F439481

General Info

Members Datasets Scaffolds Average Seq Length
419 225 838 188

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100038931|Ga0070707_1000389312
Length 221
Sequence MRVIAGSAGGIRLAVPKRGVRPTMDRVKAAIFSSLGDAVIGARVLDLFAGSGGLGIEALSRGASSAVFVENDRQSAEAIDANLAKTKLNGRVRHQDVFDFLRYAAGVEAAVPAAGRLAQAPPQQQIIEKFTIIFADPPYEKAEAVESFTEKLLTNEALAQLLETDGIFVLEKRPDEVLPEMKLWRMVRRKRYGATEVLLVSAVRKEFTRRSLGEGGQTAIQ

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.73
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 17.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100038931 3300005468 Bacteria 4543
2 SwRhRL2b_contig_3868829 2162886007 Bacteria 929
3 CNXas_1000232 3300000545 Bacteria 6846
4 JGI24743J22301_10013879 3300001991 Bacteria 1481
5 JGI24035J26624_1003681 3300002126 Bacteria 1449
6 JGI24035J26624_1005540 3300002126 Unclassified 1211
7 JGI25406J46586_10000071 3300003203 Bacteria 46225
8 JGI25405J52794_10001890 3300003911 Bacteria 3535
9 JGI25405J52794_10011072 3300003911 Bacteria 1723
10 JGI25405J52794_10022853 3300003911 Unclassified 1270
11 Ga0065704_10015579 3300005289 Bacteria 1896
12 Ga0065704_10079293 3300005289 Bacteria 4202
13 Ga0065704_10153123 3300005289 Bacteria 1413
14 Ga0065712_10001577 3300005290 Bacteria 9242
15 Ga0065715_10000579 3300005293 Bacteria 15458
16 Ga0065715_10003307 3300005293 Bacteria 6005
17 Ga0065715_10146447 3300005293 Unclassified 1778
18 Ga0065715_10220392 3300005293 Bacteria 1274
19 Ga0065707_10146870 3300005295 Bacteria 1703
20 Ga0065707_10192199 3300005295 Bacteria 1355
21 Ga0070658_10567993 3300005327 Bacteria 982
22 Ga0070676_10000548 3300005328 Bacteria 18206
23 Ga0070683_100003999 3300005329 Bacteria 12074
24 Ga0070690_100059857 3300005330 Bacteria 2449
25 Ga0070690_100070005 3300005330 Bacteria 2277
26 Ga0070670_100413451 3300005331 Unclassified 1192
27 Ga0068869_100792198 3300005334 Unclassified 814
28 Ga0070666_10151212 3300005335 Bacteria 1619
29 Ga0070680_100064177 3300005336 Bacteria 3010
30 Ga0070682_100104408 3300005337 Bacteria 1877
31 Ga0068868_100169278 3300005338 Bacteria 1808
32 Ga0068868_100871410 3300005338 Bacteria 817
33 Ga0070660_100030191 3300005339 Bacteria 4065
34 Ga0070660_100282672 3300005339 Bacteria 1358
35 Ga0070660_100317256 3300005339 Bacteria 1280
36 Ga0070689_100001974 3300005340 Bacteria 13304
37 Ga0070689_100163171 3300005340 Bacteria 1802
38 Ga0070689_100319334 3300005340 Unclassified 1296
39 Ga0070687_100007195 3300005343 Unclassified 4619
40 Ga0070687_100068475 3300005343 Unclassified 1898
41 Ga0070687_100308886 3300005343 Bacteria 1006
42 Ga0070661_100178768 3300005344 Bacteria 1614
43 Ga0070668_100005968 3300005347 Bacteria 9034
44 Ga0070668_100104711 3300005347 Unclassified 2246
45 Ga0070669_100002334 3300005353 Bacteria 13715
46 Ga0070675_100004733 3300005354 Bacteria 10390
47 Ga0070675_100004919 3300005354 Bacteria 10188
48 Ga0070675_100146904 3300005354 Bacteria 2019
49 Ga0070675_100174917 3300005354 Bacteria 1853
50 Ga0070671_100128076 3300005355 Bacteria 2137
51 Ga0070671_100610751 3300005355 Unclassified 943
52 Ga0070674_100553049 3300005356 Bacteria 966
53 Ga0070674_100635560 3300005356 Bacteria 906
54 Ga0070673_100032241 3300005364 Bacteria 3942
55 Ga0070688_100008653 3300005365 Bacteria 5538
56 Ga0070688_100012096 3300005365 Bacteria 4822
