F439704

General Info

Members Datasets Scaffolds Average Seq Length
420 236 840 352

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100262500|Ga0070697_1002625001
Length 403
Sequence MFTAALGGVTLTVEQHSAERLVTSCRETGILPAAMNPTTPAAQTHSRTAARSRAGTMRAVVKVAAGRGAEIREVPVPSCGAGQLLLDVKRAGVCGTDLHIYSWDRWSQERIQPPVTLGHEFVGEVIEVGAGVTEFAAGDRVACESHIVCHHCTACRTGNAHVCENTRILGVDVNGGFAEYVVVPAVNAWRVPGNIPIEVAAVMEPLGNAVHTAFAGPISGCNLAVTGCGPIGLFAIGVARAAGAARVFASDVSPYRLELARKMKADLVLDARHGDFAERCRERTGGDGLDGVLEMSGNPAAVRDGLAALRSGGRLSLLGLPKEPFDLDWNRLVIFKGVTVHGIIGRRMYETWYQMHNLLSSGRLDIGPAITHVMPMDQFDRAITLLEAGEAGKVVLVPWGEEA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
164 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
235 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
236 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.71
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 0.71
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100262500 3300005536 Bacteria 1479
2 JGI24751J29686_10010428 3300002459 Unclassified 1916
3 Ga0070683_100016158 3300005329 Bacteria 6572
4 Ga0070683_100169469 3300005329 Bacteria 2072
5 Ga0070690_100029312 3300005330 Bacteria 3412
6 Ga0070670_100002095 3300005331 Bacteria 16349
7 Ga0070670_100004879 3300005331 Bacteria 11285
8 Ga0070670_100047380 3300005331 Bacteria 3699
9 Ga0068869_100005163 3300005334 Bacteria 8195
10 Ga0070666_10020459 3300005335 Bacteria 4277
11 Ga0070680_100109561 3300005336 Bacteria 2298
12 Ga0070680_100212187 3300005336 Unclassified 1633
13 Ga0068868_100123857 3300005338 Bacteria 2110
14 Ga0068868_100290512 3300005338 Bacteria 1386
15 Ga0070660_100009090 3300005339 Bacteria 6976
16 Ga0070689_100005528 3300005340 Bacteria 8643
17 Ga0070689_100019159 3300005340 Bacteria 5056
18 Ga0070689_100037131 3300005340 Bacteria 3726
19 Ga0070689_100199272 3300005340 Unclassified 1634
20 Ga0070689_100205716 3300005340 Bacteria 1609
21 Ga0070671_100040109 3300005355 Bacteria 3888
22 Ga0070674_100003172 3300005356 Bacteria 9162
23 Ga0070674_100020969 3300005356 Bacteria 4187
24 Ga0070674_100053125 3300005356 Bacteria 2796
25 Ga0070673_100047098 3300005364 Bacteria 3353
26 Ga0070673_100232381 3300005364 Bacteria 1600
27 Ga0070688_100003044 3300005365 Bacteria 8557
28 Ga0070688_100030603 3300005365 Bacteria 3231
29 Ga0070688_100037960 3300005365 Bacteria 2938
30 Ga0070688_100073029 3300005365 Bacteria 2200
31 Ga0070667_100000363 3300005367 Bacteria 49379
32 Ga0070713_100002206 3300005436 Bacteria 12616
33 Ga0070701_10043091 3300005438 Bacteria 2307
34 Ga0070705_100042316 3300005440 Bacteria 2604
35 Ga0070700_100008290 3300005441 Bacteria 5655
36 Ga0070700_100128816 3300005441 Bacteria 1705
37 Ga0070708_100161661 3300005445 Bacteria 2087
38 Ga0070678_100015491 3300005456 Unclassified 4850
39 Ga0070678_100023504 3300005456 Bacteria 4109
40 Ga0070662_100219629 3300005457 Unclassified 1516
41 Ga0070681_10039943 3300005458 Bacteria 4704
42 Ga0068867_100049948 3300005459 Bacteria 3081
43 Ga0068867_100054854 3300005459 Bacteria 2945
44 Ga0070685_10013678 3300005466 Bacteria 4286
45 Ga0070685_10023822 3300005466 Bacteria 3355
46 Ga0070685_10118567 3300005466 Bacteria 1641
47 Ga0070706_100094024 3300005467 Bacteria 2782
48 Ga0070707_100003969 3300005468 Bacteria 13932
49 Ga0070698_100177835 3300005471 Bacteria 2066
50 Ga0070684_100121011 3300005535 Bacteria 2355
51 Ga0068853_100000015 3300005539 Bacteria 226965
52 Ga0068853_100077653 3300005539 Bacteria 2901
53 Ga0070672_100103364 3300005543 Unclassified 2314
54 Ga0070686_100014529 3300005544 Bacteria 4541
55 Ga0070686_100039160 3300005544 Bacteria 2952
56 Ga0070696_100092897 3300005546 Bacteria 2151
57 Ga0070665_100063861 3300005548 Bacteria 3692
58 Ga0070704_100027297 3300005549 Bacteria 3784
59 Ga0070704_100168190 3300005549 Bacteria 1740
60 Ga0068855_100023129 3300005563 Bacteria 7446
61 Ga0070664_100028739 3300005564 Bacteria 4629
62 Ga0070664_100090449 3300005564 Bacteria 2649
63 Ga0068857_100036910 3300005577 Bacteria 4329
64 Ga0068852_100026843 3300005616 Bacteria 4687
