F439699

General Info

Members Datasets Scaffolds Average Seq Length
420 167 840 126

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100536040|Ga0070708_1005360402
Length 132
Sequence MSVTGLDFIWLEVDSIKRSIEFYRDELGLEVDESDSEGAPPIATVRAGKLKIILAEEFKPMITRGRGIHLFLRVTDVDEYYRELRSRGLRIAPPSDEGWGGRFITVKDPDGYRLFFFTWTSSKQWPTFANQD

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 47.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100536040 3300005445 Unclassified 1104
2 Ga0065712_10075086 3300005290 Bacteria 3933
3 Ga0065715_10009343 3300005293 Bacteria 3669
4 Ga0065715_10011735 3300005293 Bacteria 2867
5 Ga0065715_10108042 3300005293 Bacteria 2739
6 Ga0065715_10555770 3300005293 Unclassified 737
7 Ga0065707_10147205 3300005295 Bacteria 1693
8 Ga0065707_10188587 3300005295 Bacteria 1374
9 Ga0070676_10094190 3300005328 Bacteria 1840
10 Ga0070690_100016010 3300005330 Bacteria 4483
11 Ga0070690_100068851 3300005330 Unclassified 2296
12 Ga0070690_100785017 3300005330 Unclassified 738
13 Ga0070690_101427059 3300005330 Unclassified 557
14 Ga0070670_101671496 3300005331 Unclassified 586
15 Ga0070670_102015432 3300005331 Unclassified 532
16 Ga0068869_100016864 3300005334 Bacteria 4936
17 Ga0068869_100068904 3300005334 Bacteria 2614
18 Ga0068869_100081843 3300005334 Bacteria 2412
19 Ga0068869_100194561 3300005334 Bacteria 1596
20 Ga0070666_10040959 3300005335 Bacteria 3094
21 Ga0070666_10068840 3300005335 Bacteria 2406
22 Ga0070682_100000059 3300005337 Bacteria 106643
23 Ga0068868_100027890 3300005338 Bacteria 4311
24 Ga0070689_100364078 3300005340 Bacteria 1215
25 Ga0070689_101503457 3300005340 Bacteria 610
26 Ga0070689_101900266 3300005340 Unclassified 544
27 Ga0070687_100084555 3300005343 Unclassified 1739
28 Ga0070692_10013846 3300005345 Unclassified 3770
29 Ga0070669_100089061 3300005353 Bacteria 2311
30 Ga0070669_100119367 3300005353 Bacteria 2010
31 Ga0070669_100195501 3300005353 Unclassified 1589
32 Ga0070669_100375103 3300005353 Bacteria 1159
33 Ga0070669_101634337 3300005353 Unclassified 561
34 Ga0070675_100135581 3300005354 Bacteria 2101
35 Ga0070675_100302930 3300005354 Unclassified 1408
36 Ga0070675_100896237 3300005354 Unclassified 813
37 Ga0070671_100008653 3300005355 Bacteria 8164
38 Ga0070671_100622277 3300005355 Unclassified 934
39 Ga0070674_100402016 3300005356 Unclassified 1119
40 Ga0070674_100857455 3300005356 Unclassified 788
41 Ga0070674_101881745 3300005356 Unclassified 543
42 Ga0070673_100081371 3300005364 Bacteria 2626
43 Ga0070673_100175863 3300005364 Bacteria 1829
44 Ga0070673_100274654 3300005364 Bacteria 1476
45 Ga0070688_101584893 3300005365 Bacteria 534
46 Ga0070667_100148654 3300005367 Unclassified 2056
47 Ga0070701_10127064 3300005438 Unclassified 1444
48 Ga0070701_10259580 3300005438 Unclassified 1052
49 Ga0070705_100048409 3300005440 Bacteria 2462
50 Ga0070705_100132773 3300005440 Unclassified 1626
51 Ga0070705_100333006 3300005440 Bacteria 1100
52 Ga0070705_100421468 3300005440 Bacteria 994
53 Ga0070705_100436168 3300005440 Unclassified 979
54 Ga0070700_100113853 3300005441 Unclassified 1803
55 Ga0070700_100127409 3300005441 Bacteria 1713
56 Ga0070700_100416091 3300005441 Unclassified 1015
57 Ga0070700_100749785 3300005441 Unclassified 781
58 Ga0070694_100008149 3300005444 Bacteria 6402
59 Ga0070694_100381530 3300005444 Unclassified 1099
60 Ga0070694_100576540 3300005444 Bacteria 903
61 Ga0070694_100619434 3300005444 Unclassified 873
62 Ga0070694_101593341 3300005444 Unclassified 554
63 Ga0070708_100003716 3300005445 Bacteria 11967
64 Ga0070708_100067929 3300005445 Bacteria 3203
65 Ga0070708_100098883 3300005445 Unclassified 2668
66 Ga0070708_100381889 3300005445 Bacteria 1328
67 Ga0070708_100481044 3300005445 Unclassified 1172
68 Ga0070708_100610438 3300005445 Bacteria 1028
69 Ga0070678_100373899 3300005456 Bacteria 1231
70 Ga0070678_100917695 3300005456 Unclassified 801
71 Ga0070681_10721072 3300005458 Unclassified 913
72 Ga0068867_100223017 3300005459 Unclassified 1520
73 Ga0068867_100230688 3300005459 Bacteria 1496
74 Ga0068867_101797407 3300005459 Bacteria 576