57 Ga0070688_100032874 3300005365 Bacteria 3132
58 Ga0070659_100001682 3300005366 Bacteria 15902
59 Ga0070659_100080855 3300005366 Bacteria 2595
60 Ga0070659_100182919 3300005366 Unclassified 1721
61 Ga0070667_100005183 3300005367 Bacteria 10895
62 Ga0070667_100341168 3300005367 Bacteria 1355
63 Ga0070667_100804610 3300005367 Unclassified 873
64 Ga0070709_10004014 3300005434 Bacteria 7941
65 Ga0070709_10086345 3300005434 Bacteria 2059
66 Ga0070714_100025105 3300005435 Bacteria 4916
67 Ga0070714_100150869 3300005435 Bacteria 2094
68 Ga0070713_100175165 3300005436 Unclassified 1924
69 Ga0070710_10014948 3300005437 Bacteria 3917
70 Ga0070710_10063372 3300005437 Unclassified 2112
71 Ga0070711_100040941 3300005439 Bacteria 3127
72 Ga0070711_100479123 3300005439 Bacteria 1023
73 Ga0070705_100035681 3300005440 Bacteria 2789
74 Ga0070700_100053126 3300005441 Bacteria 2528
75 Ga0070694_100107283 3300005444 Unclassified 1985
76 Ga0070708_100027353 3300005445 Bacteria 4893
77 Ga0070708_100067022 3300005445 Bacteria 3222
78 Ga0070708_100102004 3300005445 Bacteria 2629
79 Ga0070663_100070519 3300005455 Bacteria 2541
80 Ga0070663_100668266 3300005455 Bacteria 880
81 Ga0070678_100059952 3300005456 Bacteria 2799
82 Ga0070678_100282327 3300005456 Bacteria 1405
83 Ga0070662_100000885 3300005457 Bacteria 18309
84 Ga0070662_100615133 3300005457 Bacteria 914
85 Ga0070685_10016765 3300005466 Bacteria 3908
86 Ga0070706_100026711 3300005467 Bacteria 5311
87 Ga0070706_100076065 3300005467 Bacteria 3108
88 Ga0070706_100101502 3300005467 Bacteria 2674
89 Ga0070706_100392666 3300005467 Bacteria 1291
90 Ga0070707_100000673 3300005468 Bacteria 33923
91 Ga0070707_100036110 3300005468 Bacteria 4715
92 Ga0070707_100047788 3300005468 Unclassified 4097
93 Ga0070707_100103974 3300005468 Bacteria 2752
94 Ga0070707_100161149 3300005468 Bacteria 2186
95 Ga0070698_100006651 3300005471 Bacteria 12535
96 Ga0070698_100020471 3300005471 Bacteria 6935
97 Ga0070679_100211360 3300005530 Unclassified 1904
98 Ga0070684_100002179 3300005535 Bacteria 14464
99 Ga0070684_100083675 3300005535 Bacteria 2828
100 Ga0070684_100328042 3300005535 Bacteria 1406
101 Ga0070684_100558682 3300005535 Bacteria 1062
102 Ga0070697_100004236 3300005536 Bacteria 10992
103 Ga0070697_100009557 3300005536 Bacteria 7572
104 Ga0070697_100037916 3300005536 Bacteria 3893
105 Ga0070697_100059869 3300005536 Bacteria 3103
106 Ga0070697_100729583 3300005536 Bacteria 875
107 Ga0070672_100167086 3300005543 Bacteria 1828
108 Ga0070695_100020488 3300005545 Bacteria 4039
109 Ga0070696_100504583 3300005546 Unclassified 963
110 Ga0070693_100649554 3300005547 Bacteria 767
111 Ga0070665_100032764 3300005548 Bacteria 5228
112 Ga0070665_100049214 3300005548 Bacteria 4229
113 Ga0070665_100318447 3300005548 Unclassified 1559
114 Ga0070665_100383248 3300005548 Unclassified 1413
115 Ga0070665_100946835 3300005548 Bacteria 874
116 Ga0068855_100313901 3300005563 Bacteria 1734
117 Ga0070664_100035415 3300005564 Bacteria 4191
118 Ga0070664_100119264 3300005564 Bacteria 2308
119 Ga0068857_100150522 3300005577 Bacteria 2108
120 Ga0068856_100031619 3300005614 Bacteria 5179
121 Ga0070702_100053800 3300005615 Bacteria 2314
122 Ga0068852_100567239 3300005616 Unclassified 1137
123 Ga0068864_100161175 3300005618 Bacteria 2039
124 Ga0068861_100052367 3300005719 Bacteria 3102