65 Ga0068859_100508281 3300005617 Bacteria 1300
66 Ga0068864_100024919 3300005618 Bacteria 5033
67 Ga0068864_100100136 3300005618 Bacteria 2569
68 Ga0068866_10036617 3300005718 Bacteria 2405
69 Ga0068870_10005209 3300005840 Bacteria 5660
70 Ga0068858_100038404 3300005842 Bacteria 4440
71 Ga0068858_100130632 3300005842 Bacteria 2355
72 Ga0070717_10147765 3300006028 Bacteria 2031
73 Ga0097621_100012284 3300006237 Bacteria 6338
74 Ga0097621_100140566 3300006237 Bacteria 2063
75 Ga0068871_100163764 3300006358 Bacteria 1903
76 Ga0075428_100008258 3300006844 Bacteria 11544
77 Ga0075428_100055086 3300006844 Bacteria 4358
78 Ga0075428_100066222 3300006844 Bacteria 3955
79 Ga0075428_100074850 3300006844 Bacteria 3698
80 Ga0075430_100053066 3300006846 Bacteria 3414
81 Ga0075431_100007725 3300006847 Bacteria 10711
82 Ga0075431_100061682 3300006847 Bacteria 3868
83 Ga0075431_100093811 3300006847 Bacteria 3097
84 Ga0075433_10060488 3300006852 Bacteria 3317
85 Ga0075433_10188120 3300006852 Bacteria 1837
86 Ga0075433_10205641 3300006852 Bacteria 1750
87 Ga0075434_100018148 3300006871 Bacteria 6791
88 Ga0075434_100026498 3300006871 Bacteria 5680
89 Ga0075434_100048423 3300006871 Bacteria 4217
90 Ga0075434_100224054 3300006871 Bacteria 1900
91 Ga0075429_100008860 3300006880 Bacteria 8747
92 Ga0075429_100027864 3300006880 Bacteria 4904
93 Ga0097620_100508276 3300006931 Bacteria 1300
94 Ga0075435_100021235 3300007076 Bacteria 4990
95 Ga0075435_100124211 3300007076 Bacteria 2156
96 Ga0075435_100280782 3300007076 Bacteria 1422
97 Ga0105240_10000120 3300009093 Bacteria 163069
98 Ga0111539_10019778 3300009094 Bacteria 8303
99 Ga0111539_10050904 3300009094 Bacteria 4934
100 Ga0111539_10054531 3300009094 Bacteria 4756
101 Ga0111539_10063345 3300009094 Bacteria 4376
102 Ga0111539_10133605 3300009094 Bacteria 2905
103 Ga0111539_10135579 3300009094 Bacteria 2883
104 Ga0111539_10139862 3300009094 Unclassified 2835
105 Ga0111539_10159130 3300009094 Bacteria 2642
106 Ga0111539_10175216 3300009094 Bacteria 2505
107 Ga0111539_10209831 3300009094 Bacteria 2269
108 Ga0105245_10002167 3300009098 Bacteria 17777
109 Ga0105245_10199499 3300009098 Bacteria 1921
110 Ga0105245_10229759 3300009098 Bacteria 1794
111 Ga0105247_10009300 3300009101 Bacteria 5967
112 Ga0105247_10087233 3300009101 Bacteria 1975
113 Ga0114129_10041619 3300009147 Bacteria 6472
114 Ga0114129_10073811 3300009147 Bacteria 4752
115 Ga0114129_10074427 3300009147 Bacteria 4731
116 Ga0114129_10139339 3300009147 Bacteria 3327
117 Ga0114129_10180643 3300009147 Bacteria 2871
118 Ga0114129_10219720 3300009147 Bacteria 2564
119 Ga0114129_10405196 3300009147 Bacteria 1797
120 Ga0114129_10694905 3300009147 Bacteria 1308
121 Ga0105241_10007514 3300009174 Bacteria 8018
122 Ga0105241_10014839 3300009174 Bacteria 5703
123 Ga0105242_10054304 3300009176 Bacteria 3274
124 Ga0105248_10004057 3300009177 Bacteria 16188
125 Ga0105248_10164025 3300009177 Bacteria 2505
126 Ga0105248_10245700 3300009177 Bacteria 2015
127 Ga0105248_10370324 3300009177 Bacteria 1613
128 Ga0105237_10000008 3300009545 Bacteria 363335
129 Ga0105237_10105301 3300009545 Bacteria 2812
130 Ga0105238_10017067 3300009551 Bacteria 7368
131 Ga0105239_10009739 3300010375 Bacteria 10802
132 Ga0105239_10026085 3300010375 Bacteria 6433
133 Ga0105239_10123152 3300010375 Bacteria 2881
134 Ga0105246_10032162 3300011119 Bacteria 3477
135 Ga0105246_10129403 3300011119 Bacteria 1883
136 Ga0157370_10167611 3300013104 Bacteria 2042
137 Ga0157369_10322651 3300013105 Bacteria 1605
138 Ga0157374_10001135 3300013296 Bacteria 22802
139 Ga0157378_10043467 3300013297 Bacteria 3989
140 Ga0157378_10181527 3300013297 Bacteria 1980
141 Ga0157378_10360696 3300013297 Bacteria 1422
142 Ga0157372_10013352 3300013307 Bacteria 8770
143 Ga0157372_10019923 3300013307 Bacteria 7231
144 Ga0157375_10144070 3300013308 Bacteria 2512
145 Ga0157375_10259582 3300013308 Bacteria 1899
146 Ga0163163_10031939 3300014325 Bacteria 5084
147 Ga0163163_10089297 3300014325 Bacteria 3094
148 Ga0157380_10017739 3300014326 Bacteria 5273
