F439637

General Info

Members Datasets Scaffolds Average Seq Length
419 209 838 125

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0193552|Ga0501084_0193552_174_611
Length 145
Sequence VRRSGTFGATSPPNHEEEQMSGLLTEFKDFLMKGNIVELAVAFVMGVAFAAVVNSLVENLVMPIIAAIIGKPDFSDLTFTINDAVFRYGAFITAAIQFVAVAAAVFFFIVRPLNALMTRYRSPVEEGMPDEERRHQELLAALRER

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
127 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 7.16
Rhizosphere 91.17
Stem 0
Stem Tuber 0
Unclassified 8.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0193552 3300054114 Bacteria 1716
2 Ga0070658_10489181 3300005327 Bacteria 1062
3 Ga0070676_10454032 3300005328 Bacteria 902
4 Ga0070683_100123793 3300005329 Bacteria 2443
5 Ga0070683_100526598 3300005329 Bacteria 1130
6 Ga0070683_101407615 3300005329 Bacteria 670
7 Ga0070677_10356776 3300005333 Bacteria 759
8 Ga0070682_100352744 3300005337 Bacteria 1097
9 Ga0068868_100377175 3300005338 Bacteria 1219
10 Ga0068868_100510557 3300005338 Bacteria 1054
11 Ga0070669_100344428 3300005353 Bacteria 1208
12 Ga0070675_100180075 3300005354 Bacteria 1827
13 Ga0070674_100250126 3300005356 Bacteria 1392
14 Ga0070674_101565158 3300005356 Unclassified 594
15 Ga0070709_10475708 3300005434 Bacteria 945
16 Ga0070714_100561337 3300005435 Bacteria 1094
17 Ga0070701_10321202 3300005438 Bacteria 958
18 Ga0070705_100073976 3300005440 Bacteria 2070
19 Ga0070700_100214891 3300005441 Bacteria 1359
20 Ga0070700_101516903 3300005441 Bacteria 570
21 Ga0070694_100499294 3300005444 Unclassified 968
22 Ga0070708_100174050 3300005445 Bacteria 2011
23 Ga0070663_100397385 3300005455 Bacteria 1126
24 Ga0070663_100728232 3300005455 Bacteria 845
25 Ga0070678_100605630 3300005456 Bacteria 978
26 Ga0070681_11113512 3300005458 Bacteria 711
27 Ga0068867_101319154 3300005459 Bacteria 667
28 Ga0070706_100441790 3300005467 Bacteria 1211
29 Ga0070707_100248616 3300005468 Bacteria 1730
30 Ga0070707_100277894 3300005468 Bacteria 1628
31 Ga0070707_100674826 3300005468 Bacteria 996
32 Ga0070698_100289332 3300005471 Bacteria 1570
33 Ga0070698_100851511 3300005471 Bacteria 857
34 Ga0070699_100467007 3300005518 Bacteria 1145
35 Ga0070679_101007434 3300005530 Bacteria 777
36 Ga0070684_100099098 3300005535 Bacteria 2600
37 Ga0070684_100310787 3300005535 Bacteria 1447
38 Ga0070672_100339564 3300005543 Unclassified 1279
39 Ga0070696_100036090 3300005546 Bacteria 3406
40 Ga0070704_100308045 3300005549 Bacteria 1322
41 Ga0070664_101063278 3300005564 Bacteria 761
42 Ga0070664_101299774 3300005564 Bacteria 687
43 Ga0068854_100047056 3300005578 Bacteria 3073
44 Ga0068854_101334153 3300005578 Bacteria 647
45 Ga0070702_101789072 3300005615 Bacteria 513
46 Ga0068852_101002260 3300005616 Bacteria 854
47 Ga0068859_101489804 3300005617 Bacteria 747
48 Ga0068864_100220065 3300005618 Bacteria 1751
49 Ga0068861_100197175 3300005719 Bacteria 1687
50 Ga0068870_10103666 3300005840 Bacteria 1612
51 Ga0081455_10115694 3300005937 Bacteria 2122
52 Ga0081455_10142981 3300005937 Bacteria 1855
53 Ga0081455_10173632 3300005937 Bacteria 1639
54 Ga0081455_10982701 3300005937 Bacteria 523
55 Ga0081538_10191602 3300005981 Unclassified 857
56 Ga0081539_10004624 3300005985 Bacteria 14987
57 Ga0081539_10047584 3300005985 Bacteria 2447
58 Ga0075365_10209203 3300006038 Bacteria 1367
59 Ga0075367_10066916 3300006178 Bacteria 2154
60 Ga0075367_10239773 3300006178 Bacteria 1136
61 Ga0075427_10016526 3300006194 Bacteria 1147
62 Ga0075428_100133141 3300006844 Bacteria 2703
63 Ga0075430_100026202 3300006846 Bacteria 4961
64 Ga0075430_100228645 3300006846 Bacteria 1542
65 Ga0075430_100359280 3300006846 Bacteria 1203
66 Ga0075433_10400952 3300006852 Bacteria 1210
67 Ga0075434_100051288 3300006871 Bacteria 4100
68 Ga0075434_100342225 3300006871 Bacteria 1517
69 Ga0075429_101195707 3300006880 Bacteria 664
70 Ga0068865_101640433 3300006881 Bacteria 579
71 Ga0097620_101489774 3300006931 Bacteria 747
72 Ga0075435_100733708 3300007076 Bacteria 859