75 Ga0070706_100006829 3300005467 Bacteria 10774
76 Ga0070706_100173761 3300005467 Bacteria 2012
77 Ga0070706_100257637 3300005467 Unclassified 1628
78 Ga0070706_100437015 3300005467 Unclassified 1218
79 Ga0070706_102179668 3300005467 Unclassified 500
80 Ga0070707_100094475 3300005468 Bacteria 2895
81 Ga0070707_100153658 3300005468 Unclassified 2241
82 Ga0070707_100353107 3300005468 Unclassified 1428
83 Ga0070698_100008079 3300005471 Bacteria 11381
84 Ga0070698_100029626 3300005471 Bacteria 5683
85 Ga0070698_100932429 3300005471 Unclassified 814
86 Ga0070698_101099778 3300005471 Bacteria 743
87 Ga0070699_100004780 3300005518 Bacteria 11972
88 Ga0070699_100021698 3300005518 Bacteria 5537
89 Ga0070699_100255805 3300005518 Bacteria 1566
90 Ga0070699_100480238 3300005518 Unclassified 1128
91 Ga0070699_100812592 3300005518 Unclassified 856
92 Ga0070699_101803250 3300005518 Unclassified 560
93 Ga0070697_100000018 3300005536 Bacteria 140702
94 Ga0070697_100032062 3300005536 Bacteria 4226
95 Ga0070697_100317546 3300005536 Bacteria 1341
96 Ga0070697_100368074 3300005536 Unclassified 1243
97 Ga0068853_100699509 3300005539 Unclassified 967
98 Ga0070672_100343469 3300005543 Unclassified 1271
99 Ga0070686_100012879 3300005544 Bacteria 4775
100 Ga0070686_100017326 3300005544 Bacteria 4208
101 Ga0070686_100023878 3300005544 Bacteria 3660
102 Ga0070686_100037771 3300005544 Bacteria 2997
103 Ga0070686_100250622 3300005544 Unclassified 1293
104 Ga0070686_101016225 3300005544 Unclassified 681
105 Ga0070695_100755494 3300005545 Unclassified 776
106 Ga0070696_100017772 3300005546 Bacteria 4801
107 Ga0070696_100186549 3300005546 Bacteria 1541
108 Ga0070696_100286252 3300005546 Unclassified 1258
109 Ga0070696_100702343 3300005546 Unclassified 824
110 Ga0070696_100844681 3300005546 Unclassified 756
111 Ga0070665_100083617 3300005548 Bacteria 3196
112 Ga0070704_100025524 3300005549 Bacteria 3892
113 Ga0070704_100182527 3300005549 Unclassified 1679
114 Ga0070704_100440751 3300005549 Unclassified 1119
115 Ga0070704_100639435 3300005549 Unclassified 938
116 Ga0070704_100818070 3300005549 Unclassified 833
117 Ga0070704_101361872 3300005549 Unclassified 650
118 Ga0070664_100956493 3300005564 Unclassified 804
119 Ga0070664_101399954 3300005564 Unclassified 661
120 Ga0070664_101703423 3300005564 Unclassified 597
121 Ga0068857_100117054 3300005577 Unclassified 2398
122 Ga0068857_100317999 3300005577 Bacteria 1437
123 Ga0068857_101950745 3300005577 Bacteria 575
124 Ga0068854_100144464 3300005578 Bacteria 1829
125 Ga0068854_100510860 3300005578 Bacteria 1013
126 Ga0068854_100564921 3300005578 Bacteria 967
127 Ga0068854_100806930 3300005578 Bacteria 818
128 Ga0070702_100004986 3300005615 Bacteria 6129
129 Ga0068852_100386621 3300005616 Bacteria 1374
130 Ga0068852_100411238 3300005616 Unclassified 1333
131 Ga0068852_102603525 3300005616 Bacteria 525
132 Ga0068859_100015753 3300005617 Bacteria 7596
133 Ga0068859_100190768 3300005617 Bacteria 2134
134 Ga0068859_100199912 3300005617 Bacteria 2083
135 Ga0068859_100271609 3300005617 Bacteria 1788
136 Ga0068859_101472485 3300005617 Unclassified 751
137 Ga0068859_101492135 3300005617 Unclassified 746
138 Ga0068864_100009488 3300005618 Bacteria 8029
139 Ga0068864_100030450 3300005618 Bacteria 4574
140 Ga0068864_100121520 3300005618 Bacteria 2335
141 Ga0068864_100469243 3300005618 Bacteria 1206
142 Ga0068864_101562675 3300005618 Unclassified 663
143 Ga0068866_10048313 3300005718 Unclassified 2151
144 Ga0068866_10119356 3300005718 Bacteria 1483
145 Ga0068861_100060930 3300005719 Unclassified 2894
146 Ga0068870_10008899 3300005840 Bacteria 4535
147 Ga0068870_10116968 3300005840 Unclassified 1530
148 Ga0068863_100036934 3300005841 Bacteria 4651
149 Ga0068863_100414069 3300005841 Bacteria 1319
150 Ga0068863_100509367 3300005841 Unclassified 1186
151 Ga0068863_101109875 3300005841 Unclassified 796
152 Ga0068858_100207502 3300005842 Unclassified 1854
153 Ga0068858_100856939 3300005842 Unclassified 887
154 Ga0068860_100043913 3300005843 Bacteria 4261
