F439647

General Info

Members Datasets Scaffolds Average Seq Length
419 317 340 276

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606447|2809227666
Length 310
Sequence PALSAETAEGELIADRENRKSRSADERPRPKARGRVGQERVNWSTTVILILCAVTVLLPLYVTISMSLKTSAQAVDGNAFSLPAPFSFDGFVEAWTLTRFPVGAAVSLFVTAGTVILTIILAAFASYAIVRNWDRRLFRYSFFYLLAAMFIPFPVVALPQIQLTGRVGLDNPVGVILLATMFQLSFSVLLFTAFLRSIPYELEESARIDGASTWQTFWKLIFPLLAPMSATVGIFAFLYAWNDFMMPSLIISDPNLQTLPVRQNLFQSQFSNNYNVAFASYLMAMAPAIIAYLFTQRWVMAGVTQGAVKG

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221553 Microbacterium sp. Root553 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221630 Microbacterium sp. Root322 Isolate Unclassified
5 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
6 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
7 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
8 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
9 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
10 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
11 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
12 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
13 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
14 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
15 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
16 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
17 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
18 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
19 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
20 2808606394 Promicromonospora sp. C35 Isolate Unclassified
21 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
22 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
23 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
24 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
25 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
26 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
27 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
28 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
29 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
30 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
31 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
32 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
33 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
34 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
35 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
36 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
37 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
38 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
39 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
40 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
41 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
42 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
43 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
44 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
45 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
46 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
47 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
48 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
49 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
50 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
51 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
52 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
53 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
54 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
55 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
56 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
57 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
58 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
59 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
60 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
61 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
62 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
63 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
64 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
65 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
66 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
67 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
68 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
69 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
70 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
71 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
72 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
73 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
74 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
75 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
76 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
86 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
93 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
94 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
98 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
99 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
190 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
191 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
312 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
313 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
314 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
315 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
316 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
317 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.67
Metatranscriptomes 0.48
Isolates 18.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 6.44
Nodule 0
Rhizoplane 5.49
Rhizosphere 70.41
Stem 0
Stem Tuber 0
Unclassified 17.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011305 3300001979 Bacteria 3402
2 JGI25154J39366_1000585 3300002738 Bacteria 17667
3 JGI25152J39213_1000290 3300002773 Bacteria 33080
4 rootH2_10096985 3300003320 Bacteria 1816