73 Ga0111539_10015718 3300009094 Bacteria 9405
74 Ga0111539_10095041 3300009094 Bacteria 3502
75 Ga0111539_11697035 3300009094 Bacteria 732
76 Ga0111539_11716558 3300009094 Bacteria 728
77 Ga0111539_13276804 3300009094 Unclassified 521
78 Ga0105245_10136357 3300009098 Bacteria 2307
79 Ga0105245_10491726 3300009098 Bacteria 1242
80 Ga0105245_11879111 3300009098 Bacteria 652
81 Ga0114129_10056277 3300009147 Bacteria 5509
82 Ga0114129_10191460 3300009147 Bacteria 2777
83 Ga0114129_10381215 3300009147 Bacteria 1862
84 Ga0105241_10312438 3300009174 Bacteria 1352
85 Ga0105242_10060890 3300009176 Bacteria 3103
86 Ga0105242_10943414 3300009176 Unclassified 866
87 Ga0105237_11240193 3300009545 Unclassified 752
88 Ga0105239_10318410 3300010375 Bacteria 1754
89 Ga0105239_11865670 3300010375 Bacteria 697
90 Ga0105246_10074785 3300011119 Bacteria 2396
91 Ga0105246_10703837 3300011119 Bacteria 886
92 Ga0157375_11187625 3300013308 Bacteria 895
93 Ga0157375_11484295 3300013308 Bacteria 800
94 Ga0157380_10084597 3300014326 Bacteria 2601
95 Ga0157380_10566508 3300014326 Bacteria 1117
96 Ga0157377_11077819 3300014745 Bacteria 614
97 Ga0157377_11319759 3300014745 Bacteria 565
98 Ga0157376_10361925 3300014969 Bacteria 1391
99 Ga0157376_10633799 3300014969 Bacteria 1067
100 Ga0157376_12383182 3300014969 Unclassified 569
101 Ga0207682_10402457 3300025893 Unclassified 647
102 Ga0207688_10408518 3300025901 Bacteria 843
103 Ga0207645_10771338 3300025907 Bacteria 654
104 Ga0207643_10133966 3300025908 Bacteria 1476
105 Ga0207705_10491395 3300025909 Bacteria 953
106 Ga0207684_10856876 3300025910 Unclassified 766
107 Ga0207707_10217398 3300025912 Bacteria 1664
108 Ga0207693_10002613 3300025915 Bacteria 15647
109 Ga0207660_10302324 3300025917 Bacteria 1274
110 Ga0207660_10500741 3300025917 Bacteria 985
111 Ga0207649_11419074 3300025920 Bacteria 549
112 Ga0207652_10861852 3300025921 Unclassified 802
113 Ga0207652_11362206 3300025921 Bacteria 613
114 Ga0207646_10218787 3300025922 Bacteria 1720
115 Ga0207681_11021948 3300025923 Bacteria 694
116 Ga0207659_10287077 3300025926 Unclassified 1347
117 Ga0207687_10456032 3300025927 Bacteria 1061
118 Ga0207687_10605986 3300025927 Bacteria 923
119 Ga0207664_10126436 3300025929 Bacteria 2147
120 Ga0207686_10599559 3300025934 Unclassified 867
121 Ga0207669_10054391 3300025937 Bacteria 2418
122 Ga0207669_10060517 3300025937 Bacteria 2322
123 Ga0207704_10310294 3300025938 Unclassified 1212
124 Ga0207691_10269978 3300025940 Bacteria 1465
125 Ga0207691_10400932 3300025940 Bacteria 1170
126 Ga0207661_10023975 3300025944 Bacteria 4617
127 Ga0207679_11193073 3300025945 Bacteria 698
128 Ga0207668_10402349 3300025972 Bacteria 1158
129 Ga0207640_10901482 3300025981 Bacteria 772
130 Ga0207640_12043959 3300025981 Bacteria 519
131 Ga0207677_10205868 3300026023 Bacteria 1567
132 Ga0207677_10310940 3300026023 Bacteria 1306
133 Ga0207708_10104397 3300026075 Bacteria 2196
134 Ga0207708_10324197 3300026075 Bacteria 1258
135 Ga0207708_10682660 3300026075 Bacteria 877
136 Ga0207708_11211121 3300026075 Bacteria 660
137 Ga0207648_10107420 3300026089 Bacteria 2450
138 Ga0207648_10268086 3300026089 Bacteria 1525
139 Ga0207676_12228264 3300026095 Bacteria 546
140 Ga0207674_10810949 3300026116 Bacteria 903
141 Ga0207675_100006335 3300026118 Bacteria 11220
142 Ga0207675_101608071 3300026118 Bacteria 670
143 Ga0207683_10453103 3300026121 Unclassified 1183
144 Ga0207698_10425591 3300026142 Bacteria 1275
145 Ga0207698_11153301 3300026142 Bacteria 788
146 Ga0207428_10025594 3300027907 Bacteria 4938
147 Ga0265319_1005442 3300028563 Bacteria 6088
148 Ga0265334_10005432 3300028573 Bacteria 5567
149 Ga0265318_10015417 3300028577 Bacteria 3179
150 Ga0265336_10055087 3300028666 Bacteria 1197
151 Ga0265338_10016638 3300028800 Bacteria 7978
152 Ga0265324_10143456 3300029957 Unclassified 811
153 Ga0265330_10025801 3300031235 Bacteria 2662
154 Ga0265320_10096791 3300031240 Unclassified 1362
155 Ga0265329_10040364 3300031242 Bacteria 1497