149 Ga0157377_10004576 3300014745 Bacteria 6388
150 Ga0157377_10023691 3300014745 Bacteria 3257
151 Ga0157379_10122873 3300014968 Bacteria 2336
152 Ga0157376_10467179 3300014969 Bacteria 1234
153 Ga0206351_10437130 3300020077 Bacteria 1304
154 Ga0154015_1283142 3300020610 Bacteria 2088
155 Ga0224712_10044537 3300022467 Bacteria 1693
156 Ga0207688_10002076 3300025901 Bacteria 10769
157 Ga0207680_10006052 3300025903 Bacteria 5825
158 Ga0207680_10135930 3300025903 Bacteria 1625
159 Ga0207643_10005164 3300025908 Bacteria 6985
160 Ga0207643_10005227 3300025908 Bacteria 6943
161 Ga0207654_10007147 3300025911 Bacteria 5621
162 Ga0207707_10055973 3300025912 Bacteria 3431
163 Ga0207695_10000204 3300025913 Bacteria 163066
164 Ga0207671_10000005 3300025914 Bacteria 844816
165 Ga0207671_10096290 3300025914 Bacteria 2236
166 Ga0207662_10000068 3300025918 Bacteria 46021
167 Ga0207662_10065776 3300025918 Unclassified 2183
168 Ga0207657_10015373 3300025919 Bacteria 7416
169 Ga0207652_10059982 3300025921 Bacteria 3281
170 Ga0207646_10047013 3300025922 Bacteria 3871
171 Ga0207681_10060677 3300025923 Unclassified 2597
172 Ga0207694_10048168 3300025924 Bacteria 3297
173 Ga0207650_10074352 3300025925 Bacteria 2561
174 Ga0207659_10065409 3300025926 Bacteria 2635
175 Ga0207687_10002022 3300025927 Bacteria 13907
176 Ga0207687_10017656 3300025927 Bacteria 4701
177 Ga0207687_10183973 3300025927 Bacteria 1621
178 Ga0207700_10025932 3300025928 Bacteria 4080
179 Ga0207644_10066313 3300025931 Bacteria 2628
180 Ga0207706_10193837 3300025933 Bacteria 1783
181 Ga0207686_10017627 3300025934 Bacteria 4027
182 Ga0207686_10018727 3300025934 Bacteria 3924
183 Ga0207670_10000197 3300025936 Bacteria 39852
184 Ga0207670_10051886 3300025936 Bacteria 2756
185 Ga0207670_10150922 3300025936 Bacteria 1724
186 Ga0207669_10011233 3300025937 Bacteria 4349
187 Ga0207669_10094456 3300025937 Bacteria 1957
188 Ga0207704_10028415 3300025938 Bacteria 3103
189 Ga0207704_10039395 3300025938 Bacteria 2751
190 Ga0207691_10019186 3300025940 Bacteria 6474
191 Ga0207711_10062558 3300025941 Bacteria 3210
192 Ga0207711_10305966 3300025941 Bacteria 1467
193 Ga0207711_10374004 3300025941 Unclassified 1321
194 Ga0207689_10097372 3300025942 Bacteria 2416
195 Ga0207661_10100554 3300025944 Bacteria 2427
196 Ga0207651_10091227 3300025960 Bacteria 2230
197 Ga0207651_10134503 3300025960 Bacteria 1899
198 Ga0207651_10181303 3300025960 Bacteria 1671
199 Ga0207640_10037860 3300025981 Bacteria 3039
200 Ga0207658_10000322 3300025986 Bacteria 48194
201 Ga0207677_10082301 3300026023 Bacteria 2313
202 Ga0207677_10095633 3300026023 Bacteria 2171
203 Ga0207703_10096903 3300026035 Bacteria 2491
204 Ga0207639_10000022 3300026041 Bacteria 226983
205 Ga0207639_10001291 3300026041 Bacteria 16905
206 Ga0207708_10002331 3300026075 Bacteria 13941
207 Ga0207708_10037834 3300026075 Bacteria 3675
208 Ga0207702_10456599 3300026078 Bacteria 1240
209 Ga0207648_10072531 3300026089 Bacteria 3000
210 Ga0207648_10075104 3300026089 Bacteria 2947
211 Ga0207648_10128246 3300026089 Bacteria 2232
212 Ga0207648_10134619 3300026089 Bacteria 2176
213 Ga0207674_10038769 3300026116 Bacteria 4942
214 Ga0207675_100083058 3300026118 Bacteria 3004
215 Ga0207683_10084206 3300026121 Bacteria 2826
216 Ga0207683_10091886 3300026121 Bacteria 2704
217 Ga0207428_10013444 3300027907 Bacteria 7150
218 Ga0207428_10034411 3300027907 Bacteria 4152
219 Ga0207428_10101114 3300027907 Bacteria 2228
220 Ga0268266_10382979 3300028379 Bacteria 1327
221 Ga0268265_10308610 3300028380 Bacteria 1428
222 Ga0268264_10080656 3300028381 Bacteria 2779
223 Ga0265326_10033480 3300028558 Bacteria 1462
224 Ga0265319_1002945 3300028563 Bacteria 9062
225 Ga0265334_10002766 3300028573 Bacteria 8091
226 Ga0265318_10002950 3300028577 Bacteria 8818
227 Ga0265323_10009317 3300028653 Bacteria 4017
228 Ga0265322_10003734 3300028654 Bacteria 4580
229 Ga0307515_10000018 3300028794 Bacteria 424853
230 Ga0265338_10000042 3300028800 Bacteria 226810
231 Ga0265338_10028999 3300028800 Bacteria 5501
232 Ga0265324_10032308 3300029957 Bacteria 1829