5 rootL2_10129165 3300003322 Bacteria 5968
6 Ga0058860_11899493 3300004801 Bacteria 1162
7 Ga0065714_10008014 3300005288 Bacteria 5187
8 Ga0070683_100227472 3300005329 Bacteria 1773
9 Ga0070683_100636664 3300005329 Bacteria 1021
10 Ga0068869_100018038 3300005334 Bacteria 4798
11 Ga0068868_100016954 3300005338 Bacteria 5420
12 Ga0070660_100026308 3300005339 Bacteria 4330
13 Ga0070691_10018705 3300005341 Bacteria 3194
14 Ga0070687_100199770 3300005343 Bacteria 1210
15 Ga0070668_100210347 3300005347 Bacteria 1600
16 Ga0070671_100050832 3300005355 Bacteria 3448
17 Ga0070703_10004608 3300005406 Bacteria 3866
18 Ga0070714_100019397 3300005435 Bacteria 5539
19 Ga0070714_100025612 3300005435 Bacteria 4869
20 Ga0070713_100433834 3300005436 Bacteria 1231
21 Ga0070710_10033765 3300005437 Bacteria 2780
22 Ga0070711_100039418 3300005439 Bacteria 3182
23 Ga0070705_100024363 3300005440 Bacteria 3265
24 Ga0070708_100000826 3300005445 Bacteria 23328
25 Ga0070681_10350054 3300005458 Bacteria 1387
26 Ga0070706_100053840 3300005467 Bacteria 3714
27 Ga0070706_100158432 3300005467 Bacteria 2113
28 Ga0070707_100003487 3300005468 Bacteria 14845
29 Ga0070698_100013631 3300005471 Bacteria 8605
30 Ga0070698_100081396 3300005471 Bacteria 3232
31 Ga0068853_100028198 3300005539 Bacteria 4721
32 Ga0070672_100343771 3300005543 Bacteria 1271
33 Ga0070696_100061230 3300005546 Bacteria 2633
34 Ga0068855_100108363 3300005563 Bacteria 3190
35 Ga0068854_100029367 3300005578 Bacteria 3806
36 Ga0068856_100025187 3300005614 Bacteria 5797
37 Ga0070702_100004903 3300005615 Bacteria 6166
38 Ga0068852_100041728 3300005616 Bacteria 3879
39 Ga0068864_100054138 3300005618 Bacteria 3463
40 Ga0068863_100090556 3300005841 Bacteria 2900
41 Ga0081540_1023476 3300005983 Bacteria 3605
42 Ga0070717_10058823 3300006028 Bacteria 3178
43 Ga0070717_10113132 3300006028 Bacteria 2317
44 Ga0075364_10018547 3300006051 Bacteria 4357
45 Ga0075364_10025773 3300006051 Bacteria 3745
46 Ga0075364_10201857 3300006051 Bacteria 1348
47 Ga0070716_100038090 3300006173 Bacteria 2660
48 Ga0075367_10003011 3300006178 Bacteria 7889
49 Ga0075369_10004790 3300006186 Bacteria 5032
50 Ga0075370_10016015 3300006353 Bacteria 4027
51 Ga0068871_100031243 3300006358 Bacteria 4198
52 Ga0105250_10047604 3300009092 Bacteria 1719
53 Ga0105240_10104956 3300009093 Bacteria 3431
54 Ga0105245_10126610 3300009098 Bacteria 2392
55 Ga0105247_10035117 3300009101 Bacteria 3055
56 Ga0105243_10014554 3300009148 Bacteria 5951
57 Ga0105243_10043356 3300009148 Bacteria 3526
58 Ga0105243_10156667 3300009148 Bacteria 1959
59 Ga0105241_10052026 3300009174 Bacteria 3126
60 Ga0105242_10044326 3300009176 Bacteria 3602
61 Ga0105248_10025567 3300009177 Bacteria 6565
62 Ga0105238_10049521 3300009551 Bacteria 4230
63 Ga0105249_10758576 3300009553 Bacteria 1033
64 Ga0105239_10187744 3300010375 Bacteria 2313
65 Ga0105246_10016734 3300011119 Bacteria 4649
66 Ga0105246_10021873 3300011119 Bacteria 4122
67 Ga0105246_10157300 3300011119 Bacteria 1727
68 Ga0105246_10489892 3300011119 Bacteria 1042
69 Ga0157373_10062789 3300013100 Bacteria 2631
70 Ga0157370_10059433 3300013104 Bacteria 3633
71 Ga0157370_10151243 3300013104 Bacteria 2160
72 Ga0157369_10126234 3300013105 Bacteria 2712
73 Ga0157369_10197637 3300013105 Bacteria 2111
74 Ga0157378_10044928 3300013297 Bacteria 3924
75 Ga0157372_10082729 3300013307 Bacteria 3635
76 Ga0157372_10178104 3300013307 Bacteria 2461
77 Ga0157375_10049330 3300013308 Bacteria 4124
78 Ga0157377_10029118 3300014745 Bacteria 2978
79 Ga0157379_10015298 3300014968 Bacteria 6729
80 Ga0157376_10070317 3300014969 Bacteria 2970
81 Ga0163161_10103912 3300017792 Bacteria 2117
82 Ga0163161_10146868 3300017792 Bacteria 1789
83 Ga0207425_1026380 3300025245 Bacteria 1192
84 Ga0209646_1000030 3300025246 Bacteria 384216
85 Ga0209129_1000047 3300025258 Bacteria 270566
86 Ga0209129_1017977 3300025258 Bacteria 1371
87 Ga0209025_1000691 3300025294 Bacteria 57670
88 Ga0209051_1006033 3300025303 Bacteria 6916
89 Ga0207697_10009497 3300025315 Bacteria 4200
90 Ga0207655_1001384 3300025728 Bacteria 22650
91 Ga0207655_1003194 3300025728 Bacteria 12337
92 Ga0207655_1062547 3300025728 Bacteria 1431
93 Ga0207692_10067638 3300025898 Bacteria 1871
94 Ga0207688_10039972 3300025901 Bacteria 2606
95 Ga0207688_10089050 3300025901 Bacteria 1770
96 Ga0207699_10006626 3300025906 Bacteria 5620
97 Ga0207684_10036848 3300025910 Bacteria 4151
98 Ga0207684_10310074 3300025910 Bacteria 1360
99 Ga0207693_10212308 3300025915 Bacteria 1521
100 Ga0207662_10153149 3300025918 Bacteria 1468
101 Ga0207657_10255662 3300025919 Bacteria 1395
102 Ga0207649_10077357 3300025920 Bacteria 2144
103 Ga0207646_10032849 3300025922 Bacteria 4694
104 Ga0207659_10047443 3300025926 Bacteria 3038
105 Ga0207687_10398409 3300025927 Bacteria 1132
106 Ga0207700_10000849 3300025928 Bacteria 17621
107 Ga0207664_10006661 3300025929 Bacteria 7963
108 Ga0207664_10006798 3300025929 Bacteria 7903
109 Ga0207664_10226590 3300025929 Bacteria 1623
110 Ga0207644_10045894 3300025931 Bacteria 3110
111 Ga0207706_10358726 3300025933 Bacteria 1266
112 Ga0207686_10052553 3300025934 Bacteria 2543
113 Ga0207709_10000796 3300025935 Bacteria 24560
114 Ga0207709_10004329 3300025935 Bacteria 8217
115 Ga0207704_10217602 3300025938 Bacteria 1411
116 Ga0207665_10016982 3300025939 Bacteria 4779
117 Ga0207691_10119480 3300025940 Bacteria 2337
118 Ga0207689_10007848 3300025942 Bacteria 9327
119 Ga0207661_10082253 3300025944 Bacteria 2662
120 Ga0207712_10101499 3300025961 Bacteria 2140
121 Ga0207639_10115084 3300026041 Bacteria 2199
122 Ga0207678_10009833 3300026067 Bacteria 8405
123 Ga0207708_10154653 3300026075 Bacteria 1808
124 Ga0207702_10012491 3300026078 Bacteria 7065
125 Ga0207641_10006965 3300026088 Bacteria 9461
126 Ga0207676_10039986 3300026095 Bacteria 3591
127 Ga0207675_100036640 3300026118 Bacteria 4575
128 Ga0207683_10011067 3300026121 Bacteria 7687
129 Ga0207698_10238875 3300026142 Bacteria 1654
130 Ga0209813_10003222 3300027866 Bacteria 3811