156 Ga0265339_10309302 3300031249 Bacteria 752
157 Ga0265327_10022222 3300031251 Bacteria 3802
158 Ga0265327_10278498 3300031251 Bacteria 740
159 Ga0307408_102522438 3300031548 Bacteria 500
160 Ga0265314_10003240 3300031711 Bacteria 15912
161 Ga0265342_10047098 3300031712 Bacteria 2588
162 Ga0307405_10373665 3300031731 Bacteria 1107
163 Ga0307409_100634747 3300031995 Bacteria 1060
164 Ga0307416_100020165 3300032002 Bacteria 4749
165 Ga0307416_101343771 3300032002 Bacteria 820
166 Ga0307416_101670593 3300032002 Bacteria 742
167 Ga0307415_100016319 3300032126 Bacteria 4424
168 Ga0307415_101285348 3300032126 Bacteria 692
169 Ga0373952_0234961 3300035092 Unclassified 549
170 Ga0373961_0089325 3300035241 Bacteria 982
171 Ga0395899_0023180 3300037312 Bacteria 4705
172 Ga0395899_0182946 3300037312 Bacteria 1470
173 Ga0395900_0031744 3300037418 Bacteria 5429
174 Ga0395900_0123945 3300037418 Bacteria 2650
175 Ga0395900_0288158 3300037418 Unclassified 1632
176 Ga0395900_0351873 3300037418 Bacteria 1446
177 Ga0395898_0032764 3300037466 Bacteria 5188
178 Ga0395898_0411257 3300037466 Bacteria 1290
179 Ga0395898_0681708 3300037466 Unclassified 970
180 Ga0395905_0186362 3300037471 Bacteria 1947
181 Ga0395905_0677653 3300037471 Bacteria 933
182 Ga0395905_1341772 3300037471 Bacteria 619
183 Ga0395901_0235371 3300038443 Bacteria 1911
184 Ga0395901_0559980 3300038443 Bacteria 1157
185 Ga0395901_1361526 3300038443 Bacteria 669
186 Ga0451793_1288143 3300041452 Unclassified 530
187 Ga0451800_0235438 3300041459 Bacteria 532
188 Ga0451853_0035796 3300041512 Bacteria 1814
189 Ga0450920_055897 3300042122 Bacteria 794
190 Ga0450907_027019 3300042146 Bacteria 973
191 Ga0439434_0170771 3300042435 Bacteria 725
192 Ga0451576_0434091 3300045051 Bacteria 1378
193 Ga0495603_0163979 3300046455 Bacteria 1289
194 Ga0495603_0573228 3300046455 Bacteria 646
195 Ga0495603_0741536 3300046455 Bacteria 561
196 Ga0495653_0519108 3300046463 Bacteria 741
197 Ga0495653_0918676 3300046463 Bacteria 521
198 Ga0495639_0269165 3300046475 Unclassified 845
199 Ga0495584_0124007 3300046491 Unclassified 1309
200 Ga0495596_0069086 3300046500 Bacteria 1373
201 Ga0495616_0243135 3300046513 Bacteria 776
202 Ga0495631_0158968 3300046518 Unclassified 970
203 Ga0495644_0078557 3300046523 Bacteria 1243
204 Ga0495642_0311069 3300046528 Unclassified 691
205 Ga0495652_0532486 3300046529 Bacteria 810
206 Ga0495587_0455184 3300046536 Bacteria 709
207 Ga0495609_0274112 3300046538 Unclassified 691
208 Ga0495633_0344150 3300046558 Unclassified 676
209 Ga0495633_0493832 3300046558 Bacteria 552
210 Ga0495656_0007983 3300046615 Bacteria 3765
211 Ga0495656_0376015 3300046615 Unclassified 740
212 Ga0495656_0419724 3300046615 Bacteria 702
213 Ga0495588_0415129 3300046674 Bacteria 706
214 Ga0495670_0158352 3300046691 Bacteria 1189
215 Ga0495670_0263712 3300046691 Bacteria 920
216 Ga0495671_0252645 3300046692 Unclassified 851
217 Ga0495589_0404933 3300046794 Unclassified 626
218 Ga0495581_0182683 3300047315 Unclassified 1227
219 Ga0495602_0896252 3300048088 Bacteria 590
220 Ga0495615_0216370 3300048090 Unclassified 596
221 Ga0496100_0385717 3300048903 Bacteria 1065
222 Ga0496101_0019998 3300048904 Bacteria 4578
223 Ga0496101_0519697 3300048904 Bacteria 941
224 Ga0496102_0008742 3300048905 Bacteria 8690
225 Ga0496102_0104969 3300048905 Bacteria 2629
226 Ga0496102_0139102 3300048905 Bacteria 2276
227 Ga0496103_0575073 3300048906 Bacteria 718
228 Ga0496104_0438599 3300048907 Bacteria 1218
229 Ga0496104_1685547 3300048907 Bacteria 536
230 Ga0496105_0216719 3300048908 Bacteria 1559
231 Ga0496105_0220285 3300048908 Bacteria 1545
232 Ga0496105_0487349 3300048908 Bacteria 969
233 Ga0496107_0107075 3300048910 Bacteria 2054
234 Ga0496108_0344666 3300048911 Bacteria 1300
235 Ga0496108_0907905 3300048911 Bacteria 756
236 Ga0496109_0013648 3300048912 Bacteria 7056
237 Ga0496109_0117676 3300048912 Bacteria 2474
238 Ga0496109_0536002 3300048912 Bacteria 1104
239 Ga0496110_0159163 3300048913 Bacteria 2046