125 Ga0068863_100062708 3300005841 Bacteria 3515
126 Ga0068863_100353914 3300005841 Bacteria 1430
127 Ga0068858_100009255 3300005842 Bacteria 9408
128 Ga0068860_100032211 3300005843 Bacteria 5038
129 Ga0068860_100369223 3300005843 Bacteria 1415
130 Ga0081455_10000517 3300005937 Bacteria 50023
131 Ga0081455_10001023 3300005937 Bacteria 35256
132 Ga0081455_10008472 3300005937 Bacteria 10691
133 Ga0081455_10018757 3300005937 Bacteria 6566
134 Ga0081455_10072343 3300005937 Bacteria 2855
135 Ga0081455_10111522 3300005937 Bacteria 2173
136 Ga0081455_10346791 3300005937 Unclassified 1049
137 Ga0081455_10381817 3300005937 Unclassified 984
138 Ga0081540_1016799 3300005983 Unclassified 4561
139 Ga0081539_10000026 3300005985 Bacteria 330830
140 Ga0081539_10003337 3300005985 Bacteria 19955
141 Ga0081539_10036572 3300005985 Bacteria 2937
142 Ga0081539_10093690 3300005985 Bacteria 1546
143 Ga0070717_10013023 3300006028 Bacteria 6355
144 Ga0070717_10274834 3300006028 Unclassified 1493
145 Ga0070717_10496755 3300006028 Unclassified 1102
146 Ga0070716_100120259 3300006173 Bacteria 1643
147 Ga0070716_100380457 3300006173 Bacteria 1009
148 Ga0070712_100015471 3300006175 Unclassified 4916
149 Ga0070712_100074940 3300006175 Bacteria 2432
150 Ga0070712_100371965 3300006175 Bacteria 1174
151 Ga0070712_100427782 3300006175 Unclassified 1098
152 Ga0097621_100806082 3300006237 Unclassified 870
153 Ga0068871_100175763 3300006358 Bacteria 1838
154 Ga0068871_101134714 3300006358 Bacteria 732
155 Ga0068865_100221645 3300006881 Unclassified 1479
156 Ga0099794_10154010 3300007265 Unclassified 1167
157 Ga0099795_10102763 3300007788 Bacteria 1123
158 Ga0105245_10162301 3300009098 Bacteria 2121
159 Ga0105245_10498513 3300009098 Bacteria 1234
160 Ga0105245_11285289 3300009098 Bacteria 780
161 Ga0105247_10314977 3300009101 Bacteria 1090
162 Ga0105237_10089696 3300009545 Bacteria 3064
163 Ga0105249_10001542 3300009553 Bacteria 20224
164 Ga0105249_10020485 3300009553 Bacteria 5911
165 Ga0105249_10155347 3300009553 Bacteria 2206
166 Ga0105249_10243365 3300009553 Unclassified 1779
167 Ga0105249_12649468 3300009553 Unclassified 573
168 Ga0099796_10126163 3300010159 Bacteria 988
169 Ga0105239_10026364 3300010375 Bacteria 6396
170 Ga0105239_10051274 3300010375 Bacteria 4524
171 Ga0105239_10111092 3300010375 Bacteria 3038
172 Ga0105239_10352196 3300010375 Unclassified 1662
173 Ga0105239_10568355 3300010375 Unclassified 1292
174 Ga0105246_10311942 3300011119 Bacteria 1274
175 Ga0105246_10497734 3300011119 Bacteria 1034
176 Ga0157373_10580278 3300013100 Bacteria 815
177 Ga0157369_10015937 3300013105 Bacteria 8459
178 Ga0157374_10034571 3300013296 Bacteria 4618
179 Ga0157374_10077873 3300013296 Bacteria 3139
180 Ga0157374_10835909 3300013296 Bacteria 937
181 Ga0157374_11258022 3300013296 Bacteria 762
182 Ga0157378_10005615 3300013297 Bacteria 10989
183 Ga0157378_10013810 3300013297 Bacteria 7062
184 Ga0157378_10015675 3300013297 Bacteria 6636
185 Ga0157378_10074882 3300013297 Unclassified 3047
186 Ga0157378_10109557 3300013297 Bacteria 2530
187 Ga0157378_10215808 3300013297 Unclassified 1821
188 Ga0157378_10291096 3300013297 Bacteria 1577
189 Ga0157378_10358769 3300013297 Bacteria 1426
190 Ga0157378_10501036 3300013297 Bacteria 1213
191 Ga0157378_11087066 3300013297 Bacteria 836