233 Ga0307512_10020688 3300030522 Bacteria 5946
234 Ga0265330_10008298 3300031235 Bacteria 5004
235 Ga0265328_10013357 3300031239 Bacteria 3251
236 Ga0265328_10062795 3300031239 Bacteria 1364
237 Ga0265320_10020089 3300031240 Bacteria 3630
238 Ga0265325_10000453 3300031241 Bacteria 29634
239 Ga0265329_10005040 3300031242 Bacteria 5391
240 Ga0265340_10005710 3300031247 Bacteria 6872
241 Ga0265339_10004237 3300031249 Bacteria 9829
242 Ga0265331_10049399 3300031250 Bacteria 2020
243 Ga0265327_10012057 3300031251 Bacteria 5872
244 Ga0265327_10012474 3300031251 Bacteria 5729
245 Ga0265316_10008337 3300031344 Bacteria 9621
246 Ga0265316_10071793 3300031344 Bacteria 2668
247 Ga0307513_10085473 3300031456 Bacteria 3237
248 Ga0265313_10006904 3300031595 Bacteria 7892
249 Ga0265314_10051856 3300031711 Bacteria 2855
250 Ga0265342_10034500 3300031712 Bacteria 3103
251 Ga0373953_0029026 3300035117 Bacteria 2137
252 Ga0373954_0029175 3300035118 Bacteria 2540
253 Ga0373957_0003977 3300035120 Bacteria 4444
254 Ga0373955_0015851 3300035172 Bacteria 3697
255 Ga0373955_0152933 3300035172 Bacteria 1359
256 Ga0373924_0051761 3300035410 Bacteria 1704
257 Ga0373931_0008232 3300035691 Bacteria 4941
258 Ga0373931_0062245 3300035691 Bacteria 2014
259 Ga0373933_0025876 3300035724 Bacteria 3366
260 Ga0373937_0026164 3300036401 Bacteria 5273
261 Ga0395905_0000116 3300037471 Bacteria 133816
262 Ga0436364_0920199 3300037853 Bacteria 5345
263 Ga0436364_1436310 3300037853 Bacteria 12059
264 Ga0436363_0161183 3300039450 Bacteria 7003
265 Ga0436362_0097592 3300039453 Bacteria 2669
266 Ga0450923_008701 3300042125 Unclassified 1755
267 Ga0450907_013106 3300042146 Bacteria 1380
268 Ga0450918_013036 3300042531 Bacteria 1446
269 Ga0466969_0011371 3300044656 Unclassified 4712
270 Ga0453684_0197454 3300044712 Bacteria 2348
271 Ga0453684_0209791 3300044712 Bacteria 2265
272 Ga0451576_0037955 3300045051 Bacteria 5100
273 Ga0451576_0516124 3300045051 Bacteria 1255
274 Ga0466958_0018056 3300045836 Bacteria 4088
275 Ga0495592_0033207 3300046454 Bacteria 3892
276 Ga0495651_0022616 3300046462 Bacteria 4887
277 Ga0495651_0240851 3300046462 Bacteria 1241
278 Ga0495651_0242997 3300046462 Bacteria 1234
279 Ga0495653_0023197 3300046463 Bacteria 5018
280 Ga0495653_0026973 3300046463 Bacteria 4601
281 Ga0495639_0076753 3300046475 Bacteria 1550
282 Ga0495608_0002701 3300046511 Bacteria 12747
283 Ga0495608_0011799 3300046511 Bacteria 6077
284 Ga0495618_0030852 3300046514 Bacteria 3350
285 Ga0495628_0056747 3300046516 Bacteria 3081
286 Ga0495586_0075133 3300046535 Bacteria 1850
287 Ga0495587_0033226 3300046536 Bacteria 3115
288 Ga0495667_0067958 3300046559 Bacteria 2328
289 Ga0495634_0106357 3300046642 Bacteria 1808
290 Ga0495634_0134310 3300046642 Bacteria 1575
291 Ga0495635_0039239 3300046663 Bacteria 3276
292 Ga0495657_0037277 3300046675 Bacteria 3352
293 Ga0495599_0009228 3300046678 Bacteria 6020
294 Ga0495604_0055630 3300047317 Bacteria 3049
295 Ga0495680_0098557 3300047322 Bacteria 2181
296 Ga0495675_0001211 3300047444 Bacteria 15630
297 Ga0495684_0031300 3300047471 Bacteria 4085
298 Ga0496109_0079099 3300048912 Bacteria 3028
299 Ga0496111_0111934 3300048914 Unclassified 2011
300 Ga0496112_0310746 3300048915 Bacteria 1521
301 Ga0501031_0001218 3300049568 Bacteria 15736
302 Ga0501031_0030933 3300049568 Bacteria 3492
303 Ga0501032_0011050 3300049569 Bacteria 6489
304 Ga0501033_0004490 3300049570 Bacteria 11163
305 Ga0501033_0094184 3300049570 Bacteria 2190
306 Ga0501036_0023423 3300049572 Bacteria 5202
307 Ga0501036_0044888 3300049572 Bacteria 3744
308 Ga0501036_0171165 3300049572 Bacteria 1830
309 Ga0501037_0036268 3300049573 Bacteria 3634
310 Ga0501038_0002518 3300049574 Bacteria 17073
311 Ga0501038_0065970 3300049574 Bacteria 3084
312 Ga0501039_0004869 3300049575 Bacteria 10165
313 Ga0501039_0019364 3300049575 Bacteria 5216
314 Ga0501039_0177067 3300049575 Bacteria 1677
315 Ga0501040_0011969 3300049576 Bacteria 5676
316 Ga0501040_0164401 3300049576 Bacteria 1570
317 Ga0501040_0212771 3300049576 Bacteria 1374