131 Ga0268265_10657867 3300028380 Bacteria 1008
132 Ga0268264_10013634 3300028381 Bacteria 6689
133 Ga0265337_1000047 3300028556 Bacteria 53962
134 Ga0265326_10002773 3300028558 Bacteria 5872
135 Ga0265319_1004312 3300028563 Bacteria 7073
136 Ga0265334_10009786 3300028573 Bacteria 4053
137 Ga0265322_10013045 3300028654 Bacteria 2405
138 Ga0265336_10081010 3300028666 Bacteria 968
139 Ga0265338_10000315 3300028800 Bacteria 87685
140 Ga0316177_1122875 3300030731 Bacteria 2239
141 Ga0316176_1043689 3300030732 Bacteria 2870
142 Ga0247549_100050 3300030942 Bacteria 2485
143 Ga0265320_10001951 3300031240 Bacteria 14562
144 Ga0265340_10010637 3300031247 Bacteria 4918
145 Ga0307408_100012126 3300031548 Bacteria 5705
146 Ga0307408_100024514 3300031548 Bacteria 4120
147 Ga0307408_100033557 3300031548 Bacteria 3587
148 Ga0307408_100039826 3300031548 Bacteria 3324
149 Ga0307408_100218039 3300031548 Bacteria 1555
150 Ga0307405_10116013 3300031731 Bacteria 1823
151 Ga0307413_10003876 3300031824 Bacteria 6392
152 Ga0307413_10445235 3300031824 Bacteria 1027
153 Ga0307410_10005677 3300031852 Bacteria 6639
154 Ga0307406_10002007 3300031901 Bacteria 11103
155 Ga0307406_10003732 3300031901 Bacteria 8282
156 Ga0307406_10028615 3300031901 Bacteria 3369
157 Ga0307406_10117565 3300031901 Bacteria 1842
158 Ga0307407_10003311 3300031903 Bacteria 6578
159 Ga0307407_10007112 3300031903 Bacteria 5044
160 Ga0307412_10001043 3300031911 Bacteria 15825
161 Ga0307412_10004892 3300031911 Bacteria 7486
162 Ga0307412_10011390 3300031911 Bacteria 5150
163 Ga0307412_10018634 3300031911 Bacteria 4182
164 Ga0307412_10063506 3300031911 Bacteria 2491
165 Ga0307412_10209824 3300031911 Bacteria 1485
166 Ga0307412_10266640 3300031911 Bacteria 1338
167 Ga0307409_100050713 3300031995 Bacteria 3171
168 Ga0307409_100326617 3300031995 Bacteria 1438
169 Ga0307416_100006627 3300032002 Bacteria 7269
170 Ga0307416_100123929 3300032002 Bacteria 2310
171 Ga0307416_100359906 3300032002 Bacteria 1477
172 Ga0307416_100540968 3300032002 Bacteria 1236
173 Ga0307414_10002785 3300032004 Bacteria 9214
174 Ga0307414_10019759 3300032004 Bacteria 4183
175 Ga0307411_10035966 3300032005 Bacteria 3098
176 Ga0373929_0031834 3300035085 Bacteria 1132
177 Ga0373944_0005022 3300035089 Bacteria 3471
178 Ga0373951_0016844 3300035091 Bacteria 1651
179 Ga0373923_0009078 3300035111 Bacteria 3575
180 Ga0373945_0012939 3300035116 Bacteria 2779
181 Ga0373953_0055844 3300035117 Bacteria 1604
182 Ga0373960_0027672 3300035121 Bacteria 1559
183 Ga0373946_0000964 3300035171 Bacteria 9865
184 Ga0373955_0059158 3300035172 Bacteria 2110
185 Ga0316574_0087846 3300035398 Bacteria 1980
186 Ga0373931_0183871 3300035691 Bacteria 1239
187 Ga0373935_0012818 3300035692 Bacteria 5049
188 Ga0373935_0203845 3300035692 Bacteria 1368
189 Ga0373927_0008567 3300035695 Bacteria 6872
190 Ga0373933_0003385 3300035724 Bacteria 8890
191 Ga0373933_0022351 3300035724 Bacteria 3601
192 Ga0373937_0046773 3300036401 Bacteria 3957
193 Ga0373937_0114420 3300036401 Bacteria 2511
194 Ga0373925_0351729 3300037068 Bacteria 1196
195 Ga0395900_0115078 3300037418 Bacteria 2760
196 Ga0395900_0309471 3300037418 Bacteria 1563
197 Ga0395898_0060258 3300037466 Bacteria 3689
198 Ga0395898_0104846 3300037466 Bacteria 2711
199 Ga0395901_0063784 3300038443 Bacteria 3835
200 Ga0436363_1100641 3300039450 Bacteria 1602
201 Ga0466972_0016811 3300044658 Bacteria 3659
202 Ga0466963_0086543 3300044694 Bacteria 2130
203 Ga0466964_0088112 3300044706 Bacteria 1346
204 Ga0466968_0076511 3300044735 Bacteria 1465
205 Ga0466970_0000082 3300044765 Bacteria 38992
206 Ga0466970_0025599 3300044765 Bacteria 3090
207 Ga0466957_0009989 3300044842 Bacteria 5432
208 Ga0495592_0336596 3300046454 Bacteria 971
209 Ga0495603_0272521 3300046455 Bacteria 973
210 Ga0495629_0053737 3300046459 Bacteria 2817
211 Ga0495638_0015359 3300046460 Bacteria 5145
212 Ga0495641_0009590 3300046461 Bacteria 5735
213 Ga0495651_0007677 3300046462 Bacteria 8246
214 Ga0495651_0075888 3300046462 Bacteria 2547
215 Ga0495653_0225732 3300046463 Bacteria 1256
216 Ga0495582_0002980 3300046473 Bacteria 9486
217 Ga0495639_0002976 3300046475 Bacteria 7374
218 Ga0495664_0020217 3300046477 Bacteria 3837
219 Ga0495608_0068480 3300046511 Bacteria 2320
220 Ga0495608_0130931 3300046511 Bacteria 1605
221 Ga0495608_0172243 3300046511 Bacteria 1372
222 Ga0495618_0115627 3300046514 Bacteria 1717
223 Ga0495618_0186087 3300046514 Bacteria 1318
224 Ga0495628_0123845 3300046516 Bacteria 1981
225 Ga0495630_0014266 3300046517 Bacteria 5785
226 Ga0495666_0003801 3300046526 Bacteria 7636
227 Ga0495652_0201355 3300046529 Bacteria 1510
228 Ga0495665_0009000 3300046531 Bacteria 5418
229 Ga0495587_0002315 3300046536 Bacteria 12736
230 Ga0495609_0034414 3300046538 Bacteria 2297
231 Ga0495645_0008559 3300046543 Bacteria 7146
232 Ga0495667_0013533 3300046559 Bacteria 5518
233 Ga0495667_0036427 3300046559 Bacteria 3284
234 Ga0495667_0185124 3300046559 Bacteria 1335
235 Ga0495634_0028524 3300046642 Bacteria 3873
236 Ga0495657_0043050 3300046675 Bacteria 3080
237 Ga0495657_0085184 3300046675 Bacteria 2037
238 Ga0495657_0251642 3300046675 Bacteria 1063
239 Ga0495599_0025687 3300046678 Bacteria 3688
240 Ga0495599_0169108 3300046678 Bacteria 1349
241 Ga0495647_0034118 3300046681 Bacteria 1905
242 Ga0495658_0005436 3300046683 Bacteria 6262
243 Ga0495613_0012625 3300046689 Bacteria 6280
244 Ga0495624_0015375 3300046690 Bacteria 5168
245 Ga0495581_0003416 3300047315 Bacteria 9116
246 Ga0495604_0030441 3300047317 Bacteria 4286
247 Ga0495604_0226911 3300047317 Bacteria 1283
248 Ga0495680_0024277 3300047322 Bacteria 5030
249 Ga0495680_0029673 3300047322 Bacteria 4476
250 Ga0495684_0106028 3300047471 Bacteria 2123
251 Ga0495686_0211738 3300047472 Bacteria 1107
252 Ga0495593_0002789 3300047673 Bacteria 10525
253 Ga0495602_0105034 3300048088 Bacteria 2309
254 Ga0495602_0220466 3300048088 Bacteria 1432
255 Ga0495614_0008662 3300048089 Bacteria 4524
256 Ga0496100_0076927 3300048903 Bacteria 2242