240 Ga0496111_0019191 3300048914 Bacteria 4745
241 Ga0496111_0773250 3300048914 Bacteria 696
242 Ga0496111_1353151 3300048914 Bacteria 500
243 Ga0496112_0018488 3300048915 Bacteria 6563
244 Ga0496113_0457560 3300048916 Bacteria 1025
245 Ga0496113_1191631 3300048916 Bacteria 595
246 Ga0496114_0863354 3300048917 Bacteria 785
247 Ga0496114_1419087 3300048917 Bacteria 582
248 Ga0496115_0004429 3300048918 Bacteria 10178
249 Ga0501031_0001620 3300049568 Bacteria 14075
250 Ga0501031_0002892 3300049568 Bacteria 10974
251 Ga0501031_0010436 3300049568 Bacteria 6050
252 Ga0501031_0223935 3300049568 Bacteria 1224
253 Ga0501031_0400988 3300049568 Bacteria 887
254 Ga0501032_0023403 3300049569 Bacteria 4268
255 Ga0501033_0031325 3300049570 Bacteria 3996
256 Ga0501033_0280424 3300049570 Bacteria 1176
257 Ga0501033_0359519 3300049570 Bacteria 1019
258 Ga0501033_0378468 3300049570 Bacteria 989
259 Ga0501033_0590529 3300049570 Bacteria 762
260 Ga0501034_0297909 3300049571 Bacteria 1550
261 Ga0501034_0333618 3300049571 Bacteria 1448
262 Ga0501034_1004008 3300049571 Bacteria 718
263 Ga0501036_0004360 3300049572 Bacteria 11415
264 Ga0501036_0024038 3300049572 Bacteria 5135
265 Ga0501036_0227496 3300049572 Bacteria 1565
266 Ga0501036_0548680 3300049572 Bacteria 960
267 Ga0501037_0036134 3300049573 Bacteria 3641
268 Ga0501037_0096260 3300049573 Bacteria 2139
269 Ga0501038_0045250 3300049574 Bacteria 3821
270 Ga0501038_0088994 3300049574 Bacteria 2590
271 Ga0501038_0209314 3300049574 Bacteria 1561
272 Ga0501038_1316488 3300049574 Bacteria 521
273 Ga0501039_0000567 3300049575 Bacteria 26741
274 Ga0501039_0198960 3300049575 Bacteria 1575
275 Ga0501039_0247935 3300049575 Bacteria 1400
276 Ga0501039_0267554 3300049575 Bacteria 1343
277 Ga0501040_0011573 3300049576 Bacteria 5774
278 Ga0501040_0061944 3300049576 Bacteria 2573
279 Ga0501040_0078026 3300049576 Bacteria 2291
280 Ga0501040_0089924 3300049576 Bacteria 2133
281 Ga0501040_0867766 3300049576 Bacteria 653
282 Ga0501041_0002239 3300049577 Bacteria 10938
283 Ga0501041_0007726 3300049577 Bacteria 6312
284 Ga0501041_0055015 3300049577 Bacteria 2428
285 Ga0501041_0075451 3300049577 Bacteria 2073
286 Ga0501041_0164711 3300049577 Bacteria 1386
287 Ga0501042_0022674 3300049578 Bacteria 4386
288 Ga0501042_0079347 3300049578 Bacteria 2351
289 Ga0501042_0126065 3300049578 Bacteria 1844
290 Ga0501042_0273969 3300049578 Bacteria 1218
291 Ga0501042_0345072 3300049578 Bacteria 1076
292 Ga0501043_0001426 3300049579 Bacteria 20883
293 Ga0501043_0104233 3300049579 Bacteria 2229
294 Ga0501043_0232040 3300049579 Bacteria 1425
295 Ga0501043_0368840 3300049579 Bacteria 1088
296 Ga0501046_0030187 3300049580 Bacteria 4401
297 Ga0501046_0032993 3300049580 Bacteria 4188
298 Ga0501046_0078932 3300049580 Bacteria 2545
299 Ga0501046_0416756 3300049580 Bacteria 968
300 Ga0501048_0007526 3300049582 Bacteria 8252
301 Ga0501048_0049075 3300049582 Bacteria 3009
302 Ga0501048_0053598 3300049582 Bacteria 2867
303 Ga0501048_1167969 3300049582 Unclassified 554
304 Ga0501067_0017470 3300049583 Bacteria 3967
305 Ga0501067_0078813 3300049583 Unclassified 1825
306 Ga0501068_0000470 3300049584 Bacteria 20365
307 Ga0501068_0037630 3300049584 Bacteria 2896
308 Ga0501068_0288941 3300049584 Bacteria 1048
309 Ga0501068_0704860 3300049584 Bacteria 660
310 Ga0501069_0004231 3300049585 Bacteria 7416
311 Ga0501069_0031129 3300049585 Bacteria 2933
312 Ga0501069_0054810 3300049585 Bacteria 2220
313 Ga0501069_0142807 3300049585 Bacteria 1373
314 Ga0501069_0300398 3300049585 Bacteria 941
315 Ga0501070_0001965 3300049586 Bacteria 18128
316 Ga0501070_0097331 3300049586 Bacteria 2434
317 Ga0501070_0450078 3300049586 Bacteria 1038
318 Ga0501070_0546606 3300049586 Bacteria 927
319 Ga0501071_0000103 3300049587 Bacteria 32610
320 Ga0501071_0039774 3300049587 Bacteria 3364
321 Ga0501071_0068939 3300049587 Bacteria 2574
322 Ga0501071_0300891 3300049587 Bacteria 1216
323 Ga0501071_0415768 3300049587 Bacteria 1027