318 Ga0501041_0011363 3300049577 Bacteria 5261
319 Ga0501041_0017674 3300049577 Bacteria 4244
320 Ga0501041_0068556 3300049577 Bacteria 2174
321 Ga0501042_0004287 3300049578 Bacteria 9083
322 Ga0501042_0004385 3300049578 Bacteria 8999
323 Ga0501043_0070946 3300049579 Bacteria 2736
324 Ga0501043_0077187 3300049579 Bacteria 2617
325 Ga0501046_0003418 3300049580 Bacteria 14581
326 Ga0501046_0008548 3300049580 Bacteria 8907
327 Ga0501046_0017472 3300049580 Bacteria 5985
328 Ga0501048_0002460 3300049582 Bacteria 14133
329 Ga0501048_0009037 3300049582 Bacteria 7500
330 Ga0501048_0090239 3300049582 Bacteria 2162
331 Ga0501067_0008057 3300049583 Bacteria 5855
332 Ga0501067_0014567 3300049583 Bacteria 4353
333 Ga0501067_0025426 3300049583 Bacteria 3281
334 Ga0501067_0131975 3300049583 Bacteria 1390
335 Ga0501068_0001817 3300049584 Bacteria 11330
336 Ga0501068_0013211 3300049584 Bacteria 4696
337 Ga0501068_0045722 3300049584 Bacteria 2638
338 Ga0501068_0050534 3300049584 Bacteria 2514
339 Ga0501068_0054495 3300049584 Bacteria 2423
340 Ga0501069_0001102 3300049585 Bacteria 13033
341 Ga0501069_0012011 3300049585 Bacteria 4597
342 Ga0501069_0028377 3300049585 Bacteria 3068
343 Ga0501069_0034018 3300049585 Bacteria 2807
344 Ga0501069_0047315 3300049585 Bacteria 2387
345 Ga0501069_0118009 3300049585 Bacteria 1514
346 Ga0501070_0020242 3300049586 Bacteria 5580
347 Ga0501071_0002909 3300049587 Bacteria 10566
348 Ga0501071_0049753 3300049587 Bacteria 3017
349 Ga0501071_0225942 3300049587 Bacteria 1410
350 Ga0501071_0259869 3300049587 Bacteria 1311
351 Ga0501072_0008717 3300049588 Bacteria 7698
352 Ga0501072_0015470 3300049588 Bacteria 5848
353 Ga0501072_0214093 3300049588 Bacteria 1535
354 Ga0501072_0267436 3300049588 Bacteria 1360
355 Ga0501073_0010586 3300049589 Bacteria 6751
356 Ga0501074_0006295 3300049590 Bacteria 8571
357 Ga0501075_0034979 3300049591 Bacteria 3744
358 Ga0501075_0124462 3300049591 Bacteria 1963
359 Ga0501075_0217929 3300049591 Bacteria 1456
360 Ga0501075_0287113 3300049591 Unclassified 1253
361 Ga0501076_0073606 3300049592 Bacteria 2735
362 Ga0501076_0165488 3300049592 Bacteria 1802
363 Ga0501076_0342280 3300049592 Bacteria 1227
364 Ga0501077_0001318 3300049593 Bacteria 14989
365 Ga0501077_0081705 3300049593 Bacteria 2047
366 Ga0501079_0007094 3300049741 Bacteria 8453
367 Ga0501079_0041299 3300049741 Bacteria 3560
368 Ga0501079_0341135 3300049741 Bacteria 1174
369 Ga0501080_0005851 3300049742 Bacteria 11005
370 Ga0501080_0030376 3300049742 Bacteria 5034
371 Ga0501080_0119548 3300049742 Bacteria 2442
372 Ga0501081_0003955 3300049743 Bacteria 9498
373 Ga0501081_0026932 3300049743 Bacteria 3878
374 Ga0501083_0005663 3300049744 Bacteria 8847
375 Ga0501035_0011454 3300049822 Bacteria 8222
376 Ga0501035_0059354 3300049822 Bacteria 3407
377 Ga0501045_0002818 3300049824 Bacteria 11875
378 Ga0501045_0011433 3300049824 Bacteria 6235
379 Ga0501045_0115703 3300049824 Bacteria 1989
380 nmdc:mga05p37_148276_c1 3300050507 Bacteria 2871
381 nmdc:mga05p37_162286_c1 3300050507 Bacteria 2729
382 nmdc:mga05p37_19879_c2 3300050507 Bacteria 4951
383 nmdc:mga05p37_24600_c1 3300050507 Bacteria 7321
384 nmdc:mga09592_1139_c1 3300050508 Bacteria 21166
385 nmdc:mga09592_38665_c1 3300050508 Bacteria 4006
386 nmdc:mga0qj67_11278_c1 3300050509 Bacteria 6693
387 nmdc:mga0qj67_177475_c1 3300050509 Bacteria 1730
388 nmdc:mga06r32_192068_c1 3300050510 Bacteria 2029
389 nmdc:mga06r32_55238_c1 3300050510 Bacteria 3809
390 nmdc:mga06r32_57722_c1 3300050510 Bacteria 3729
391 nmdc:mga08y16_67171_c1 3300050511 Bacteria 3741
392 nmdc:mga08y16_69692_c1 3300050511 Bacteria 3666
393 nmdc:mga0n895_2249_c1 3300050512 Bacteria 14960
394 nmdc:mga0n895_30301_c1 3300050512 Bacteria 5169
395 nmdc:mga0n895_69632_c1 3300050512 Bacteria 3486
396 nmdc:mga0rr50_179566_c1 3300050513 Bacteria 1729
397 nmdc:mga0rr50_194974_c1 3300050513 Bacteria 1662
398 nmdc:mga0a205_4012_c1 3300050515 Bacteria 13165
399 nmdc:mga0a205_49473_c1 3300050515 Bacteria 4057
400 nmdc:mga0a205_68883_c1 3300050515 Bacteria 3417