257 Ga0496100_0197224 3300048903 Bacteria 1465
258 Ga0496101_0038672 3300048904 Bacteria 3389
259 Ga0496102_0008516 3300048905 Bacteria 8793
260 Ga0496102_0325419 3300048905 Bacteria 1448
261 Ga0496103_0011345 3300048906 Bacteria 5278
262 Ga0496104_0028590 3300048907 Bacteria 5167
263 Ga0496105_0028632 3300048908 Bacteria 4556
264 Ga0496105_0228503 3300048908 Bacteria 1513
265 Ga0496106_0009706 3300048909 Bacteria 7107
266 Ga0496108_0011783 3300048911 Bacteria 7111
267 Ga0496108_0519021 3300048911 Bacteria 1040
268 Ga0496109_0008239 3300048912 Bacteria 8848
269 Ga0496110_0018997 3300048913 Bacteria 5776
270 Ga0496111_0005291 3300048914 Bacteria 8242
271 Ga0496112_0017653 3300048915 Bacteria 6711
272 Ga0496113_0006593 3300048916 Bacteria 7380
273 Ga0496114_0019251 3300048917 Bacteria 5530
274 Ga0496114_0020663 3300048917 Bacteria 5345
275 Ga0496114_0149412 3300048917 Bacteria 2026
276 Ga0496114_0206159 3300048917 Bacteria 1723
277 Ga0496114_0297571 3300048917 Bacteria 1424
278 Ga0496115_0174706 3300048918 Bacteria 1776
279 Ga0496117_0000223 3300048920 Bacteria 107483
280 Ga0496117_0001084 3300048920 Bacteria 41243
281 Ga0496117_0001996 3300048920 Bacteria 27057
282 Ga0496117_0187819 3300048920 Bacteria 1181
283 Ga0496118_0000290 3300048921 Bacteria 87438
284 Ga0496118_0000296 3300048921 Bacteria 86577
285 Ga0496119_0001226 3300048922 Bacteria 31944
286 Ga0496119_0007224 3300048922 Bacteria 10056
287 Ga0496119_0035978 3300048922 Bacteria 3237
288 Ga0496119_0157110 3300048922 Bacteria 1213
289 Ga0496120_0002245 3300048923 Bacteria 20186
290 Ga0496120_0044408 3300048923 Bacteria 2582
291 Ga0496120_0085388 3300048923 Bacteria 1699
292 Ga0496121_0201352 3300048924 Bacteria 1419
293 Ga0496122_0004826 3300048925 Bacteria 16440
294 Ga0496122_0008173 3300048925 Bacteria 11377
295 Ga0496122_0039097 3300048925 Bacteria 3788
296 Ga0496122_0175497 3300048925 Bacteria 1285
297 Ga0496123_0120696 3300048926 Bacteria 1475
298 Ga0496123_0153213 3300048926 Bacteria 1240
299 Ga0496124_0000040 3300048927 Bacteria 307061
300 Ga0496124_0000075 3300048927 Bacteria 218086
301 Ga0496124_0047470 3300048927 Bacteria 3673
302 Ga0496124_0077914 3300048927 Bacteria 2733
303 Ga0496125_0034174 3300048928 Bacteria 4485
304 Ga0496125_0114364 3300048928 Bacteria 1944
305 Ga0496126_0004538 3300048929 Bacteria 16506
306 Ga0496126_0057045 3300048929 Bacteria 3528
307 Ga0501032_0001651 3300049569 Bacteria 17701
308 Ga0501032_0130881 3300049569 Bacteria 1655
309 Ga0501033_0051217 3300049570 Bacteria 3060
310 Ga0501034_0000328 3300049571 Bacteria 83532
311 Ga0501034_0022915 3300049571 Bacteria 6362
312 Ga0501034_0048405 3300049571 Bacteria 4290
313 Ga0501036_0067265 3300049572 Bacteria 3031
314 Ga0501037_0005756 3300049573 Bacteria 9050
315 Ga0501038_0071677 3300049574 Bacteria 2938
316 Ga0501038_0270571 3300049574 Bacteria 1340
317 Ga0501038_0333370 3300049574 Bacteria 1184
318 Ga0501039_0111899 3300049575 Bacteria 2134
319 Ga0501039_0251522 3300049575 Bacteria 1389
320 Ga0501043_0051190 3300049579 Bacteria 3245
321 Ga0501070_0001347 3300049586 Bacteria 21982
322 Ga0501070_0364881 3300049586 Bacteria 1171
323 Ga0501044_0090451 3300049823 Bacteria 3088
324 Ga0501044_0246229 3300049823 Bacteria 1730
325 nmdc:mga03n38_971_c1 3300050490 Bacteria 7794
326 nmdc:mga00v17_135924_c1 3300050491 Bacteria 1574
327 nmdc:mga00v17_71905_c1 3300050491 Bacteria 2145
328 nmdc:mga00v17_74152_c1 3300050491 Bacteria 2114
329 nmdc:mga0yw44_5115_c1 3300050492 Bacteria 6136
330 nmdc:mga04h51_4197_c1 3300050495 Bacteria 3564
331 nmdc:mga07m45_32118_c1 3300050496 Bacteria 1614
332 Ga0495601_0012594 3300053077 Bacteria 5071
333 Ga0495612_0002739 3300053078 Bacteria 7295
334 Ga0500650_0008669 3300053098 Bacteria 4040
335 Ga0500568_0051742 3300053139 Bacteria 1615
336 Ga0500573_0001009 3300053140 Bacteria 12945
337 Ga0500573_0024834 3300053140 Bacteria 3446
338 Ga0500573_0112852 3300053140 Bacteria 1519
339 Ga0500577_0005166 3300053142 Bacteria 3498
340 Ga0500577_0038999 3300053142 Bacteria 1719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0172243 Ga0495608_0172243_355_1251 218
2 3300046454 Ga0495592_0336596 Ga0495592_0336596_11_685 224
3 3300037068 Ga0373925_0351729 Ga0373925_0351729_157_1053 228
4 3300005435 Ga0070714_100025612 Ga0070714_1000256123 229
5 3300025929 Ga0207664_10006798 Ga0207664_100067984 229
6 3300005329 Ga0070683_100636664 Ga0070683_1006366641 231
7 3300005437 Ga0070710_10033765 Ga0070710_100337652 231
8 3300005439 Ga0070711_100039418 Ga0070711_1000394182 231
9 3300005458 Ga0070681_10350054 Ga0070681_103500542 231
10 3300006173 Ga0070716_100038090 Ga0070716_1000380902 231
11 3300025915 Ga0207693_10212308 Ga0207693_102123082 231
12 3300025929 Ga0207664_10226590 Ga0207664_102265901 231
13 3300025939 Ga0207665_10016982 Ga0207665_100169823 231
14 3300005983 Ga0081540_1023476 Ga0081540_10234762 232
15 3300046529 Ga0495652_0201355 Ga0495652_0201355_749_1483 232
16 3300030942 Ga0247549_100050 Ga0247549_1000502 237
17 3300005471 Ga0070698_100081396 Ga0070698_1000813963 238
18 3300025315 Ga0207697_10009497 Ga0207697_100094974 243
19 3300025728 Ga0207655_1062547 Ga0207655_10625472 243
20 3300035692 Ga0373935_0203845 Ga0373935_0203845_97_993 243
21 3300035724 Ga0373933_0022351 Ga0373933_0022351_2300_3196 243
22 3300036401 Ga0373937_0114420 Ga0373937_0114420_821_1717 243
23 3300046559 Ga0495667_0013533 Ga0495667_0013533_263_1159 243
24 3300035121 Ga0373960_0027672 Ga0373960_0027672_378_1274 245
25 3300031824 Ga0307413_10445235 Ga0307413_104452351 246
26 3300035172 Ga0373955_0059158 Ga0373955_0059158_322_1218 246
27 3300046675 Ga0495657_0251642 Ga0495657_0251642_90_995 246
28 3300046516 Ga0495628_0123845 Ga0495628_0123845_35_931 247
29 3300005445 Ga0070708_100000826 Ga0070708_1000008267 248
30 3300005467 Ga0070706_100053840 Ga0070706_1000538402 248
31 3300005468 Ga0070707_100003487 Ga0070707_1000034879 248
32 3300005471 Ga0070698_100013631 Ga0070698_1000136312 248
33 3300025910 Ga0207684_10036848 Ga0207684_100368481 248