324 Ga0501072_0005251 3300049588 Bacteria 9862
325 Ga0501072_0023845 3300049588 Bacteria 4754
326 Ga0501072_0031025 3300049588 Bacteria 4182
327 Ga0501072_0253063 3300049588 Bacteria 1402
328 Ga0501072_0259722 3300049588 Bacteria 1382
329 Ga0501073_0061844 3300049589 Bacteria 2612
330 Ga0501073_0140354 3300049589 Bacteria 1674
331 Ga0501073_1063337 3300049589 Bacteria 556
332 Ga0501074_0006459 3300049590 Bacteria 8468
333 Ga0501074_0017426 3300049590 Bacteria 5211
334 Ga0501074_0019019 3300049590 Bacteria 4988
335 Ga0501074_0237598 3300049590 Bacteria 1296
336 Ga0501075_0002149 3300049591 Bacteria 13049
337 Ga0501075_0064856 3300049591 Bacteria 2755
338 Ga0501075_0152684 3300049591 Bacteria 1760
339 Ga0501075_0233458 3300049591 Bacteria 1402
340 Ga0501075_0239715 3300049591 Bacteria 1382
341 Ga0501075_0453323 3300049591 Bacteria 978
342 Ga0501075_0502476 3300049591 Bacteria 925
343 Ga0501076_0001231 3300049592 Bacteria 17030
344 Ga0501076_0004640 3300049592 Bacteria 9791
345 Ga0501076_0080377 3300049592 Bacteria 2617
346 Ga0501076_0266498 3300049592 Bacteria 1402
347 Ga0501076_0273816 3300049592 Bacteria 1382
348 Ga0501076_1421460 3300049592 Bacteria 570
349 Ga0501077_0018582 3300049593 Bacteria 4396
350 Ga0501077_0035359 3300049593 Bacteria 3179
351 Ga0501077_0157805 3300049593 Bacteria 1440
352 Ga0501077_0176768 3300049593 Bacteria 1356
353 Ga0501077_0205693 3300049593 Bacteria 1251
354 Ga0501079_0003189 3300049741 Bacteria 12014
355 Ga0501079_0169855 3300049741 Bacteria 1700
356 Ga0501079_0244353 3300049741 Bacteria 1402
357 Ga0501079_0251081 3300049741 Bacteria 1382
358 Ga0501080_0004556 3300049742 Bacteria 12354
359 Ga0501080_0094003 3300049742 Bacteria 2784
360 Ga0501080_0103657 3300049742 Bacteria 2638
361 Ga0501080_0147848 3300049742 Bacteria 2172
362 Ga0501081_0000330 3300049743 Bacteria 25438
363 Ga0501081_0036977 3300049743 Bacteria 3330
364 Ga0501081_0043612 3300049743 Bacteria 3077
365 Ga0501081_0145885 3300049743 Bacteria 1698
366 Ga0501081_0159745 3300049743 Bacteria 1623
367 Ga0501083_0043456 3300049744 Bacteria 3044
368 Ga0501083_0205754 3300049744 Bacteria 1283
369 Ga0501083_0861703 3300049744 Bacteria 589
370 Ga0501035_0019284 3300049822 Bacteria 6277
371 Ga0501035_0333536 3300049822 Bacteria 1272
372 Ga0501035_0779206 3300049822 Bacteria 765
373 Ga0501035_0981931 3300049822 Bacteria 665
374 Ga0501044_0177160 3300049823 Bacteria 2101
375 Ga0501045_0010957 3300049824 Bacteria 6350
376 Ga0501045_0040435 3300049824 Bacteria 3393
377 Ga0501045_0053960 3300049824 Bacteria 2938
378 Ga0501045_0097205 3300049824 Bacteria 2178
379 Ga0501045_0224118 3300049824 Bacteria 1399
380 nmdc:mga0yw44_20588_c1 3300050492 Bacteria 3664
381 nmdc:mga0yw44_619660_c1 3300050492 Bacteria 735
382 nmdc:mga06z11_237703_c1 3300050494 Bacteria 1069
383 nmdc:mga05p37_1502202_c1 3300050507 Bacteria 671
384 nmdc:mga05p37_1546737_c1 3300050507 Bacteria 657
385 nmdc:mga05p37_648675_c1 3300050507 Bacteria 1183
386 nmdc:mga05p37_85119_c1 3300050507 Bacteria 3896
387 nmdc:mga09592_1033445_c1 3300050508 Bacteria 686
388 nmdc:mga09592_46537_c1 3300050508 Bacteria 3655
389 nmdc:mga0qj67_118329_c1 3300050509 Bacteria 2142
390 nmdc:mga0qj67_1410416_c1 3300050509 Bacteria 537
391 nmdc:mga0qj67_307256_c1 3300050509 Bacteria 1285
392 nmdc:mga0qj67_476906_c1 3300050509 Bacteria 1004
393 nmdc:mga06r32_315104_c1 3300050510 Bacteria 1550
394 nmdc:mga06r32_436485_c1 3300050510 Bacteria 1290
395 nmdc:mga06r32_7420_c1 3300050510 Bacteria 9864
396 nmdc:mga08y16_1015857_c1 3300050511 Bacteria 808
397 nmdc:mga08y16_1195531_c1 3300050511 Bacteria 731
398 nmdc:mga08y16_19014_c1 3300050511 Bacteria 7235
399 nmdc:mga08y16_264188_c1 3300050511 Bacteria 1777
400 nmdc:mga0n895_351886_c1 3300050512 Bacteria 1492
401 nmdc:mga0rr50_673466_c1 3300050513 Unclassified 883
402 nmdc:mga0a205_179604_c1 3300050515 Bacteria 2011
403 nmdc:mga0a205_329933_c1 3300050515 Bacteria 1395
404 nmdc:mga0a205_610540_c1 3300050515 Bacteria 943
405 Ga0501084_0001188 3300054114 Bacteria 20375
