Ga0209999_1005698 Ga0209999_10056983 249
273 3300027682 Ga0209971_1014000 Ga0209971_10140002 249
274 3300027695 Ga0209966_1000793 Ga0209966_10007936 249
275 3300027907 Ga0207428_10009403 Ga0207428_100094037 249
276 3300027907 Ga0207428_10018198 Ga0207428_100181983 249
277 3300027907 Ga0207428_10132363 Ga0207428_101323633 249
278 3300028380 Ga0268265_10002339 Ga0268265_1000233915 249
279 3300028380 Ga0268265_10093203 Ga0268265_100932034 249
280 3300028381 Ga0268264_10044437 Ga0268264_100444376 249
281 3300028381 Ga0268264_10544864 Ga0268264_105448642 249
282 3300034817 Ga0373948_0012419 Ga0373948_0012419_634_1383 249
283 3300034818 Ga0373950_0024349 Ga0373950_0024349_106_855 249
284 3300034819 Ga0373958_0006947 Ga0373958_0006947_716_1465 249
285 3300035083 Ga0373926_0152682 Ga0373926_0152682_66_815 249
286 3300035084 Ga0373928_0008197 Ga0373928_0008197_151_900 249
287 3300035088 Ga0373940_0001221 Ga0373940_0001221_2815_3564 249
288 3300035092 Ga0373952_0019334 Ga0373952_0019334_201_950 249
289 3300035111 Ga0373923_0095864 Ga0373923_0095864_446_1195 249
290 3300035112 Ga0373932_0023058 Ga0373932_0023058_399_1148 249
291 3300035116 Ga0373945_0015754 Ga0373945_0015754_698_1447 249
292 3300035170 Ga0373943_0019735 Ga0373943_0019735_1936_2685 249
293 3300035171 Ga0373946_0004787 Ga0373946_0004787_1018_1767 249
294 3300035207 Ga0373942_0003671 Ga0373942_0003671_2313_3062 249
295 3300035207 Ga0373942_0011113 Ga0373942_0011113_459_1208 249
296 3300035241 Ga0373961_0015549 Ga0373961_0015549_160_909 249
297 3300035410 Ga0373924_0004837 Ga0373924_0004837_3922_4698 249
298 3300035410 Ga0373924_0029656 Ga0373924_0029656_645_1394 249
299 3300035691 Ga0373931_0024247 Ga0373931_0024247_2201_2950 249
300 3300035691 Ga0373931_0053326 Ga0373931_0053326_876_1625 249
301 3300035695 Ga0373927_0340141 Ga0373927_0340141_59_808 249
302 3300035724 Ga0373933_0105486 Ga0373933_0105486_476_1243 249
303 3300037068 Ga0373925_0243230 Ga0373925_0243230_95_844 249
304 3300042001 Ga0439441_003364 Ga0439441_003364_494_1243 249
305 3300042117 Ga0450913_003918 Ga0450913_003918_235_984 249
306 3300042156 Ga0439446_0014945 Ga0439446_0014945_800_1576 249
307 3300042436 Ga0439435_0000448 Ga0439435_0000448_1527_2303 249
308 3300042436 Ga0439435_0004549 Ga0439435_0004549_505_1266 249
309 3300042436 Ga0439435_0033895 Ga0439435_0033895_63_812 249
310 3300042461 Ga0439460_0023248 Ga0439460_0023248_791_1552 249
311 3300042532 Ga0450893_0014398 Ga0450893_0014398_327_1076 249
312 3300042876 Ga0451577_0018965 Ga0451577_0018965_2888_3637 249
313 3300045051 Ga0451576_0001772 Ga0451576_0001772_18506_19255 249
314 3300046455 Ga0495603_0006754 Ga0495603_0006754_2339_3088 249
315 3300046462 Ga0495651_0179729 Ga0495651_0179729_287_1054 249
316 3300046472 Ga0495580_0005855 Ga0495580_0005855_4466_5215 249
317 3300046473 Ga0495582_0009220 Ga0495582_0009220_708_1457 249
318 3300046475 Ga0495639_0035106 Ga0495639_0035106_941_1690 249
319 3300046528 Ga0495642_0062069 Ga0495642_0062069_273_1022 249
320 3300046531 Ga0495665_0072694 Ga0495665_0072694_812_1561 249
321 3300046535 Ga0495586_0004334 Ga0495586_0004334_4389_5138 249
322 3300046537 Ga0495598_0030487 Ga0495598_0030487_576_1325 249
323 3300046674 Ga0495588_0013661 Ga0495588_0013661_2195_2944 249
324 3300046681 Ga0495647_0013374 Ga0495647_0013374_720_1469 249
325 3300046683 Ga0495658_0002156 Ga0495658_0002156_4648_5397 249
326 3300047321 Ga0495676_0036993 Ga0495676_0036993_1033_1782 249
327 3300048088 Ga0495602_0401151 Ga0495602_0401151_201_968 249
328 3300048911 Ga0496108_0360649 Ga0496108_0360649_438_1187 249
329 3300049568 Ga0501031_0011874 Ga0501031_0011874_1896_2666 249
330 3300049569 Ga0501032_0035394 Ga0501032_0035394_1092_1844 249
331 3300049570 Ga0501033_0021323 Ga0501033_0021323_49_819 249