34 3300025922 Ga0207646_10032849 Ga0207646_100328492 248
35 3300039450 Ga0436363_1100641 Ga0436363_1100641_569_1462 248
36 3300005435 Ga0070714_100019397 Ga0070714_1000193974 249
37 3300006028 Ga0070717_10058823 Ga0070717_100588233 249
38 3300026075 Ga0207708_10154653 Ga0207708_101546533 249
39 3300044706 Ga0466964_0088112 Ga0466964_0088112_44_862 249
40 3300048914 Ga0496111_0005291 Ga0496111_0005291_4454_5347 249
41 3300048929 Ga0496126_0057045 Ga0496126_0057045_1883_2761 249
42 3300004801 Ga0058860_11899493 Ga0058860_118994931 250
43 3300005329 Ga0070683_100227472 Ga0070683_1002274722 250
44 3300005334 Ga0068869_100018038 Ga0068869_1000180382 250
45 3300005338 Ga0068868_100016954 Ga0068868_1000169544 250
46 3300005339 Ga0070660_100026308 Ga0070660_1000263082 250
47 3300005341 Ga0070691_10018705 Ga0070691_100187053 250
48 3300005343 Ga0070687_100199770 Ga0070687_1001997702 250
49 3300005347 Ga0070668_100210347 Ga0070668_1002103472 250
50 3300005355 Ga0070671_100050832 Ga0070671_1000508323 250
51 3300005406 Ga0070703_10004608 Ga0070703_100046082 250
52 3300005440 Ga0070705_100024363 Ga0070705_1000243632 250
53 3300005467 Ga0070706_100158432 Ga0070706_1001584323 250
54 3300005539 Ga0068853_100028198 Ga0068853_1000281982 250
55 3300005543 Ga0070672_100343771 Ga0070672_1003437712 250
56 3300005546 Ga0070696_100061230 Ga0070696_1000612302 250
57 3300005563 Ga0068855_100108363 Ga0068855_1001083633 250
58 3300005578 Ga0068854_100029367 Ga0068854_1000293672 250
59 3300005614 Ga0068856_100025187 Ga0068856_1000251874 250
60 3300005615 Ga0070702_100004903 Ga0070702_1000049033 250
61 3300005616 Ga0068852_100041728 Ga0068852_1000417283 250
62 3300005618 Ga0068864_100054138 Ga0068864_1000541383 250
63 3300005841 Ga0068863_100090556 Ga0068863_1000905562 250
64 3300006028 Ga0070717_10113132 Ga0070717_101131322 250
65 3300006358 Ga0068871_100031243 Ga0068871_1000312433 250
66 3300009092 Ga0105250_10047604 Ga0105250_100476042 250
67 3300009093 Ga0105240_10104956 Ga0105240_101049563 250
68 3300009098 Ga0105245_10126610 Ga0105245_101266102 250
69 3300009101 Ga0105247_10035117 Ga0105247_100351173 250
70 3300009148 Ga0105243_10014554 Ga0105243_100145543 250
71 3300009174 Ga0105241_10052026 Ga0105241_100520262 250
72 3300009176 Ga0105242_10044326 Ga0105242_100443263 250
73 3300009177 Ga0105248_10025567 Ga0105248_100255672 250
74 3300009551 Ga0105238_10049521 Ga0105238_100495212 250
75 3300009553 Ga0105249_10758576 Ga0105249_107585761 250
76 3300010375 Ga0105239_10187744 Ga0105239_101877442 250
77 3300011119 Ga0105246_10016734 Ga0105246_100167342 250
78 3300013100 Ga0157373_10062789 Ga0157373_100627892 250
79 3300013105 Ga0157369_10126234 Ga0157369_101262342 250
80 3300013297 Ga0157378_10044928 Ga0157378_100449283 250
81 3300013307 Ga0157372_10178104 Ga0157372_101781042 250
82 3300013308 Ga0157375_10049330 Ga0157375_100493302 250
83 3300014745 Ga0157377_10029118 Ga0157377_100291182 250
84 3300014968 Ga0157379_10015298 Ga0157379_100152983 250
85 3300014969 Ga0157376_10070317 Ga0157376_100703172 250
86 3300017792 Ga0163161_10146868 Ga0163161_101468682 250
87 3300025898 Ga0207692_10067638 Ga0207692_100676382 250
88 3300025901 Ga0207688_10089050 Ga0207688_100890502 250
89 3300025906 Ga0207699_10006626 Ga0207699_100066262 250
90 3300025910 Ga0207684_10310074 Ga0207684_103100742 250
91 3300025918 Ga0207662_10153149 Ga0207662_101531492 250
92 3300025919 Ga0207657_10255662 Ga0207657_102556622 250
93 3300025926 Ga0207659_10047443 Ga0207659_100474432 250
94 3300025927 Ga0207687_10398409 Ga0207687_103984091 250
95 3300025928 Ga0207700_10000849 Ga0207700_100008496 250
96 3300025929 Ga0207664_10006661 Ga0207664_100066614 250
97 3300025931 Ga0207644_10045894 Ga0207644_100458942 250
98 3300025934 Ga0207686_10052553 Ga0207686_100525532 250
99 3300025938 Ga0207704_10217602 Ga0207704_102176022 250
100 3300025940 Ga0207691_10119480 Ga0207691_101194802 250
101 3300025942 Ga0207689_10007848 Ga0207689_100078485 250
102 3300025944 Ga0207661_10082253 Ga0207661_100822532 250
103 3300025961 Ga0207712_10101499 Ga0207712_101014993 250
104 3300026041 Ga0207639_10115084 Ga0207639_101150842 250
105 3300026067 Ga0207678_10009833 Ga0207678_100098336 250
106 3300026078 Ga0207702_10012491 Ga0207702_100124915 250
107 3300026088 Ga0207641_10006965 Ga0207641_100069655 250
108 3300026095 Ga0207676_10039986 Ga0207676_100399862 250
109 3300026118 Ga0207675_100036640 Ga0207675_1000366403 250
110 3300026121 Ga0207683_10011067 Ga0207683_100110674 250
111 3300026142 Ga0207698_10238875 Ga0207698_102388752 250
112 3300028380 Ga0268265_10657867 Ga0268265_106578671 250
113 3300028381 Ga0268264_10013634 Ga0268264_100136345 250
114 3300035085 Ga0373929_0031834 Ga0373929_0031834_183_1079 250
115 3300035091 Ga0373951_0016844 Ga0373951_0016844_35_931 250
116 3300035691 Ga0373931_0183871 Ga0373931_0183871_183_1079 250
117 3300046463 Ga0495653_0225732 Ga0495653_0225732_175_1071 250
118 3300046514 Ga0495618_0186087 Ga0495618_0186087_208_1104 250
119 3300046559 Ga0495667_0185124 Ga0495667_0185124_272_1168 250
120 3300047471 Ga0495684_0106028 Ga0495684_0106028_914_1810 250
121 3300048903 Ga0496100_0076927 Ga0496100_0076927_1260_2156 250
122 3300048904 Ga0496101_0038672 Ga0496101_0038672_1219_2115 250
123 3300048905 Ga0496102_0008516 Ga0496102_0008516_6723_7619 250
124 3300048906 Ga0496103_0011345 Ga0496103_0011345_3855_4751 250
125 3300048907 Ga0496104_0028590 Ga0496104_0028590_3144_4040 250
126 3300048908 Ga0496105_0028632 Ga0496105_0028632_3074_3970 250
127 3300048909 Ga0496106_0009706 Ga0496106_0009706_4276_5172 250
128 3300048911 Ga0496108_0011783 Ga0496108_0011783_4625_5521 250
129 3300048912 Ga0496109_0008239 Ga0496109_0008239_5591_6487 250
130 3300048913 Ga0496110_0018997 Ga0496110_0018997_1105_2001 250
131 3300048915 Ga0496112_0017653 Ga0496112_0017653_2529_3425 250
132 3300048916 Ga0496113_0006593 Ga0496113_0006593_2145_3041 250
133 3300048918 Ga0496115_0174706 Ga0496115_0174706_377_1273 250