406 Ga0501084_0018070 3300054114 Bacteria 5873
407 Ga0501084_0135174 3300054114 Bacteria 2076
408 Ga0501084_0168700 3300054114 Bacteria 1847
409 Ga0501084_0301037 3300054114 Bacteria 1354
410 Ga0501082_0026490 3300060353 Bacteria 4997
411 Ga0501082_0150601 3300060353 Bacteria 2020
412 Ga0501082_0195116 3300060353 Bacteria 1761
413 Ga0501082_0310367 3300060353 Bacteria 1373
414 Ga0530510_0004814 3300061734 Bacteria 9339
415 Ga0530510_0008034 3300061734 Bacteria 7361
416 Ga0530510_0023368 3300061734 Bacteria 4405
417 Ga0530510_0222632 3300061734 Bacteria 1402
418 Ga0530510_0228929 3300061734 Bacteria 1382
419 Ga0530510_0922993 3300061734 Bacteria 667
420 Ga0501084_0193552
421 Ga0070658_10489181
422 Ga0070676_10454032
423 Ga0070683_100123793
424 Ga0070683_100526598
425 Ga0070683_101407615
426 Ga0070677_10356776
427 Ga0070682_100352744
428 Ga0068868_100377175
429 Ga0068868_100510557
430 Ga0070669_100344428
431 Ga0070675_100180075
432 Ga0070674_100250126
433 Ga0070674_101565158
434 Ga0070709_10475708
435 Ga0070714_100561337
436 Ga0070701_10321202
437 Ga0070705_100073976
438 Ga0070700_100214891
439 Ga0070700_101516903
440 Ga0070694_100499294
441 Ga0070708_100174050
442 Ga0070663_100397385
443 Ga0070663_100728232
444 Ga0070678_100605630
445 Ga0070681_11113512
446 Ga0068867_101319154
447 Ga0070706_100441790
448 Ga0070707_100248616
449 Ga0070707_100277894
450 Ga0070707_100674826
451 Ga0070698_100289332
452 Ga0070698_100851511
453 Ga0070699_100467007
454 Ga0070679_101007434
455 Ga0070684_100099098
456 Ga0070684_100310787
457 Ga0070672_100339564
458 Ga0070696_100036090
459 Ga0070704_100308045
460 Ga0070664_101063278
461 Ga0070664_101299774
462 Ga0068854_100047056
463 Ga0068854_101334153
464 Ga0070702_101789072
465 Ga0068852_101002260
466 Ga0068859_101489804
467 Ga0068864_100220065
468 Ga0068861_100197175
469 Ga0068870_10103666
470 Ga0081455_10115694
471 Ga0081455_10142981
472 Ga0081455_10173632
473 Ga0081455_10982701
474 Ga0081538_10191602
475 Ga0081539_10004624
476 Ga0081539_10047584
477 Ga0075365_10209203
478 Ga0075367_10066916
479 Ga0075367_10239773
480 Ga0075427_10016526
481 Ga0075428_100133141
482 Ga0075430_100026202
483 Ga0075430_100228645
484 Ga0075430_100359280
485 Ga0075433_10400952
486 Ga0075434_100051288
487 Ga0075434_100342225
488 Ga0075429_101195707
489 Ga0068865_101640433
490 Ga0097620_101489774
491 Ga0075435_100733708
492 Ga0111539_10015718
493 Ga0111539_10095041
494 Ga0111539_11697035
495 Ga0111539_11716558
496 Ga0111539_13276804
497 Ga0105245_10136357
498 Ga0105245_10491726
499 Ga0105245_11879111
500 Ga0114129_10056277
501 Ga0114129_10191460
502 Ga0114129_10381215
503 Ga0105241_10312438
504 Ga0105242_10060890
505 Ga0105242_10943414
506 Ga0105237_11240193
507 Ga0105239_10318410
508 Ga0105239_11865670
509 Ga0105246_10074785
510 Ga0105246_10703837
511 Ga0157375_11187625
512 Ga0157375_11484295
513 Ga0157380_10084597
514 Ga0157380_10566508
515 Ga0157377_11077819
516 Ga0157377_11319759
517 Ga0157376_10361925
518 Ga0157376_10633799
519 Ga0157376_12383182
520 Ga0207682_10402457
521 Ga0207688_10408518
522 Ga0207645_10771338
523 Ga0207643_10133966
524 Ga0207705_10491395
525 Ga0207684_10856876
526 Ga0207707_10217398
527 Ga0207693_10002613
528 Ga0207660_10302324
529 Ga0207660_10500741
530 Ga0207649_11419074
531 Ga0207652_10861852
532 Ga0207652_11362206
533 Ga0207646_10218787
534 Ga0207681_11021948
535 Ga0207659_10287077
536 Ga0207687_10456032
537 Ga0207687_10605986
538 Ga0207664_10126436
539 Ga0207686_10599559
540 Ga0207669_10054391
541 Ga0207669_10060517
542 Ga0207704_10310294
543 Ga0207691_10269978
544 Ga0207691_10400932
545 Ga0207661_10023975
546 Ga0207679_11193073
547 Ga0207668_10402349
548 Ga0207640_10901482
549 Ga0207640_12043959
550 Ga0207677_10205868
551 Ga0207677_10310940
552 Ga0207708_10104397
553 Ga0207708_10324197
554 Ga0207708_10682660
555 Ga0207708_11211121
556 Ga0207648_10107420
557 Ga0207648_10268086
558 Ga0207676_12228264
559 Ga0207674_10810949
560 Ga0207675_100006335