332 3300049572 Ga0501036_0024832 Ga0501036_0024832_895_1665 249
333 3300049572 Ga0501036_0292320 Ga0501036_0292320_498_1247 249
334 3300049572 Ga0501036_0603402 Ga0501036_0603402_133_900 249
335 3300049573 Ga0501037_0091718 Ga0501037_0091718_240_1010 249
336 3300049575 Ga0501039_0006093 Ga0501039_0006093_3742_4512 249
337 3300049575 Ga0501039_0103563 Ga0501039_0103563_20_787 249
338 3300049575 Ga0501039_0107056 Ga0501039_0107056_718_1485 249
339 3300049575 Ga0501039_0118703 Ga0501039_0118703_1198_1947 249
340 3300049576 Ga0501040_0016376 Ga0501040_0016376_3243_4013 249
341 3300049576 Ga0501040_0030311 Ga0501040_0030311_27_776 249
342 3300049576 Ga0501040_0083198 Ga0501040_0083198_54_815 249
343 3300049577 Ga0501041_0014191 Ga0501041_0014191_3065_3835 249
344 3300049577 Ga0501041_0078547 Ga0501041_0078547_321_1088 249
345 3300049577 Ga0501041_0098525 Ga0501041_0098525_524_1291 249
346 3300049577 Ga0501041_0169556 Ga0501041_0169556_496_1263 249
347 3300049578 Ga0501042_0054695 Ga0501042_0054695_652_1422 249
348 3300049578 Ga0501042_0103618 Ga0501042_0103618_526_1293 249
349 3300049578 Ga0501042_0612161 Ga0501042_0612161_15_782 249
350 3300049579 Ga0501043_0067823 Ga0501043_0067823_1895_2665 249
351 3300049580 Ga0501046_0036077 Ga0501046_0036077_1912_2682 249
352 3300049580 Ga0501046_0117511 Ga0501046_0117511_129_896 249
353 3300049582 Ga0501048_0013439 Ga0501048_0013439_1457_2227 249
354 3300049582 Ga0501048_0310818 Ga0501048_0310818_85_846 249
355 3300049584 Ga0501068_0105956 Ga0501068_0105956_888_1640 249
356 3300049584 Ga0501068_0150759 Ga0501068_0150759_148_915 249
357 3300049584 Ga0501068_0166571 Ga0501068_0166571_544_1311 249
358 3300049587 Ga0501071_0011417 Ga0501071_0011417_3077_3829 249
359 3300049587 Ga0501071_0032500 Ga0501071_0032500_2789_3556 249
360 3300049587 Ga0501071_0261564 Ga0501071_0261564_522_1289 249
361 3300049588 Ga0501072_0007007 Ga0501072_0007007_4633_5385 249
362 3300049588 Ga0501072_0076564 Ga0501072_0076564_241_1008 249
363 3300049588 Ga0501072_0077614 Ga0501072_0077614_248_1009 249
364 3300049588 Ga0501072_0177615 Ga0501072_0177615_780_1547 249
365 3300049589 Ga0501073_0071361 Ga0501073_0071361_20_769 249
366 3300049589 Ga0501073_0325892 Ga0501073_0325892_79_846 249
367 3300049590 Ga0501074_0025155 Ga0501074_0025155_2487_3257 249
368 3300049590 Ga0501074_0365136 Ga0501074_0365136_187_954 249
369 3300049591 Ga0501075_0017685 Ga0501075_0017685_1174_1941 249
370 3300049591 Ga0501075_0021354 Ga0501075_0021354_895_1665 249
371 3300049591 Ga0501075_0098968 Ga0501075_0098968_1146_1913 249
372 3300049592 Ga0501076_0014204 Ga0501076_0014204_841_1593 249
373 3300049592 Ga0501076_0029745 Ga0501076_0029745_1773_2540 249
374 3300049592 Ga0501076_0352661 Ga0501076_0352661_280_1047 249
375 3300049593 Ga0501077_0006033 Ga0501077_0006033_3299_4069 249
376 3300049593 Ga0501077_0090524 Ga0501077_0090524_104_856 249
377 3300049741 Ga0501079_0014450 Ga0501079_0014450_3461_4213 249
378 3300049742 Ga0501080_0016201 Ga0501080_0016201_5453_6220 249
379 3300049742 Ga0501080_0035690 Ga0501080_0035690_3099_3869 249
380 3300049743 Ga0501081_0008564 Ga0501081_0008564_5071_5841 249
381 3300049744 Ga0501083_0181050 Ga0501083_0181050_95_865 249
382 3300049744 Ga0501083_0233142 Ga0501083_0233142_61_828 249
383 3300049823 Ga0501044_0329918 Ga0501044_0329918_641_1411 249
384 3300049824 Ga0501045_0005879 Ga0501045_0005879_2383_3153 249
385 3300049824 Ga0501045_0080757 Ga0501045_0080757_165_914 249
386 3300049824 Ga0501045_0120225 Ga0501045_0120225_492_1259 249
387 3300050507 nmdc:mga05p37_159590_c1 nmdc:mga05p37_159590_c1_1426_2178 249
388 3300050507 nmdc:mga05p37_258101_c1 nmdc:mga05p37_258101_c1_963_1730 249
389 3300050507 nmdc:mga05p37_316266_c1 nmdc:mga05p37_316266_c1_836_1585 249
390 3300050507 nmdc:mga05p37_8266_c1 nmdc:mga05p37_8266_c1_7994_8743 249