155 Ga0068860_100154998 3300005843 Unclassified 2207
156 Ga0068860_102306096 3300005843 Unclassified 559
157 Ga0068862_100043833 3300005844 Bacteria 3814
158 Ga0068862_100045956 3300005844 Bacteria 3727
159 Ga0068862_100097471 3300005844 Bacteria 2567
160 Ga0068862_100139769 3300005844 Unclassified 2149
161 Ga0068862_102493995 3300005844 Unclassified 529
162 Ga0081539_10000871 3300005985 Bacteria 57873
163 Ga0081539_10336575 3300005985 Unclassified 638
164 Ga0081539_10457007 3300005985 Bacteria 529
165 Ga0070716_100000007 3300006173 Bacteria 256300
166 Ga0097621_100022111 3300006237 Unclassified 4933
167 Ga0097621_100225188 3300006237 Bacteria 1635
168 Ga0097621_100290393 3300006237 Bacteria 1441
169 Ga0068871_100003200 3300006358 Bacteria 11231
170 Ga0075433_10006327 3300006852 Bacteria 9357
171 Ga0075433_10094534 3300006852 Bacteria 2645
172 Ga0075433_10201672 3300006852 Bacteria 1769
173 Ga0075433_10514056 3300006852 Bacteria 1054
174 Ga0075434_100024472 3300006871 Bacteria 5902
175 Ga0068865_100113379 3300006881 Bacteria 2004
176 Ga0068865_100208818 3300006881 Unclassified 1520
177 Ga0068865_100772459 3300006881 Bacteria 827
178 Ga0097620_100015753 3300006931 Bacteria 7596
179 Ga0097620_100190763 3300006931 Bacteria 2134
180 Ga0097620_100199894 3300006931 Bacteria 2083
181 Ga0097620_100271612 3300006931 Bacteria 1788
182 Ga0097620_101472205 3300006931 Unclassified 751
183 Ga0097620_101492053 3300006931 Unclassified 746
184 Ga0075435_100432723 3300007076 Unclassified 1134
185 Ga0105250_10193938 3300009092 Unclassified 855
186 Ga0105240_11708288 3300009093 Unclassified 657
187 Ga0105240_12165039 3300009093 Bacteria 577
188 Ga0111539_10889551 3300009094 Bacteria 1036
189 Ga0111539_12526469 3300009094 Unclassified 596
190 Ga0105245_10112525 3300009098 Bacteria 2533
191 Ga0105245_11244536 3300009098 Unclassified 793
192 Ga0114129_10024551 3300009147 Bacteria 8540
193 Ga0114129_10034664 3300009147 Bacteria 7130
194 Ga0114129_10209455 3300009147 Unclassified 2636
195 Ga0105243_10035916 3300009148 Bacteria 3843
196 Ga0105243_10141529 3300009148 Bacteria 2053
197 Ga0105243_10488344 3300009148 Unclassified 1164
198 Ga0105243_10957687 3300009148 Bacteria 855
199 Ga0105243_11649307 3300009148 Bacteria 669
200 Ga0105243_12264036 3300009148 Unclassified 581
201 Ga0105241_10036212 3300009174 Unclassified 3713
202 Ga0105241_10284344 3300009174 Bacteria 1414
203 Ga0105241_10550067 3300009174 Unclassified 1036
204 Ga0105241_11151131 3300009174 Unclassified 733
205 Ga0105242_10406175 3300009176 Unclassified 1272
206 Ga0105242_10776173 3300009176 Bacteria 946
207 Ga0105242_10824398 3300009176 Unclassified 920
208 Ga0105242_11869215 3300009176 Unclassified 640
209 Ga0105242_11899090 3300009176 Unclassified 636
210 Ga0105248_10031555 3300009177 Bacteria 5920
211 Ga0105248_10203776 3300009177 Bacteria 2229
212 Ga0105248_10383867 3300009177 Bacteria 1582
213 Ga0105248_10810883 3300009177 Bacteria 1056
214 Ga0105248_11273985 3300009177 Unclassified 831
215 Ga0105238_10016298 3300009551 Bacteria 7522
216 Ga0105249_10031295 3300009553 Bacteria 4812
217 Ga0105249_10721882 3300009553 Unclassified 1058
218 Ga0105239_10359514 3300010375 Unclassified 1644
219 Ga0105239_13564116 3300010375 Unclassified 506
220 Ga0105246_10105903 3300011119 Bacteria 2056
221 Ga0105246_10171935 3300011119 Unclassified 1660
222 Ga0105246_10194633 3300011119 Bacteria 1572
223 Ga0105246_10258445 3300011119 Bacteria 1386
224 Ga0105246_10449546 3300011119 Unclassified 1082
225 Ga0157373_10001400 3300013100 Bacteria 18481
226 Ga0157371_10290440 3300013102 Unclassified 1182
227 Ga0157374_10120483 3300013296 Bacteria 2532
228 Ga0157374_10172494 3300013296 Unclassified 2110
229 Ga0157378_10001968 3300013297 Bacteria 18403
230 Ga0157378_10045294 3300013297 Bacteria 3908
231 Ga0157378_10083903 3300013297 Bacteria 2884
232 Ga0157378_10816499 3300013297 Bacteria 959
233 Ga0157378_10923734 3300013297 Bacteria 904
234 Ga0157378_10930169 3300013297 Bacteria 901
235 Ga0157378_11379795 3300013297 Unclassified 747
236 Ga0157378_11667821 3300013297 Bacteria 684