561 Ga0207675_101608071
562 Ga0207683_10453103
563 Ga0207698_10425591
564 Ga0207698_11153301
565 Ga0207428_10025594
566 Ga0265319_1005442
567 Ga0265334_10005432
568 Ga0265318_10015417
569 Ga0265336_10055087
570 Ga0265338_10016638
571 Ga0265324_10143456
572 Ga0265330_10025801
573 Ga0265320_10096791
574 Ga0265329_10040364
575 Ga0265339_10309302
576 Ga0265327_10022222
577 Ga0265327_10278498
578 Ga0307408_102522438
579 Ga0265314_10003240
580 Ga0265342_10047098
581 Ga0307405_10373665
582 Ga0307409_100634747
583 Ga0307416_100020165
584 Ga0307416_101343771
585 Ga0307416_101670593
586 Ga0307415_100016319
587 Ga0307415_101285348
588 Ga0373952_0234961
589 Ga0373961_0089325
590 Ga0395899_0023180
591 Ga0395899_0182946
592 Ga0395900_0031744
593 Ga0395900_0123945
594 Ga0395900_0288158
595 Ga0395900_0351873
596 Ga0395898_0032764
597 Ga0395898_0411257
598 Ga0395898_0681708
599 Ga0395905_0186362
600 Ga0395905_0677653
601 Ga0395905_1341772
602 Ga0395901_0235371
603 Ga0395901_0559980
604 Ga0395901_1361526
605 Ga0451793_1288143
606 Ga0451800_0235438
607 Ga0451853_0035796
608 Ga0450920_055897
609 Ga0450907_027019
610 Ga0439434_0170771
611 Ga0451576_0434091
612 Ga0495603_0163979
613 Ga0495603_0573228
614 Ga0495603_0741536
615 Ga0495653_0519108
616 Ga0495653_0918676
617 Ga0495639_0269165
618 Ga0495584_0124007
619 Ga0495596_0069086
620 Ga0495616_0243135
621 Ga0495631_0158968
622 Ga0495644_0078557
623 Ga0495642_0311069
624 Ga0495652_0532486
625 Ga0495587_0455184
626 Ga0495609_0274112
627 Ga0495633_0344150
628 Ga0495633_0493832
629 Ga0495656_0007983
630 Ga0495656_0376015
631 Ga0495656_0419724
632 Ga0495588_0415129
633 Ga0495670_0158352
634 Ga0495670_0263712
635 Ga0495671_0252645
636 Ga0495589_0404933
637 Ga0495581_0182683
638 Ga0495602_0896252
639 Ga0495615_0216370
640 Ga0496100_0385717
641 Ga0496101_0019998
642 Ga0496101_0519697
643 Ga0496102_0008742
644 Ga0496102_0104969
645 Ga0496102_0139102
646 Ga0496103_0575073
647 Ga0496104_0438599
648 Ga0496104_1685547
649 Ga0496105_0216719
650 Ga0496105_0220285
651 Ga0496105_0487349
652 Ga0496107_0107075
653 Ga0496108_0344666
654 Ga0496108_0907905
655 Ga0496109_0013648
656 Ga0496109_0117676
657 Ga0496109_0536002
658 Ga0496110_0159163
659 Ga0496111_0019191
660 Ga0496111_0773250
661 Ga0496111_1353151
662 Ga0496112_0018488
663 Ga0496113_0457560
664 Ga0496113_1191631
665 Ga0496114_0863354
666 Ga0496114_1419087
667 Ga0496115_0004429
668 Ga0501031_0001620
669 Ga0501031_0002892
670 Ga0501031_0010436
671 Ga0501031_0223935
672 Ga0501031_0400988
673 Ga0501032_0023403
674 Ga0501033_0031325
675 Ga0501033_0280424
676 Ga0501033_0359519
677 Ga0501033_0378468
678 Ga0501033_0590529
679 Ga0501034_0297909
680 Ga0501034_0333618
681 Ga0501034_1004008
682 Ga0501036_0004360
683 Ga0501036_0024038
684 Ga0501036_0227496
685 Ga0501036_0548680
686 Ga0501037_0036134
687 Ga0501037_0096260
688 Ga0501038_0045250
689 Ga0501038_0088994
690 Ga0501038_0209314
691 Ga0501038_1316488
692 Ga0501039_0000567
693 Ga0501039_0198960
694 Ga0501039_0247935
695 Ga0501039_0267554
696 Ga0501040_0011573
697 Ga0501040_0061944
698 Ga0501040_0078026
699 Ga0501040_0089924
700 Ga0501040_0867766
701 Ga0501041_0002239
702 Ga0501041_0007726
703 Ga0501041_0055015
704 Ga0501041_0075451
705 Ga0501041_0164711
706 Ga0501042_0022674
707 Ga0501042_0079347
708 Ga0501042_0126065
709 Ga0501042_0273969
710 Ga0501042_0345072
711 Ga0501043_0001426
712 Ga0501043_0104233
713 Ga0501043_0232040
714 Ga0501043_0368840
715 Ga0501046_0030187
716 Ga0501046_0032993
717 Ga0501046_0078932
718 Ga0501046_0416756
719 Ga0501048_0007526
720 Ga0501048_0049075
721 Ga0501048_0053598
722 Ga0501048_1167969
723 Ga0501067_0017470
724 Ga0501067_0078813
725 Ga0501068_0000470
726 Ga0501068_0037630
727 Ga0501068_0288941
728 Ga0501068_0704860
729 Ga0501069_0004231
730 Ga0501069_0031129
731 Ga0501069_0054810
732 Ga0501069_0142807
733 Ga0501069_0300398
734 Ga0501070_0001965
735 Ga0501070_0097331
736 Ga0501070_0450078
737 Ga0501070_0546606
738 Ga0501071_0000103
739 Ga0501071_0039774