401 Ga0495595_0003285 3300053084 Bacteria 6423
402 Ga0495595_0012220 3300053084 Bacteria 3604
403 Ga0500568_0003112 3300053139 Bacteria 9460
404 Ga0500616_0000052 3300053153 Bacteria 295313
405 Ga0501084_0005221 3300054114 Bacteria 10630
406 Ga0501084_0005807 3300054114 Bacteria 10158
407 Ga0501084_0059893 3300054114 Bacteria 3187
408 Ga0501084_0146551 3300054114 Bacteria 1989
409 Ga0501084_0256512 3300054114 Bacteria 1476
410 Ga0501082_0012074 3300060353 Bacteria 7423
411 Ga0501082_0029614 3300060353 Bacteria 4716
412 Ga0501082_0331658 3300060353 Bacteria 1326
413 Ga0501082_0361586 3300060353 Bacteria 1266
414 Ga0530510_0003782 3300061734 Bacteria 10422
415 Ga0530510_0008748 3300061734 Bacteria 7080
416 Ga0530510_0017655 3300061734 Bacteria 5055
417 Ga0530510_0132440 3300061734 Bacteria 1835
418 2791911149 2791354901 Bacteria 8322202
419 2795794791 2795385472 Bacteria 6627535
420 2891328746 2891326441 Bacteria 6439512
421 Ga0070697_100262500
422 JGI24751J29686_10010428
423 Ga0070683_100016158
424 Ga0070683_100169469
425 Ga0070690_100029312
426 Ga0070670_100002095
427 Ga0070670_100004879
428 Ga0070670_100047380
429 Ga0068869_100005163
430 Ga0070666_10020459
431 Ga0070680_100109561
432 Ga0070680_100212187
433 Ga0068868_100123857
434 Ga0068868_100290512
435 Ga0070660_100009090
436 Ga0070689_100005528
437 Ga0070689_100019159
438 Ga0070689_100037131
439 Ga0070689_100199272
440 Ga0070689_100205716
441 Ga0070671_100040109
442 Ga0070674_100003172
443 Ga0070674_100020969
444 Ga0070674_100053125
445 Ga0070673_100047098
446 Ga0070673_100232381
447 Ga0070688_100003044
448 Ga0070688_100030603
449 Ga0070688_100037960
450 Ga0070688_100073029
451 Ga0070667_100000363
452 Ga0070713_100002206
453 Ga0070701_10043091
454 Ga0070705_100042316
455 Ga0070700_100008290
456 Ga0070700_100128816
457 Ga0070708_100161661
458 Ga0070678_100015491
459 Ga0070678_100023504
460 Ga0070662_100219629
461 Ga0070681_10039943
462 Ga0068867_100049948
463 Ga0068867_100054854
464 Ga0070685_10013678
465 Ga0070685_10023822
466 Ga0070685_10118567
467 Ga0070706_100094024
468 Ga0070707_100003969
469 Ga0070698_100177835
470 Ga0070684_100121011
471 Ga0068853_100000015
472 Ga0068853_100077653
473 Ga0070672_100103364
474 Ga0070686_100014529
475 Ga0070686_100039160
476 Ga0070696_100092897
477 Ga0070665_100063861
478 Ga0070704_100027297
479 Ga0070704_100168190
480 Ga0068855_100023129
481 Ga0070664_100028739
482 Ga0070664_100090449
483 Ga0068857_100036910
484 Ga0068852_100026843
485 Ga0068859_100508281
486 Ga0068864_100024919
487 Ga0068864_100100136
488 Ga0068866_10036617
489 Ga0068870_10005209
490 Ga0068858_100038404
491 Ga0068858_100130632
492 Ga0070717_10147765
493 Ga0097621_100012284
494 Ga0097621_100140566
495 Ga0068871_100163764
496 Ga0075428_100008258
497 Ga0075428_100055086
498 Ga0075428_100066222
499 Ga0075428_100074850
500 Ga0075430_100053066
501 Ga0075431_100007725
502 Ga0075431_100061682
503 Ga0075431_100093811
504 Ga0075433_10060488
505 Ga0075433_10188120
506 Ga0075433_10205641
507 Ga0075434_100018148
508 Ga0075434_100026498
509 Ga0075434_100048423
510 Ga0075434_100224054
511 Ga0075429_100008860
512 Ga0075429_100027864
513 Ga0097620_100508276
514 Ga0075435_100021235
515 Ga0075435_100124211
516 Ga0075435_100280782
517 Ga0105240_10000120
518 Ga0111539_10019778
519 Ga0111539_10050904
520 Ga0111539_10054531
521 Ga0111539_10063345
522 Ga0111539_10133605
523 Ga0111539_10135579
524 Ga0111539_10139862
525 Ga0111539_10159130
526 Ga0111539_10175216
527 Ga0111539_10209831
528 Ga0105245_10002167
529 Ga0105245_10199499
530 Ga0105245_10229759
531 Ga0105247_10009300
532 Ga0105247_10087233
533 Ga0114129_10041619
534 Ga0114129_10073811
535 Ga0114129_10074427
536 Ga0114129_10139339
537 Ga0114129_10180643
538 Ga0114129_10219720
539 Ga0114129_10405196
540 Ga0114129_10694905
541 Ga0105241_10007514
542 Ga0105241_10014839
543 Ga0105242_10054304
544 Ga0105248_10004057
545 Ga0105248_10164025
546 Ga0105248_10245700
547 Ga0105248_10370324
548 Ga0105237_10000008
549 Ga0105237_10105301
550 Ga0105238_10017067
551 Ga0105239_10009739