237 Ga0163162_10004385 3300013306 Bacteria 13582
238 Ga0163162_10020007 3300013306 Bacteria 6574
239 Ga0163162_11228079 3300013306 Unclassified 851
240 Ga0163162_11336307 3300013306 Unclassified 815
241 Ga0163162_12461829 3300013306 Unclassified 598
242 Ga0157372_10650896 3300013307 Unclassified 1227
243 Ga0157375_10084391 3300013308 Bacteria 3225
244 Ga0157375_10237982 3300013308 Bacteria 1980
245 Ga0157375_10425213 3300013308 Unclassified 1494
246 Ga0163163_10001070 3300014325 Bacteria 23278
247 Ga0163163_10003204 3300014325 Bacteria 13862
248 Ga0163163_10151138 3300014325 Unclassified 2365
249 Ga0163163_10156281 3300014325 Bacteria 2325
250 Ga0163163_10675818 3300014325 Bacteria 1096
251 Ga0157380_10006318 3300014326 Bacteria 8327
252 Ga0157380_10022022 3300014326 Unclassified 4788
253 Ga0157380_10231357 3300014326 Unclassified 1660
254 Ga0157380_10874500 3300014326 Unclassified 923
255 Ga0157380_11133972 3300014326 Unclassified 823
256 Ga0157380_11359218 3300014326 Bacteria 759
257 Ga0157380_11569470 3300014326 Unclassified 713
258 Ga0157377_10006470 3300014745 Bacteria 5591
259 Ga0157376_10017943 3300014969 Bacteria 5412
260 Ga0157376_10028104 3300014969 Unclassified 4467
261 Ga0163161_10129523 3300017792 Unclassified 1902
262 Ga0163161_10248243 3300017792 Bacteria 1386
263 Ga0163161_11333928 3300017792 Unclassified 625
264 Ga0213876_10000022 3300021384 Bacteria 259520
265 Ga0213876_10000153 3300021384 Bacteria 73076
266 Ga0213876_10008427 3300021384 Bacteria 5580
267 Ga0213876_10379773 3300021384 Bacteria 751
268 Ga0207642_10091717 3300025899 Unclassified 1502
269 Ga0207642_10144833 3300025899 Unclassified 1257
270 Ga0207642_10353904 3300025899 Unclassified 867
271 Ga0207680_10098333 3300025903 Bacteria 1875
272 Ga0207680_10320003 3300025903 Unclassified 1085
273 Ga0207647_10143229 3300025904 Bacteria 1400
274 Ga0207645_10027971 3300025907 Bacteria 3640
275 Ga0207643_10079528 3300025908 Bacteria 1898
276 Ga0207643_10084026 3300025908 Unclassified 1848
277 Ga0207643_10643452 3300025908 Unclassified 684
278 Ga0207684_10002535 3300025910 Bacteria 18355
279 Ga0207684_10317839 3300025910 Bacteria 1342
280 Ga0207654_10470458 3300025911 Archaea 884
281 Ga0207654_10914799 3300025911 Unclassified 636
282 Ga0207707_10550041 3300025912 Unclassified 981
283 Ga0207695_10393556 3300025913 Unclassified 1270
284 Ga0207695_11728842 3300025913 Bacteria 506
285 Ga0207662_10027230 3300025918 Bacteria 3299
286 Ga0207662_10185567 3300025918 Bacteria 1340
287 Ga0207646_10213646 3300025922 Unclassified 1742
288 Ga0207646_10349565 3300025922 Unclassified 1336
289 Ga0207646_10639046 3300025922 Unclassified 954
290 Ga0207646_11369162 3300025922 Unclassified 616
291 Ga0207681_10057434 3300025923 Unclassified 2660
292 Ga0207681_10994859 3300025923 Unclassified 703
293 Ga0207650_10567128 3300025925 Bacteria 953
294 Ga0207659_10202241 3300025926 Unclassified 1587
295 Ga0207687_10121934 3300025927 Bacteria 1951
296 Ga0207687_10464876 3300025927 Unclassified 1051
297 Ga0207644_10255434 3300025931 Unclassified 1400
298 Ga0207706_10051058 3300025933 Bacteria 3653
299 Ga0207686_10076366 3300025934 Unclassified 2172
300 Ga0207686_10183298 3300025934 Bacteria 1486
301 Ga0207709_10119299 3300025935 Bacteria 1778
302 Ga0207709_10184297 3300025935 Bacteria 1477
303 Ga0207709_10867874 3300025935 Unclassified 732
304 Ga0207709_11241702 3300025935 Bacteria 615
305 Ga0207670_10438199 3300025936 Unclassified 1051
306 Ga0207670_10606625 3300025936 Bacteria 899
307 Ga0207669_10223851 3300025937 Bacteria 1383
308 Ga0207669_10803770 3300025937 Unclassified 780
309 Ga0207669_11673284 3300025937 Unclassified 543
310 Ga0207704_10083776 3300025938 Unclassified 2070
311 Ga0207665_10000699 3300025939 Bacteria 22745
312 Ga0207711_10149425 3300025941 Bacteria 2107
313 Ga0207711_10839663 3300025941 Unclassified 855
314 Ga0207711_10964583 3300025941 Unclassified 792
315 Ga0207689_10001374 3300025942 Bacteria 23327
316 Ga0207689_10301140 3300025942 Bacteria 1329
317 Ga0207651_10128804 3300025960 Unclassified 1933