740 Ga0501071_0068939
741 Ga0501071_0300891
742 Ga0501071_0415768
743 Ga0501072_0005251
744 Ga0501072_0023845
745 Ga0501072_0031025
746 Ga0501072_0253063
747 Ga0501072_0259722
748 Ga0501073_0061844
749 Ga0501073_0140354
750 Ga0501073_1063337
751 Ga0501074_0006459
752 Ga0501074_0017426
753 Ga0501074_0019019
754 Ga0501074_0237598
755 Ga0501075_0002149
756 Ga0501075_0064856
757 Ga0501075_0152684
758 Ga0501075_0233458
759 Ga0501075_0239715
760 Ga0501075_0453323
761 Ga0501075_0502476
762 Ga0501076_0001231
763 Ga0501076_0004640
764 Ga0501076_0080377
765 Ga0501076_0266498
766 Ga0501076_0273816
767 Ga0501076_1421460
768 Ga0501077_0018582
769 Ga0501077_0035359
770 Ga0501077_0157805
771 Ga0501077_0176768
772 Ga0501077_0205693
773 Ga0501079_0003189
774 Ga0501079_0169855
775 Ga0501079_0244353
776 Ga0501079_0251081
777 Ga0501080_0004556
778 Ga0501080_0094003
779 Ga0501080_0103657
780 Ga0501080_0147848
781 Ga0501081_0000330
782 Ga0501081_0036977
783 Ga0501081_0043612
784 Ga0501081_0145885
785 Ga0501081_0159745
786 Ga0501083_0043456
787 Ga0501083_0205754
788 Ga0501083_0861703
789 Ga0501035_0019284
790 Ga0501035_0333536
791 Ga0501035_0779206
792 Ga0501035_0981931
793 Ga0501044_0177160
794 Ga0501045_0010957
795 Ga0501045_0040435
796 Ga0501045_0053960
797 Ga0501045_0097205
798 Ga0501045_0224118
799 nmdc:mga0yw44_20588_c1
800 nmdc:mga0yw44_619660_c1
801 nmdc:mga06z11_237703_c1
802 nmdc:mga05p37_1502202_c1
803 nmdc:mga05p37_1546737_c1
804 nmdc:mga05p37_648675_c1
805 nmdc:mga05p37_85119_c1
806 nmdc:mga09592_1033445_c1
807 nmdc:mga09592_46537_c1
808 nmdc:mga0qj67_118329_c1
809 nmdc:mga0qj67_1410416_c1
810 nmdc:mga0qj67_307256_c1
811 nmdc:mga0qj67_476906_c1
812 nmdc:mga06r32_315104_c1
813 nmdc:mga06r32_436485_c1
814 nmdc:mga06r32_7420_c1
815 nmdc:mga08y16_1015857_c1
816 nmdc:mga08y16_1195531_c1
817 nmdc:mga08y16_19014_c1
818 nmdc:mga08y16_264188_c1
819 nmdc:mga0n895_351886_c1
820 nmdc:mga0rr50_673466_c1
821 nmdc:mga0a205_179604_c1
822 nmdc:mga0a205_329933_c1
823 nmdc:mga0a205_610540_c1
824 Ga0501084_0001188
825 Ga0501084_0018070
826 Ga0501084_0135174
827 Ga0501084_0168700
828 Ga0501084_0301037
829 Ga0501082_0026490
830 Ga0501082_0150601
831 Ga0501082_0195116
832 Ga0501082_0310367
833 Ga0530510_0004814
834 Ga0530510_0008034
835 Ga0530510_0023368
836 Ga0530510_0222632
837 Ga0530510_0228929
838 Ga0530510_0922993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

23

145

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y7k-assembly1.cif.gz_D structure of an archaeal mechanosensitive channel in closed state 0.6057 17 108
2oar-assembly1.cif.gz_A mechanosensitive channel of large conductance (mscl) 0.5524 15 110
6ctd-assembly2.cif.gz_I c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.5501 17 105
6ctd-assembly2.cif.gz_H c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.55 16 105
6ctd-assembly1.cif.gz_D c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.545 16 105
ID Description Score Start End Superfamily
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.6072 15 109 1.10.1200.120
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5929 15 109 1.10.1200.120
af_E9AGR5_12_199_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.5545 65 105 1.20.1540.10
af_O45803_9_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5507 67 112 1.20.1070.10
2oarD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5445 15 110 1.10.1200.120
ID Description Score Start End GO Terms
AF-A0A3D5DX88-F1-model_v4 Large conductance mechanosensitive channel protein MscL 0.8028 17 114 GO:0005886
GO:0008381
AF-A0A177Q397-F1-model_v4 Large-conductance mechanosensitive channel 0.7977 16 115 GO:0005886
GO:0008381
AF-A0A2E0WAR4-F1-model_v4 Large-conductance mechanosensitive channel 0.7941 15 116 GO:0005886
GO:0008381
AF-A0A2W6DGD5-F1-model_v4 Large conductance mechanosensitive channel protein MscL 0.792 16 111 GO:0005886
GO:0008381
AF-A0A7Y1VHX2-F1-model_v4 Large-conductance mechanosensitive channel 0.7815 15 109 GO:0005886
GO:0008381

Map