552 Ga0105239_10026085
553 Ga0105239_10123152
554 Ga0105246_10032162
555 Ga0105246_10129403
556 Ga0157370_10167611
557 Ga0157369_10322651
558 Ga0157374_10001135
559 Ga0157378_10043467
560 Ga0157378_10181527
561 Ga0157378_10360696
562 Ga0157372_10013352
563 Ga0157372_10019923
564 Ga0157375_10144070
565 Ga0157375_10259582
566 Ga0163163_10031939
567 Ga0163163_10089297
568 Ga0157380_10017739
569 Ga0157377_10004576
570 Ga0157377_10023691
571 Ga0157379_10122873
572 Ga0157376_10467179
573 Ga0206351_10437130
574 Ga0154015_1283142
575 Ga0224712_10044537
576 Ga0207688_10002076
577 Ga0207680_10006052
578 Ga0207680_10135930
579 Ga0207643_10005164
580 Ga0207643_10005227
581 Ga0207654_10007147
582 Ga0207707_10055973
583 Ga0207695_10000204
584 Ga0207671_10000005
585 Ga0207671_10096290
586 Ga0207662_10000068
587 Ga0207662_10065776
588 Ga0207657_10015373
589 Ga0207652_10059982
590 Ga0207646_10047013
591 Ga0207681_10060677
592 Ga0207694_10048168
593 Ga0207650_10074352
594 Ga0207659_10065409
595 Ga0207687_10002022
596 Ga0207687_10017656
597 Ga0207687_10183973
598 Ga0207700_10025932
599 Ga0207644_10066313
600 Ga0207706_10193837
601 Ga0207686_10017627
602 Ga0207686_10018727
603 Ga0207670_10000197
604 Ga0207670_10051886
605 Ga0207670_10150922
606 Ga0207669_10011233
607 Ga0207669_10094456
608 Ga0207704_10028415
609 Ga0207704_10039395
610 Ga0207691_10019186
611 Ga0207711_10062558
612 Ga0207711_10305966
613 Ga0207711_10374004
614 Ga0207689_10097372
615 Ga0207661_10100554
616 Ga0207651_10091227
617 Ga0207651_10134503
618 Ga0207651_10181303
619 Ga0207640_10037860
620 Ga0207658_10000322
621 Ga0207677_10082301
622 Ga0207677_10095633
623 Ga0207703_10096903
624 Ga0207639_10000022
625 Ga0207639_10001291
626 Ga0207708_10002331
627 Ga0207708_10037834
628 Ga0207702_10456599
629 Ga0207648_10072531
630 Ga0207648_10075104
631 Ga0207648_10128246
632 Ga0207648_10134619
633 Ga0207674_10038769
634 Ga0207675_100083058
635 Ga0207683_10084206
636 Ga0207683_10091886
637 Ga0207428_10013444
638 Ga0207428_10034411
639 Ga0207428_10101114
640 Ga0268266_10382979
641 Ga0268265_10308610
642 Ga0268264_10080656
643 Ga0265326_10033480
644 Ga0265319_1002945
645 Ga0265334_10002766
646 Ga0265318_10002950
647 Ga0265323_10009317
648 Ga0265322_10003734
649 Ga0307515_10000018
650 Ga0265338_10000042
651 Ga0265338_10028999
652 Ga0265324_10032308
653 Ga0307512_10020688
654 Ga0265330_10008298
655 Ga0265328_10013357
656 Ga0265328_10062795
657 Ga0265320_10020089
658 Ga0265325_10000453
659 Ga0265329_10005040
660 Ga0265340_10005710
661 Ga0265339_10004237
662 Ga0265331_10049399
663 Ga0265327_10012057
664 Ga0265327_10012474
665 Ga0265316_10008337
666 Ga0265316_10071793
667 Ga0307513_10085473
668 Ga0265313_10006904
669 Ga0265314_10051856
670 Ga0265342_10034500
671 Ga0373953_0029026
672 Ga0373954_0029175
673 Ga0373957_0003977
674 Ga0373955_0015851
675 Ga0373955_0152933
676 Ga0373924_0051761
677 Ga0373931_0008232
678 Ga0373931_0062245
679 Ga0373933_0025876
680 Ga0373937_0026164
681 Ga0395905_0000116
682 Ga0436364_0920199
683 Ga0436364_1436310
684 Ga0436363_0161183
685 Ga0436362_0097592
686 Ga0450923_008701
687 Ga0450907_013106
688 Ga0450918_013036
689 Ga0466969_0011371
690 Ga0453684_0197454
691 Ga0453684_0209791
692 Ga0451576_0037955
693 Ga0451576_0516124
694 Ga0466958_0018056
695 Ga0495592_0033207
696 Ga0495651_0022616
697 Ga0495651_0240851
698 Ga0495651_0242997
699 Ga0495653_0023197
700 Ga0495653_0026973
701 Ga0495639_0076753
702 Ga0495608_0002701
703 Ga0495608_0011799
704 Ga0495618_0030852
705 Ga0495628_0056747
706 Ga0495586_0075133
707 Ga0495587_0033226
708 Ga0495667_0067958
709 Ga0495634_0106357
710 Ga0495634_0134310
711 Ga0495635_0039239
712 Ga0495657_0037277
713 Ga0495599_0009228
714 Ga0495604_0055630
715 Ga0495680_0098557
716 Ga0495675_0001211
717 Ga0495684_0031300
718 Ga0496109_0079099
719 Ga0496111_0111934
720 Ga0496112_0310746
721 Ga0501031_0001218
722 Ga0501031_0030933
723 Ga0501032_0011050
724 Ga0501033_0004490
725 Ga0501033_0094184
726 Ga0501036_0023423
727 Ga0501036_0044888
728 Ga0501036_0171165
729 Ga0501037_0036268