391 3300050508 nmdc:mga09592_102052_c1 nmdc:mga09592_102052_c1_1544_2308 249
392 3300050508 nmdc:mga09592_18384_c1 nmdc:mga09592_18384_c1_2131_2880 249
393 3300050508 nmdc:mga09592_41790_c1 nmdc:mga09592_41790_c1_1980_2729 249
394 3300050508 nmdc:mga09592_9992_c1 nmdc:mga09592_9992_c1_4469_5218 249
395 3300050509 nmdc:mga0qj67_176802_c1 nmdc:mga0qj67_176802_c1_853_1614 249
396 3300050509 nmdc:mga0qj67_47819_c1 nmdc:mga0qj67_47819_c1_1817_2581 249
397 3300050510 nmdc:mga06r32_188912_c1 nmdc:mga06r32_188912_c1_1033_1782 249
398 3300050510 nmdc:mga06r32_28864_c1 nmdc:mga06r32_28864_c1_1381_2130 249
399 3300050511 nmdc:mga08y16_120288_c1 nmdc:mga08y16_120288_c1_649_1398 249
400 3300050511 nmdc:mga08y16_36647_c1 nmdc:mga08y16_36647_c1_1264_2013 249
401 3300050511 nmdc:mga08y16_385680_c1 nmdc:mga08y16_385680_c1_277_1026 249
402 3300050511 nmdc:mga08y16_409111_c1 nmdc:mga08y16_409111_c1_404_1153 249
403 3300050511 nmdc:mga08y16_8745_c1 nmdc:mga08y16_8745_c1_315_1064 249
404 3300050512 nmdc:mga0n895_216342_c1 nmdc:mga0n895_216342_c1_519_1268 249
405 3300050512 nmdc:mga0n895_367627_c1 nmdc:mga0n895_367627_c1_530_1279 249
406 3300050512 nmdc:mga0n895_5948_c1 nmdc:mga0n895_5948_c1_6209_6961 249
407 3300050513 nmdc:mga0rr50_336063_c1 nmdc:mga0rr50_336063_c1_99_866 249
408 3300050513 nmdc:mga0rr50_37313_c1 nmdc:mga0rr50_37313_c1_1446_2198 249
409 3300050513 nmdc:mga0rr50_9655_c1 nmdc:mga0rr50_9655_c1_5061_5810 249
410 3300050514 nmdc:mga08x19_2444_c1 nmdc:mga08x19_2444_c1_4418_5185 249
411 3300050514 nmdc:mga08x19_41786_c1 nmdc:mga08x19_41786_c1_316_1068 249
412 3300050514 nmdc:mga08x19_565_c1 nmdc:mga08x19_565_c1_17799_18548 249
413 3300050514 nmdc:mga08x19_7204_c1 nmdc:mga08x19_7204_c1_4878_5645 249
414 3300050515 nmdc:mga0a205_315007_c1 nmdc:mga0a205_315007_c1_411_1160 249
415 3300050515 nmdc:mga0a205_5613_c1 nmdc:mga0a205_5613_c1_5188_5937 249
416 3300054114 Ga0501084_0029538 Ga0501084_0029538_597_1367 249
417 3300054114 Ga0501084_0136471 Ga0501084_0136471_327_1094 249
418 3300054114 Ga0501084_0293713 Ga0501084_0293713_498_1265 249
419 3300054114 Ga0501084_0550660 Ga0501084_0550660_158_925 249
420 3300060353 Ga0501082_0046150 Ga0501082_0046150_1463_2233 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

31

140

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

180

256

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.9672 16 129
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9668 13 131
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.965 15 130
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9615 15 130
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.961 13 130
ID Description Score Start End Superfamily
af_P38684_4_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9666 15 95 3.40.50.2300
af_P0AA16_3_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9647 13 89 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9625 15 96 3.40.50.2300
4s04F01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9596 15 131 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9588 16 129 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1B8P0D3-F1-model_v4 Transcriptional regulatory protein OmpR 0.9926 12 130 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1H3H8E1-F1-model_v4 Two-component system, OmpR family, response regulator 0.9827 12 131 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0F2R9Q6-F1-model_v4 Response regulatory domain-containing protein 0.9784 13 133 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Q3GVN9-F1-model_v4 Response regulator 0.9768 13 133 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A5P1V2S2-F1-model_v4 Response regulator 0.9729 13 133 GO:0000160

Feature Viewer

pLDDT pTM Quality
82.94 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map