134 3300025920 Ga0207649_10077357 Ga0207649_100773572 252
135 3300048925 Ga0496122_0004826 Ga0496122_0004826_9592_10503 253
136 3300044658 Ga0466972_0016811 Ga0466972_0016811_176_997 254
137 3300044694 Ga0466963_0086543 Ga0466963_0086543_557_1459 255
138 3300046455 Ga0495603_0272521 Ga0495603_0272521_36_929 255
139 3300046462 Ga0495651_0075888 Ga0495651_0075888_840_1736 255
140 3300046675 Ga0495657_0085184 Ga0495657_0085184_108_1004 255
141 3300046678 Ga0495599_0169108 Ga0495599_0169108_206_1102 255
142 3300047317 Ga0495604_0226911 Ga0495604_0226911_373_1269 255
143 3300047322 Ga0495680_0029673 Ga0495680_0029673_2045_2941 255
144 3300048088 Ga0495602_0220466 Ga0495602_0220466_349_1245 255
145 3300035089 Ga0373944_0005022 Ga0373944_0005022_2479_3375 256
146 3300035111 Ga0373923_0009078 Ga0373923_0009078_1013_1909 256
147 3300035116 Ga0373945_0012939 Ga0373945_0012939_910_1806 256
148 3300035117 Ga0373953_0055844 Ga0373953_0055844_664_1560 256
149 3300035171 Ga0373946_0000964 Ga0373946_0000964_266_1162 256
150 3300035692 Ga0373935_0012818 Ga0373935_0012818_3822_4718 256
151 3300035695 Ga0373927_0008567 Ga0373927_0008567_970_1866 256
152 3300035724 Ga0373933_0003385 Ga0373933_0003385_4337_5233 256
153 3300036401 Ga0373937_0046773 Ga0373937_0046773_2466_3362 256
154 3300046459 Ga0495629_0053737 Ga0495629_0053737_178_1074 256
155 3300046461 Ga0495641_0009590 Ga0495641_0009590_4339_5235 256
156 3300046462 Ga0495651_0007677 Ga0495651_0007677_7064_7960 256
157 3300046473 Ga0495582_0002980 Ga0495582_0002980_2585_3481 256
158 3300046475 Ga0495639_0002976 Ga0495639_0002976_5633_6529 256
159 3300046477 Ga0495664_0020217 Ga0495664_0020217_2419_3315 256
160 3300046511 Ga0495608_0068480 Ga0495608_0068480_287_1183 256
161 3300046514 Ga0495618_0115627 Ga0495618_0115627_401_1297 256
162 3300046517 Ga0495630_0014266 Ga0495630_0014266_1433_2329 256
163 3300046526 Ga0495666_0003801 Ga0495666_0003801_3698_4594 256
164 3300046531 Ga0495665_0009000 Ga0495665_0009000_3330_4226 256
165 3300046536 Ga0495587_0002315 Ga0495587_0002315_288_1184 256
166 3300046543 Ga0495645_0008559 Ga0495645_0008559_179_1075 256
167 3300046559 Ga0495667_0036427 Ga0495667_0036427_1196_2092 256
168 3300046642 Ga0495634_0028524 Ga0495634_0028524_2135_3031 256
169 3300046675 Ga0495657_0043050 Ga0495657_0043050_179_1075 256
170 3300046678 Ga0495599_0025687 Ga0495599_0025687_676_1572 256
171 3300046681 Ga0495647_0034118 Ga0495647_0034118_594_1490 256
172 3300046683 Ga0495658_0005436 Ga0495658_0005436_529_1425 256
173 3300046689 Ga0495613_0012625 Ga0495613_0012625_2406_3302 256
174 3300046690 Ga0495624_0015375 Ga0495624_0015375_2267_3163 256
175 3300047315 Ga0495581_0003416 Ga0495581_0003416_6505_7401 256
176 3300047317 Ga0495604_0030441 Ga0495604_0030441_1068_1964 256
177 3300047322 Ga0495680_0024277 Ga0495680_0024277_2519_3415 256
178 3300047673 Ga0495593_0002789 Ga0495593_0002789_2853_3749 256
179 3300048088 Ga0495602_0105034 Ga0495602_0105034_287_1183 256
180 3300048089 Ga0495614_0008662 Ga0495614_0008662_1101_1997 256
181 3300053077 Ga0495601_0012594 Ga0495601_0012594_363_1259 256
182 3300053078 Ga0495612_0002739 Ga0495612_0002739_6245_7141 256
183 3300028556 Ga0265337_1000047 Ga0265337_100004735 257
184 3300028558 Ga0265326_10002773 Ga0265326_100027734 257
185 3300028563 Ga0265319_1004312 Ga0265319_10043124 257
186 3300028573 Ga0265334_10009786 Ga0265334_100097863 257
187 3300028654 Ga0265322_10013045 Ga0265322_100130451 257
188 3300028666 Ga0265336_10081010 Ga0265336_100810101 257
189 3300028800 Ga0265338_10000315 Ga0265338_1000031534 257
190 3300031240 Ga0265320_10001951 Ga0265320_100019514 257
191 3300031247 Ga0265340_10010637 Ga0265340_100106373 257
192 3300046511 Ga0495608_0130931 Ga0495608_0130931_85_981 258
193 3300030731 Ga0316177_1122875 Ga0316177_11228751 259
194 3300049569 Ga0501032_0001651 Ga0501032_0001651_3331_4173 261
195 3300049571 Ga0501034_0000328 Ga0501034_0000328_47294_48136 261
196 3300049574 Ga0501038_0270571 Ga0501038_0270571_159_1001 261
197 3300053140 Ga0500573_0112852 Ga0500573_0112852_257_1177 261
198 3300053140 Ga0500573_0024834 Ga0500573_0024834_1268_2188 262
199 3300048905 Ga0496102_0325419 Ga0496102_0325419_130_1038 263
200 3300048917 Ga0496114_0020663 Ga0496114_0020663_3767_4675 263
201 3300005436 Ga0070713_100433834 Ga0070713_1004338342 264
202 3300049571 Ga0501034_0022915 Ga0501034_0022915_3619_4497 264
203 3300031995 Ga0307409_100326617 Ga0307409_1003266172 265
204 3300035398 Ga0316574_0087846 Ga0316574_0087846_439_1356 265
205 3300048917 Ga0496114_0206159 Ga0496114_0206159_616_1530 266
206 3300053098 Ga0500650_0008669 Ga0500650_0008669_1143_2063 266
207 3300053142 Ga0500577_0005166 Ga0500577_0005166_1262_2182 266
208 3300053142 Ga0500577_0038999 Ga0500577_0038999_552_1472 266
209 3300006051 Ga0075364_10201857 Ga0075364_102018572 268
210 3300013104 Ga0157370_10059433 Ga0157370_100594332 268
211 3300031901 Ga0307406_10002007 Ga0307406_100020077 268
212 3300031901 Ga0307406_10003732 Ga0307406_100037322 268
213 3300031911 Ga0307412_10209824 Ga0307412_102098242 268
214 3300032004 Ga0307414_10002785 Ga0307414_100027854 268
215 3300048920 Ga0496117_0001084 Ga0496117_0001084_20444_21322 268
216 3300048928 Ga0496125_0034174 Ga0496125_0034174_1005_1883 268
217 3300048929 Ga0496126_0004538 Ga0496126_0004538_5702_6580 268
218 3300050491 nmdc:mga00v17_74152_c1 nmdc:mga00v17_74152_c1_995_1873 268
219 iso_pu_bacteria 2739367654 2739606165 269
220 iso_pu_bacteria 2808606394 2809029390 269
221 3300009148 Ga0105243_10043356 Ga0105243_100433562 270
222 3300025728 Ga0207655_1001384 Ga0207655_100138423 270
223 3300025728 Ga0207655_1003194 Ga0207655_100319412 270
224 3300025935 Ga0207709_10000796 Ga0207709_1000079615 270
225 3300031548 Ga0307408_100012126 Ga0307408_1000121263 270
226 3300031824 Ga0307413_10003876 Ga0307413_100038765 270
227 3300031852 Ga0307410_10005677 Ga0307410_100056773 270
228 3300031903 Ga0307407_10003311 Ga0307407_100033115 270
229 3300031911 Ga0307412_10018634 Ga0307412_100186343 270