730 Ga0501038_0002518
731 Ga0501038_0065970
732 Ga0501039_0004869
733 Ga0501039_0019364
734 Ga0501039_0177067
735 Ga0501040_0011969
736 Ga0501040_0164401
737 Ga0501040_0212771
738 Ga0501041_0011363
739 Ga0501041_0017674
740 Ga0501041_0068556
741 Ga0501042_0004287
742 Ga0501042_0004385
743 Ga0501043_0070946
744 Ga0501043_0077187
745 Ga0501046_0003418
746 Ga0501046_0008548
747 Ga0501046_0017472
748 Ga0501048_0002460
749 Ga0501048_0009037
750 Ga0501048_0090239
751 Ga0501067_0008057
752 Ga0501067_0014567
753 Ga0501067_0025426
754 Ga0501067_0131975
755 Ga0501068_0001817
756 Ga0501068_0013211
757 Ga0501068_0045722
758 Ga0501068_0050534
759 Ga0501068_0054495
760 Ga0501069_0001102
761 Ga0501069_0012011
762 Ga0501069_0028377
763 Ga0501069_0034018
764 Ga0501069_0047315
765 Ga0501069_0118009
766 Ga0501070_0020242
767 Ga0501071_0002909
768 Ga0501071_0049753
769 Ga0501071_0225942
770 Ga0501071_0259869
771 Ga0501072_0008717
772 Ga0501072_0015470
773 Ga0501072_0214093
774 Ga0501072_0267436
775 Ga0501073_0010586
776 Ga0501074_0006295
777 Ga0501075_0034979
778 Ga0501075_0124462
779 Ga0501075_0217929
780 Ga0501075_0287113
781 Ga0501076_0073606
782 Ga0501076_0165488
783 Ga0501076_0342280
784 Ga0501077_0001318
785 Ga0501077_0081705
786 Ga0501079_0007094
787 Ga0501079_0041299
788 Ga0501079_0341135
789 Ga0501080_0005851
790 Ga0501080_0030376
791 Ga0501080_0119548
792 Ga0501081_0003955
793 Ga0501081_0026932
794 Ga0501083_0005663
795 Ga0501035_0011454
796 Ga0501035_0059354
797 Ga0501045_0002818
798 Ga0501045_0011433
799 Ga0501045_0115703
800 nmdc:mga05p37_148276_c1
801 nmdc:mga05p37_162286_c1
802 nmdc:mga05p37_19879_c2
803 nmdc:mga05p37_24600_c1
804 nmdc:mga09592_1139_c1
805 nmdc:mga09592_38665_c1
806 nmdc:mga0qj67_11278_c1
807 nmdc:mga0qj67_177475_c1
808 nmdc:mga06r32_192068_c1
809 nmdc:mga06r32_55238_c1
810 nmdc:mga06r32_57722_c1
811 nmdc:mga08y16_67171_c1
812 nmdc:mga08y16_69692_c1
813 nmdc:mga0n895_2249_c1
814 nmdc:mga0n895_30301_c1
815 nmdc:mga0n895_69632_c1
816 nmdc:mga0rr50_179566_c1
817 nmdc:mga0rr50_194974_c1
818 nmdc:mga0a205_4012_c1
819 nmdc:mga0a205_49473_c1
820 nmdc:mga0a205_68883_c1
821 Ga0495595_0003285
822 Ga0495595_0012220
823 Ga0500568_0003112
824 Ga0500616_0000052
825 Ga0501084_0005221
826 Ga0501084_0005807
827 Ga0501084_0059893
828 Ga0501084_0146551
829 Ga0501084_0256512
830 Ga0501082_0012074
831 Ga0501082_0029614
832 Ga0501082_0331658
833 Ga0501082_0361586
834 Ga0530510_0003782
835 Ga0530510_0008748
836 Ga0530510_0017655
837 Ga0530510_0132440
838 2791911149
839 2795794791
840 2891328746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

230

361

0.97

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

80

193

0.94

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

263

396

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dfv-assembly3.cif.gz_C hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii 0.9759 2 343
2d8a-assembly1.cif.gz_A crystal structure of ph0655 from pyrococcus horikoshii ot3 0.9733 1 343
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9686 1 346
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9658 1 346
2d8a-assembly1.cif.gz_A crystal structure of ph0655 from pyrococcus horikoshii ot3 0.9619 1 343
ID Description Score Start End Superfamily
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9761 3 151 3.90.180.10
2dfvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9733 155 289 3.40.50.720
2dfvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 155 289 3.40.50.720
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9571 3 151 3.90.180.10
2ejvB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9518 155 289 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1I5VD59-F1-model_v4 L-threonine 3-dehydrogenase 0.9808 1 346 GO:0008270
GO:0016491
AF-A0A3D1S9W8-F1-model_v4 L-threonine 3-dehydrogenase 0.979 1 261 GO:0008270
GO:0016491
AF-A0A3C2EJZ6-F1-model_v4 deleted 0.9786 1 344
AF-A0A3C2EJZ6-F1-model_v4 deleted 0.9758 1 344
AF-X0TAU6-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9727 163 344 GO:0016491

Map