318 Ga0207651_10522311 3300025960 Bacteria 1029
319 Ga0207651_10595649 3300025960 Bacteria 966
320 Ga0207651_11386129 3300025960 Unclassified 633
321 Ga0207712_10095322 3300025961 Bacteria 2200
322 Ga0207712_10409248 3300025961 Archaea 1142
323 Ga0207712_10509526 3300025961 Bacteria 1030
324 Ga0207712_12054753 3300025961 Unclassified 511
325 Ga0207668_10434608 3300025972 Unclassified 1117
326 Ga0207668_11060497 3300025972 Unclassified 726
327 Ga0207640_10130652 3300025981 Bacteria 1815
328 Ga0207640_10367491 3300025981 Bacteria 1161
329 Ga0207640_10466340 3300025981 Bacteria 1044
330 Ga0207640_10703997 3300025981 Unclassified 866
331 Ga0207677_10038786 3300026023 Unclassified 3126
332 Ga0207677_10453302 3300026023 Unclassified 1099
333 Ga0207677_11328796 3300026023 Unclassified 661
334 Ga0207703_10074036 3300026035 Bacteria 2819
335 Ga0207703_10262236 3300026035 Unclassified 1562
336 Ga0207708_10102168 3300026075 Unclassified 2219
337 Ga0207708_10126360 3300026075 Unclassified 1996
338 Ga0207708_10398467 3300026075 Bacteria 1138
339 Ga0207708_10538184 3300026075 Bacteria 983
340 Ga0207708_10821482 3300026075 Unclassified 801
341 Ga0207708_11018737 3300026075 Unclassified 720
342 Ga0207641_10130959 3300026088 Unclassified 2252
343 Ga0207641_10512664 3300026088 Bacteria 1166
344 Ga0207641_10950653 3300026088 Unclassified 855
345 Ga0207648_10029941 3300026089 Bacteria 4828
346 Ga0207648_10239448 3300026089 Bacteria 1615
347 Ga0207648_10376855 3300026089 Bacteria 1282
348 Ga0207676_10007416 3300026095 Bacteria 7778
349 Ga0207676_10123271 3300026095 Bacteria 2189
350 Ga0207676_10142049 3300026095 Bacteria 2056
351 Ga0207676_10282444 3300026095 Bacteria 1508
352 Ga0207676_11614105 3300026095 Unclassified 646
353 Ga0207674_10367044 3300026116 Unclassified 1392
354 Ga0207674_10392624 3300026116 Bacteria 1341
355 Ga0207674_10782652 3300026116 Unclassified 921
356 Ga0207674_11607342 3300026116 Unclassified 619
357 Ga0207675_100013229 3300026118 Bacteria 7703
358 Ga0207675_100180609 3300026118 Bacteria 2020
359 Ga0207675_101094704 3300026118 Bacteria 816
360 Ga0207683_10350467 3300026121 Bacteria 1355
361 Ga0207683_10437529 3300026121 Unclassified 1205
362 Ga0207698_10412013 3300026142 Unclassified 1294
363 Ga0207698_11183979 3300026142 Bacteria 778
364 Ga0207698_11513601 3300026142 Unclassified 686
365 Ga0268266_10048331 3300028379 Bacteria 3647
366 Ga0268265_10034723 3300028380 Bacteria 3678
367 Ga0268265_10251107 3300028380 Bacteria 1567
368 Ga0268265_11524705 3300028380 Unclassified 672
369 Ga0268265_12040288 3300028380 Unclassified 581
370 Ga0268265_12422129 3300028380 Unclassified 531
371 Ga0268264_10119541 3300028381 Unclassified 2320
372 Ga0268264_10441631 3300028381 Unclassified 1259
373 Ga0268264_10944471 3300028381 Unclassified 867
374 Ga0307515_10321013 3300028794 Bacteria 1215
375 Ga0316182_1216427 3300030745 Unclassified 720
376 Ga0307513_10001943 3300031456 Bacteria 29245
377 Ga0307405_10194313 3300031731 Bacteria 1468
378 Ga0307405_10585873 3300031731 Unclassified 908
379 Ga0307410_10722899 3300031852 Bacteria 841
380 Ga0307406_10253303 3300031901 Unclassified 1328
381 Ga0307416_100366691 3300032002 Unclassified 1465
382 Ga0307416_102692806 3300032002 Unclassified 594
383 Ga0307416_103025711 3300032002 Bacteria 562
384 Ga0307414_10902884 3300032004 Unclassified 810
385 Ga0307411_10987464 3300032005 Bacteria 753
386 Ga0307415_100498884 3300032126 Bacteria 1064
387 Ga0373937_0253211 3300036401 Bacteria 1660
388 Ga0395900_0146563 3300037418 Bacteria 2414
389 Ga0395898_0817452 3300037466 Bacteria 872
390 Ga0395905_0017908 3300037471 Bacteria 6729
391 Ga0436365_0407503 3300039437 Bacteria 219857
392 Ga0436365_1401097 3300039437 Bacteria 5561
393 Ga0436365_1438887 3300039437 Bacteria 84801
394 Ga0436365_1737195 3300039437 Bacteria 728
395 Ga0436365_1822207 3300039437 Unclassified 733
396 Ga0436362_0036936 3300039453 Unclassified 592
397 Ga0436362_0666690 3300039453 Bacteria 583
398 Ga0451576_0989793 3300045051 Unclassified 881
399 Ga0495610_0172235 3300046512 Unclassified 907