230 3300031995 Ga0307409_100050713 Ga0307409_1000507132 270
231 3300032002 Ga0307416_100006627 Ga0307416_1000066273 270
232 3300032005 Ga0307411_10035966 Ga0307411_100359661 270
233 3300031901 Ga0307406_10028615 Ga0307406_100286152 271
234 3300048928 Ga0496125_0114364 Ga0496125_0114364_491_1369 271
235 3300002738 JGI25154J39366_1000585 JGI25154J39366_10005854 272
236 3300006051 Ga0075364_10025773 Ga0075364_100257733 272
237 3300025246 Ga0209646_1000030 Ga0209646_100003092 272
238 3300046460 Ga0495638_0015359 Ga0495638_0015359_1607_2530 272
239 3300050491 nmdc:mga00v17_135924_c1 nmdc:mga00v17_135924_c1_77_952 272
240 3300048927 Ga0496124_0077914 Ga0496124_0077914_1397_2332 273
241 3300050491 nmdc:mga00v17_71905_c1 nmdc:mga00v17_71905_c1_1294_2115 273
242 3300030732 Ga0316176_1043689 Ga0316176_10436893 274
243 3300009148 Ga0105243_10156667 Ga0105243_101566671 275
244 3300011119 Ga0105246_10021873 Ga0105246_100218734 275
245 3300013105 Ga0157369_10197637 Ga0157369_101976373 275
246 3300025303 Ga0209051_1006033 Ga0209051_10060333 275
247 3300025935 Ga0207709_10004329 Ga0207709_100043291 275
248 3300031548 Ga0307408_100024514 Ga0307408_1000245143 275
249 3300031548 Ga0307408_100033557 Ga0307408_1000335573 275
250 3300031901 Ga0307406_10117565 Ga0307406_101175651 275
251 3300031911 Ga0307412_10004892 Ga0307412_100048923 275
252 3300031911 Ga0307412_10011390 Ga0307412_100113903 275
253 3300032002 Ga0307416_100123929 Ga0307416_1001239292 275
254 3300032002 Ga0307416_100540968 Ga0307416_1005409681 275
255 3300048927 Ga0496124_0000075 Ga0496124_0000075_21723_22625 275
256 3300002773 JGI25152J39213_1000290 JGI25152J39213_100029032 276
257 3300025245 Ga0207425_1026380 Ga0207425_10263802 276
258 3300025258 Ga0209129_1000047 Ga0209129_1000047254 276
259 3300025294 Ga0209025_1000691 Ga0209025_100069146 276
260 3300037418 Ga0395900_0309471 Ga0395900_0309471_603_1505 276
261 3300037466 Ga0395898_0060258 Ga0395898_0060258_321_1223 276
262 3300038443 Ga0395901_0063784 Ga0395901_0063784_2786_3688 276
263 3300048920 Ga0496117_0000223 Ga0496117_0000223_40402_41304 276
264 3300048921 Ga0496118_0000296 Ga0496118_0000296_66192_67094 276
265 3300048922 Ga0496119_0001226 Ga0496119_0001226_17779_18690 276
266 3300048922 Ga0496119_0035978 Ga0496119_0035978_1878_2780 276
267 3300048923 Ga0496120_0002245 Ga0496120_0002245_3153_4064 276
268 3300048923 Ga0496120_0044408 Ga0496120_0044408_381_1283 276
269 3300048925 Ga0496122_0039097 Ga0496122_0039097_1273_2175 276
270 3300048926 Ga0496123_0153213 Ga0496123_0153213_36_938 276
271 3300025258 Ga0209129_1017977 Ga0209129_10179772 277
272 3300031903 Ga0307407_10007112 Ga0307407_100071123 277
273 3300048917 Ga0496114_0019251 Ga0496114_0019251_2932_3837 277
274 3300048920 Ga0496117_0187819 Ga0496117_0187819_232_1125 277
275 3300049571 Ga0501034_0048405 Ga0501034_0048405_2675_3577 277
276 3300049574 Ga0501038_0071677 Ga0501038_0071677_1731_2633 277
277 3300013104 Ga0157370_10151243 Ga0157370_101512432 278
278 3300048908 Ga0496105_0228503 Ga0496105_0228503_366_1280 278
279 3300048917 Ga0496114_0149412 Ga0496114_0149412_300_1214 278
280 3300031548 Ga0307408_100218039 Ga0307408_1002180392 280
281 3300031731 Ga0307405_10116013 Ga0307405_101160132 280
282 3300031911 Ga0307412_10063506 Ga0307412_100635062 280
283 3300049569 Ga0501032_0130881 Ga0501032_0130881_582_1466 281
284 3300049573 Ga0501037_0005756 Ga0501037_0005756_1055_1939 281
285 3300049574 Ga0501038_0333370 Ga0501038_0333370_74_958 281
286 3300049575 Ga0501039_0111899 Ga0501039_0111899_227_1111 281
287 3300049579 Ga0501043_0051190 Ga0501043_0051190_2057_2941 281
288 3300049823 Ga0501044_0090451 Ga0501044_0090451_1466_2350 281
289 iso_pu_bacteria 2932426870 2932427079 281
290 iso_pu_bacteria 2933418574 2933419708 281
291 3300049586 Ga0501070_0001347 Ga0501070_0001347_2872_3783 282
292 iso_pu_bacteria 2868088558 2868092217 282
293 iso_pu_bacteria 8056579771 8056583619 282
294 3300053139 Ga0500568_0051742 Ga0500568_0051742_444_1346 283
295 3300049570 Ga0501033_0051217 Ga0501033_0051217_1766_2668 285
296 3300049572 Ga0501036_0067265 Ga0501036_0067265_639_1541 285
297 3300049823 Ga0501044_0246229 Ga0501044_0246229_800_1702 285
298 3300053140 Ga0500573_0001009 Ga0500573_0001009_4497_5417 285
299 iso_pu_bacteria 2758568522 2760306980 285
300 iso_pu_bacteria 2758568621 2760624547 285
301 iso_pu_bacteria 2852677369 2852678869 285
302 iso_pu_bacteria 2862993130 2862996237 285
303 iso_pu_bacteria 2643221542 2643733140 286
304 iso_pu_bacteria 2643221553 2643784586 286
305 iso_pu_bacteria 2643221630 2644171908 286
306 iso_pu_bacteria 2643221724 2644678234 286
307 iso_pu_bacteria 2728369380 2730231251 286
308 iso_pu_bacteria 2747842429 2747952652 286
309 iso_pu_bacteria 2852663356 2852663496 286
310 iso_pu_bacteria 2857740372 2857744916 286
311 iso_pu_bacteria 2904501621 2904504209 286
312 iso_pu_bacteria 2908674828 2908676400 286
313 iso_pu_bacteria 2909074476 2909076649 286
314 iso_pu_bacteria 2910809715 2910812859 286
315 iso_pu_bacteria 2919039151 2919039262 286
316 iso_pu_bacteria 2919042368 2919042639 286
317 iso_pu_bacteria 2928500415 2928503000 286
318 iso_pu_bacteria 2945968032 2945969526 286
319 iso_pu_bacteria 2946041624 2946041918 286
320 iso_pu_bacteria 2946080515 2946083305 286
321 iso_pu_bacteria 2984551494 2984555081 286
322 iso_pu_bacteria 8004182704 8004183902 286
323 iso_pu_bacteria 2751185788 2753302934 287
324 iso_pu_bacteria 2852646457 2852649107 287
325 iso_pu_bacteria 2904497146 2904500256 287
326 iso_pu_bacteria 2928104781 2928104945 287
327 iso_pu_bacteria 2775506735 2775657419 288
328 iso_pu_bacteria 2808606360 2808850062 288
329 iso_pu_bacteria 2808606370 2808892904 288
330 iso_pu_bacteria 2811994871 2812319463 288
331 iso_pu_bacteria 2887443736 2887446553 288
332 iso_pu_bacteria 2904430863 2904431676 288
333 iso_pu_bacteria 2909074476 2909077448 288
334 iso_pu_bacteria 2953998280 2954002556 288
335 iso_pu_bacteria 2974302888 2974305166 288