400 Ga0495632_0050354 3300046519 Unclassified 2054
401 Ga0495663_0004997 3300046525 Bacteria 3704
402 Ga0495598_0009801 3300046537 Bacteria 2276
403 Ga0495621_0000053 3300046539 Bacteria 22107
404 Ga0495668_0177469 3300046616 Bacteria 1167
405 Ga0495647_0421555 3300046681 Unclassified 615
406 Ga0495658_0112807 3300046683 Unclassified 1636
407 Ga0495636_0116385 3300047318 Unclassified 1180
408 Ga0495672_0115822 3300047320 Bacteria 1432
409 Ga0496104_0435096 3300048907 Bacteria 1224
410 Ga0496104_0820241 3300048907 Unclassified 836
411 Ga0496110_1288959 3300048913 Unclassified 640
412 Ga0496111_1149480 3300048914 Unclassified 552
413 Ga0496112_0795047 3300048915 Unclassified 871
414 Ga0496112_1463743 3300048915 Unclassified 597
415 nmdc:mga06r32_930702_c1 3300050510 Unclassified 824
416 nmdc:mga08y16_2180562_c1 3300050511 Unclassified 501
417 nmdc:mga0n895_136639_c1 3300050512 Unclassified 2478
418 nmdc:mga0rr50_418930_c1 3300050513 Unclassified 1133
419 nmdc:mga0a205_52021_c1 3300050515 Unclassified 3953
420 nmdc:mga0a205_7394_c1 3300050515 Bacteria 9946
421 Ga0070708_100536040
422 Ga0065712_10075086
423 Ga0065715_10009343
424 Ga0065715_10011735
425 Ga0065715_10108042
426 Ga0065715_10555770
427 Ga0065707_10147205
428 Ga0065707_10188587
429 Ga0070676_10094190
430 Ga0070690_100016010
431 Ga0070690_100068851
432 Ga0070690_100785017
433 Ga0070690_101427059
434 Ga0070670_101671496
435 Ga0070670_102015432
436 Ga0068869_100016864
437 Ga0068869_100068904
438 Ga0068869_100081843
439 Ga0068869_100194561
440 Ga0070666_10040959
441 Ga0070666_10068840
442 Ga0070682_100000059
443 Ga0068868_100027890
444 Ga0070689_100364078
445 Ga0070689_101503457
446 Ga0070689_101900266
447 Ga0070687_100084555
448 Ga0070692_10013846
449 Ga0070669_100089061
450 Ga0070669_100119367
451 Ga0070669_100195501
452 Ga0070669_100375103
453 Ga0070669_101634337
454 Ga0070675_100135581
455 Ga0070675_100302930
456 Ga0070675_100896237
457 Ga0070671_100008653
458 Ga0070671_100622277
459 Ga0070674_100402016
460 Ga0070674_100857455
461 Ga0070674_101881745
462 Ga0070673_100081371
463 Ga0070673_100175863
464 Ga0070673_100274654
465 Ga0070688_101584893
466 Ga0070667_100148654
467 Ga0070701_10127064
468 Ga0070701_10259580
469 Ga0070705_100048409
470 Ga0070705_100132773
471 Ga0070705_100333006
472 Ga0070705_100421468
473 Ga0070705_100436168
474 Ga0070700_100113853
475 Ga0070700_100127409
476 Ga0070700_100416091
477 Ga0070700_100749785
478 Ga0070694_100008149
479 Ga0070694_100381530
480 Ga0070694_100576540
481 Ga0070694_100619434
482 Ga0070694_101593341
483 Ga0070708_100003716
484 Ga0070708_100067929
485 Ga0070708_100098883
486 Ga0070708_100381889
487 Ga0070708_100481044
488 Ga0070708_100610438
489 Ga0070678_100373899
490 Ga0070678_100917695
491 Ga0070681_10721072
492 Ga0068867_100223017
493 Ga0068867_100230688
494 Ga0068867_101797407
495 Ga0070706_100006829
496 Ga0070706_100173761
497 Ga0070706_100257637
498 Ga0070706_100437015
499 Ga0070706_102179668
500 Ga0070707_100094475
501 Ga0070707_100153658
502 Ga0070707_100353107
503 Ga0070698_100008079
504 Ga0070698_100029626
505 Ga0070698_100932429
506 Ga0070698_101099778
507 Ga0070699_100004780
508 Ga0070699_100021698
509 Ga0070699_100255805
510 Ga0070699_100480238
511 Ga0070699_100812592
512 Ga0070699_101803250
513 Ga0070697_100000018
514 Ga0070697_100032062
515 Ga0070697_100317546
516 Ga0070697_100368074
517 Ga0068853_100699509
518 Ga0070672_100343469
519 Ga0070686_100012879
520 Ga0070686_100017326
521 Ga0070686_100023878
522 Ga0070686_100037771
523 Ga0070686_100250622
524 Ga0070686_101016225
525 Ga0070695_100755494
526 Ga0070696_100017772
527 Ga0070696_100186549
528 Ga0070696_100286252
529 Ga0070696_100702343
530 Ga0070696_100844681
531 Ga0070665_100083617
532 Ga0070704_100025524
533 Ga0070704_100182527
534 Ga0070704_100440751
535 Ga0070704_100639435
536 Ga0070704_100818070
537 Ga0070704_101361872
538 Ga0070664_100956493
539 Ga0070664_101399954
540 Ga0070664_101703423
541 Ga0068857_100117054
542 Ga0068857_100317999
543 Ga0068857_101950745
544 Ga0068854_100144464
545 Ga0068854_100510860
546 Ga0068854_100564921
547 Ga0068854_100806930
548 Ga0070702_100004986
549 Ga0068852_100386621
550 Ga0068852_100411238
551 Ga0068852_102603525
552 Ga0068859_100015753
553 Ga0068859_100190768
554 Ga0068859_100199912
555 Ga0068859_100271609
556 Ga0068859_101472485
557 Ga0068859_101492135
558 Ga0068864_100009488
559 Ga0068864_100030450
560 Ga0068864_100121520
561 Ga0068864_100469243
562 Ga0068864_101562675
563 Ga0068866_10048313
564 Ga0068866_10119356
565 Ga0068861_100060930
566 Ga0068870_10008899
567 Ga0068870_10116968
568 Ga0068863_100036934
569 Ga0068863_100414069
570 Ga0068863_100509367
571 Ga0068863_101109875
572 Ga0068858_100207502
573 Ga0068858_100856939
574 Ga0068860_100043913
575 Ga0068860_100154998
576 Ga0068860_102306096
577 Ga0068862_100043833
578 Ga0068862_100045956
579 Ga0068862_100097471
580 Ga0068862_100139769
581 Ga0068862_102493995
582 Ga0081539_10000871
583 Ga0081539_10336575
584 Ga0081539_10457007
585 Ga0070716_100000007
586 Ga0097621_100022111
587 Ga0097621_100225188
588 Ga0097621_100290393
589 Ga0068871_100003200
590 Ga0075433_10006327
591 Ga0075433_10094534
592 Ga0075433_10201672
593 Ga0075433_10514056
594 Ga0075434_100024472
595 Ga0068865_100113379
596 Ga0068865_100208818
597 Ga0068865_100772459
598 Ga0097620_100015753
599 Ga0097620_100190763
600 Ga0097620_100199894
601 Ga0097620_100271612
602 Ga0097620_101472205
603 Ga0097620_101492053
604 Ga0075435_100432723
605 Ga0105250_10193938
606 Ga0105240_11708288
607 Ga0105240_12165039
608 Ga0111539_10889551
609 Ga0111539_12526469
610 Ga0105245_10112525
611 Ga0105245_11244536
612 Ga0114129_10024551
613 Ga0114129_10034664
614 Ga0114129_10209455
615 Ga0105243_10035916
616 Ga0105243_10141529
617 Ga0105243_10488344
618 Ga0105243_10957687
619 Ga0105243_11649307
620 Ga0105243_12264036
621 Ga0105241_10036212
622 Ga0105241_10284344
623 Ga0105241_10550067
624 Ga0105241_11151131
625 Ga0105242_10406175
626 Ga0105242_10776173
627 Ga0105242_10824398
628 Ga0105242_11869215
629 Ga0105242_11899090
630 Ga0105248_10031555
631 Ga0105248_10203776
632 Ga0105248_10383867
633 Ga0105248_10810883
634 Ga0105248_11273985
635 Ga0105238_10016298
636 Ga0105249_10031295
637 Ga0105249_10721882
638 Ga0105239_10359514
639 Ga0105239_13564116
640 Ga0105246_10105903
641 Ga0105246_10171935
642 Ga0105246_10194633
643 Ga0105246_10258445
644 Ga0105246_10449546
645 Ga0157373_10001400
646 Ga0157371_10290440
647 Ga0157374_10120483
648 Ga0157374_10172494
649 Ga0157378_10001968
650 Ga0157378_10045294
651 Ga0157378_10083903
652 Ga0157378_10816499
653 Ga0157378_10923734
654 Ga0157378_10930169
655 Ga0157378_11379795
656 Ga0157378_11667821
657 Ga0163162_10004385
658 Ga0163162_10020007
659 Ga0163162_11228079
660 Ga0163162_11336307
661 Ga0163162_12461829
662 Ga0157372_10650896
663 Ga0157375_10084391
664 Ga0157375_10237982
665 Ga0157375_10425213
666 Ga0163163_10001070
667 Ga0163163_10003204
668 Ga0163163_10151138
669 Ga0163163_10156281
670 Ga0163163_10675818
671 Ga0157380_10006318
672 Ga0157380_10022022
673 Ga0157380_10231357
674 Ga0157380_10874500
675 Ga0157380_11133972
676 Ga0157380_11359218
677 Ga0157380_11569470
678 Ga0157377_10006470
679 Ga0157376_10017943
680 Ga0157376_10028104
681 Ga0163161_10129523
682 Ga0163161_10248243
683 Ga0163161_11333928
684 Ga0213876_10000022
685 Ga0213876_10000153
686 Ga0213876_10008427
687 Ga0213876_10379773
688 Ga0207642_10091717
689 Ga0207642_10144833
690 Ga0207642_10353904
691 Ga0207680_10098333
692 Ga0207680_10320003
693 Ga0207647_10143229
694 Ga0207645_10027971
695 Ga0207643_10079528
696 Ga0207643_10084026
697 Ga0207643_10643452
698 Ga0207684_10002535
699 Ga0207684_10317839
700 Ga0207654_10470458
701 Ga0207654_10914799
702 Ga0207707_10550041
703 Ga0207695_10393556
704 Ga0207695_11728842
705 Ga0207662_10027230
706 Ga0207662_10185567
707 Ga0207646_10213646
708 Ga0207646_10349565
709 Ga0207646_10639046
710 Ga0207646_11369162
711 Ga0207681_10057434
712 Ga0207681_10994859
713 Ga0207650_10567128
714 Ga0207659_10202241
715 Ga0207687_10121934
716 Ga0207687_10464876
717 Ga0207644_10255434
718 Ga0207706_10051058
719 Ga0207686_10076366