336 iso_pu_bacteria 8004021418 8004023081 288
337 3300046538 Ga0495609_0034414 Ga0495609_0034414_618_1523 289
338 3300048924 Ga0496121_0201352 Ga0496121_0201352_325_1230 289
339 3300048925 Ga0496122_0175497 Ga0496122_0175497_261_1166 289
340 3300048927 Ga0496124_0047470 Ga0496124_0047470_1932_2837 289
341 iso_pu_bacteria 2939674588 2939677341 289
342 iso_pu_bacteria 8057345674 8057349015 289
343 3300003320 rootH2_10096985 rootH2_100969852 290
344 3300044765 Ga0466970_0025599 Ga0466970_0025599_300_1202 290
345 3300048903 Ga0496100_0197224 Ga0496100_0197224_199_1119 290
346 3300048920 Ga0496117_0001996 Ga0496117_0001996_12829_13749 290
347 3300048921 Ga0496118_0000290 Ga0496118_0000290_42406_43326 290
348 3300048922 Ga0496119_0007224 Ga0496119_0007224_562_1482 290
349 3300048922 Ga0496119_0157110 Ga0496119_0157110_37_948 290
350 3300048923 Ga0496120_0085388 Ga0496120_0085388_524_1444 290
351 3300048925 Ga0496122_0008173 Ga0496122_0008173_4392_5312 290
352 3300048926 Ga0496123_0120696 Ga0496123_0120696_274_1194 290
353 3300048927 Ga0496124_0000040 Ga0496124_0000040_211913_212833 290
354 iso_pu_bacteria 2643221572 2643876850 290
355 iso_pu_bacteria 2643221669 2644383905 290
356 iso_pu_bacteria 2690315906 2691514888 290
357 iso_pu_bacteria 2857723135 2857726644 290
358 iso_pu_bacteria 2857729791 2857729869 290
359 iso_pu_bacteria 2895660088 2895663087 290
360 iso_pu_bacteria 2904776348 2904776947 290
361 iso_pu_bacteria 2906799679 2906801275 290
362 iso_pu_bacteria 2919034639 2919036485 290
363 iso_pu_bacteria 2919059106 2919059503 290
364 iso_pu_bacteria 2919538618 2919540945 290
365 iso_pu_bacteria 2928121344 2928123135 290
366 iso_pu_bacteria 2939647034 2939649893 290
367 3300049575 Ga0501039_0251522 Ga0501039_0251522_227_1111 291
368 3300049586 Ga0501070_0364881 Ga0501070_0364881_194_1081 291
369 iso_pu_bacteria 2773857763 2774399155 291
370 iso_pu_bacteria 2808606306 2808629807 291
371 iso_pu_bacteria 2808606447 2809227666 291
372 iso_pu_bacteria 2833709550 2833713012 291
373 iso_pu_bacteria 2848551377 2848553362 291
374 iso_pu_bacteria 2852632344 2852634429 291
375 iso_pu_bacteria 2939657138 2939660124 291
376 iso_pu_bacteria 2946024296 2946026204 291
377 iso_pu_bacteria 2964326757 2964328105 291
378 3300031548 Ga0307408_100039826 Ga0307408_1000398262 292
379 3300031911 Ga0307412_10001043 Ga0307412_1000104310 292
380 3300031911 Ga0307412_10266640 Ga0307412_102666402 292
381 3300032002 Ga0307416_100359906 Ga0307416_1003599062 292
382 3300032004 Ga0307414_10019759 Ga0307414_100197594 292
383 iso_pu_bacteria 2757320536 2758227421 292
384 iso_pu_bacteria 2811994872 2812322748 292
385 iso_pu_bacteria 2821268502 2821268513 292
386 iso_pu_bacteria 2966924647 2966927708 292
387 iso_pu_bacteria 2974294766 2974296072 292
388 iso_pu_bacteria 2974324384 2974327664 292
389 iso_pu_bacteria 2977251589 2977252579 292
390 iso_pu_bacteria 2984580707 2984582769 292
391 iso_pu_bacteria 8016254467 8016256315 292
392 iso_pu_bacteria 2977264416 2977264427 293
393 3300011119 Ga0105246_10489892 Ga0105246_104898922 294
394 3300025901 Ga0207688_10039972 Ga0207688_100399722 294
395 3300037418 Ga0395900_0115078 Ga0395900_0115078_158_1060 294
396 3300037466 Ga0395898_0104846 Ga0395898_0104846_60_962 294
397 3300001979 JGI24740J21852_10011305 JGI24740J21852_100113054 295
398 3300003322 rootL2_10129165 rootL2_101291652 295
399 3300005288 Ga0065714_10008014 Ga0065714_100080142 295
400 3300006051 Ga0075364_10018547 Ga0075364_100185472 295
401 3300006178 Ga0075367_10003011 Ga0075367_100030118 295
402 3300006186 Ga0075369_10004790 Ga0075369_100047905 295
403 3300006353 Ga0075370_10016015 Ga0075370_100160152 295
404 3300011119 Ga0105246_10157300 Ga0105246_101573002 295
405 3300013307 Ga0157372_10082729 Ga0157372_100827293 295
406 3300017792 Ga0163161_10103912 Ga0163161_101039122 295
407 3300025933 Ga0207706_10358726 Ga0207706_103587262 295
408 3300027866 Ga0209813_10003222 Ga0209813_100032222 295
409 3300044735 Ga0466968_0076511 Ga0466968_0076511_190_1077 295
410 3300044765 Ga0466970_0000082 Ga0466970_0000082_36222_37109 295
411 3300044842 Ga0466957_0009989 Ga0466957_0009989_3790_4677 295
412 3300047472 Ga0495686_0211738 Ga0495686_0211738_61_975 295
413 3300048911 Ga0496108_0519021 Ga0496108_0519021_89_1000 295
414 3300048917 Ga0496114_0297571 Ga0496114_0297571_127_1047 295
415 3300050490 nmdc:mga03n38_971_c1 nmdc:mga03n38_971_c1_4153_5067 295
416 3300050492 nmdc:mga0yw44_5115_c1 nmdc:mga0yw44_5115_c1_4554_5468 295
417 3300050495 nmdc:mga04h51_4197_c1 nmdc:mga04h51_4197_c1_1013_1927 295
418 3300050496 nmdc:mga07m45_32118_c1 nmdc:mga07m45_32118_c1_360_1274 295
419 iso_pu_bacteria 2939660829 2939664376 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

305

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.6465 29 295
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.6418 29 285
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6404 85 287
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6366 15 283
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.628 28 282
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7552 29 281 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7534 29 285 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7528 29 285 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7307 29 281 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7279 29 285 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6I6FLY5-F1-model_v4 Carbohydrate ABC transporter permease 0.7951 29 295 GO:0005886
GO:0055085
AF-C6WGQ2-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.7937 29 295 GO:0005886
GO:0055085
AF-A0A0M8RPC8-F1-model_v4 Sugar ABC transporter permease 0.792 27 295 GO:0005886
GO:0055085
AF-A0A4D4KFN3-F1-model_v4 Sugar ABC transporter permease 0.7916 23 295 GO:0005886
GO:0055085
AF-A0A0Q9KHK2-F1-model_v4 Sugar ABC transporter permease 0.7898 36 289 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
65.42 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map