720 Ga0207686_10183298
721 Ga0207709_10119299
722 Ga0207709_10184297
723 Ga0207709_10867874
724 Ga0207709_11241702
725 Ga0207670_10438199
726 Ga0207670_10606625
727 Ga0207669_10223851
728 Ga0207669_10803770
729 Ga0207669_11673284
730 Ga0207704_10083776
731 Ga0207665_10000699
732 Ga0207711_10149425
733 Ga0207711_10839663
734 Ga0207711_10964583
735 Ga0207689_10001374
736 Ga0207689_10301140
737 Ga0207651_10128804
738 Ga0207651_10522311
739 Ga0207651_10595649
740 Ga0207651_11386129
741 Ga0207712_10095322
742 Ga0207712_10409248
743 Ga0207712_10509526
744 Ga0207712_12054753
745 Ga0207668_10434608
746 Ga0207668_11060497
747 Ga0207640_10130652
748 Ga0207640_10367491
749 Ga0207640_10466340
750 Ga0207640_10703997
751 Ga0207677_10038786
752 Ga0207677_10453302
753 Ga0207677_11328796
754 Ga0207703_10074036
755 Ga0207703_10262236
756 Ga0207708_10102168
757 Ga0207708_10126360
758 Ga0207708_10398467
759 Ga0207708_10538184
760 Ga0207708_10821482
761 Ga0207708_11018737
762 Ga0207641_10130959
763 Ga0207641_10512664
764 Ga0207641_10950653
765 Ga0207648_10029941
766 Ga0207648_10239448
767 Ga0207648_10376855
768 Ga0207676_10007416
769 Ga0207676_10123271
770 Ga0207676_10142049
771 Ga0207676_10282444
772 Ga0207676_11614105
773 Ga0207674_10367044
774 Ga0207674_10392624
775 Ga0207674_10782652
776 Ga0207674_11607342
777 Ga0207675_100013229
778 Ga0207675_100180609
779 Ga0207675_101094704
780 Ga0207683_10350467
781 Ga0207683_10437529
782 Ga0207698_10412013
783 Ga0207698_11183979
784 Ga0207698_11513601
785 Ga0268266_10048331
786 Ga0268265_10034723
787 Ga0268265_10251107
788 Ga0268265_11524705
789 Ga0268265_12040288
790 Ga0268265_12422129
791 Ga0268264_10119541
792 Ga0268264_10441631
793 Ga0268264_10944471
794 Ga0307515_10321013
795 Ga0316182_1216427
796 Ga0307513_10001943
797 Ga0307405_10194313
798 Ga0307405_10585873
799 Ga0307410_10722899
800 Ga0307406_10253303
801 Ga0307416_100366691
802 Ga0307416_102692806
803 Ga0307416_103025711
804 Ga0307414_10902884
805 Ga0307411_10987464
806 Ga0307415_100498884
807 Ga0373937_0253211
808 Ga0395900_0146563
809 Ga0395898_0817452
810 Ga0395905_0017908
811 Ga0436365_0407503
812 Ga0436365_1401097
813 Ga0436365_1438887
814 Ga0436365_1737195
815 Ga0436365_1822207
816 Ga0436362_0036936
817 Ga0436362_0666690
818 Ga0451576_0989793
819 Ga0495610_0172235
820 Ga0495632_0050354
821 Ga0495663_0004997
822 Ga0495598_0009801
823 Ga0495621_0000053
824 Ga0495668_0177469
825 Ga0495647_0421555
826 Ga0495658_0112807
827 Ga0495636_0116385
828 Ga0495672_0115822
829 Ga0496104_0435096
830 Ga0496104_0820241
831 Ga0496110_1288959
832 Ga0496111_1149480
833 Ga0496112_0795047
834 Ga0496112_1463743
835 nmdc:mga06r32_930702_c1
836 nmdc:mga08y16_2180562_c1
837 nmdc:mga0n895_136639_c1
838 nmdc:mga0rr50_418930_c1
839 nmdc:mga0a205_52021_c1
840 nmdc:mga0a205_7394_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

116

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

8

117

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.8003 4 118
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7923 4 121
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7841 4 118
6p29-assembly1.cif.gz_B n-demethylindolmycin synthase (plun2) in complex with n-demethylindolmycin 0.7834 8 118
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.7816 8 121
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.836 67 118 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8216 67 118 3.30.720.110
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7988 9 121 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7982 68 118 3.30.720.110
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7934 10 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V8RNG1-F1-model_v4 VOC domain-containing protein 0.9429 4 122
AF-A0A2V8RNG1-F1-model_v4 VOC domain-containing protein 0.9132 4 122
AF-A0A2V8LGY5-F1-model_v4 VOC domain-containing protein 0.9095 4 120 GO:0004493
GO:0046491
AF-A0A352F3F2-F1-model_v4 VOC domain-containing protein 0.8971 1 120
AF-A0A4R4IED9-F1-model_v4 VOC domain-containing protein 0.8926 8 121

Map