192 Ga0163162_10024039 3300013306 Bacteria 6012
193 Ga0163162_10316043 3300013306 Unclassified 1694
194 Ga0163162_10361424 3300013306 Unclassified 1585
195 Ga0163162_10953596 3300013306 Unclassified 969
196 Ga0157372_10023379 3300013307 Bacteria 6700
197 Ga0157372_10181903 3300013307 Bacteria 2434
198 Ga0157375_10006962 3300013308 Bacteria 9873
199 Ga0157375_10038990 3300013308 Bacteria 4567
200 Ga0157375_10403002 3300013308 Bacteria 1534
201 Ga0157375_11566969 3300013308 Bacteria 778
202 Ga0163163_10076185 3300014325 Bacteria 3349
203 Ga0163163_10795713 3300014325 Bacteria 1009
204 Ga0157377_10160695 3300014745 Bacteria 1397
205 Ga0157377_10263864 3300014745 Unclassified 1122
206 Ga0157379_10029158 3300014968 Bacteria 4908
207 Ga0157376_10018811 3300014969 Bacteria 5308
208 Ga0157376_10461086 3300014969 Bacteria 1242
209 Ga0157376_10561149 3300014969 Bacteria 1131
210 Ga0207666_1006236 3300025271 Bacteria 1542
211 Ga0207666_1008809 3300025271 Unclassified 1353
212 Ga0207666_1011003 3300025271 Bacteria 1246
213 Ga0207673_1000864 3300025290 Unclassified 3243
214 Ga0207673_1009242 3300025290 Bacteria 1257
215 Ga0207697_10000012 3300025315 Bacteria 62443
216 Ga0207697_10001954 3300025315 Bacteria 10956
217 Ga0207697_10014877 3300025315 Bacteria 3222
218 Ga0207697_10023201 3300025315 Unclassified 2540
219 Ga0207697_10098666 3300025315 Bacteria 1244
220 Ga0207697_10185330 3300025315 Bacteria 913
221 Ga0207692_10007412 3300025898 Bacteria 4500
222 Ga0207692_10154878 3300025898 Bacteria 1315
223 Ga0207688_10190868 3300025901 Unclassified 1225
224 Ga0207680_10157370 3300025903 Bacteria 1520
225 Ga0207680_10431128 3300025903 Bacteria 934
226 Ga0207680_10618531 3300025903 Bacteria 775
227 Ga0207647_10003606 3300025904 Bacteria 11589
228 Ga0207699_10058298 3300025906 Bacteria 2309
229 Ga0207645_10000363 3300025907 Bacteria 37541
230 Ga0207645_10049236 3300025907 Unclassified 2691
231 Ga0207645_10220965 3300025907 Bacteria 1249
232 Ga0207684_10027578 3300025910 Bacteria 4837
233 Ga0207684_10101025 3300025910 Unclassified 2465
234 Ga0207684_10107680 3300025910 Bacteria 2385
235 Ga0207684_10124553 3300025910 Bacteria 2211
236 Ga0207684_10506007 3300025910 Unclassified 1035
237 Ga0207707_10793739 3300025912 Bacteria 789
238 Ga0207693_10005451 3300025915 Bacteria 10610
239 Ga0207693_10070676 3300025915 Bacteria 2731
240 Ga0207693_10084163 3300025915 Bacteria 2492
241 Ga0207693_10089331 3300025915 Bacteria 2414
242 Ga0207693_10252817 3300025915 Archaea 1383
243 Ga0207693_10429587 3300025915 Bacteria 1033
244 Ga0207693_10541687 3300025915 Bacteria 908
245 Ga0207663_10014166 3300025916 Bacteria 4358
246 Ga0207663_10084598 3300025916 Bacteria 2086
247 Ga0207660_10087214 3300025917 Bacteria 2305
248 Ga0207662_10000175 3300025918 Bacteria 30539
249 Ga0207662_10062727 3300025918 Bacteria 2234
250 Ga0207657_10238629 3300025919 Bacteria 1452
251 Ga0207649_10314170 3300025920 Bacteria 1149
252 Ga0207652_10277822 3300025921 Bacteria 1511
253 Ga0207652_10687857 3300025921 Bacteria 913
254 Ga0207646_10000590 3300025922 Bacteria 47383
255 Ga0207646_10029324 3300025922 Bacteria 5003
256 Ga0207646_10120673 3300025922 Bacteria 2355
257 Ga0207646_10133054 3300025922 Bacteria 2239
258 Ga0207646_10177420 3300025922 Bacteria 1924
259 Ga0207681_10320669 3300025923 Unclassified 1232
260 Ga0207681_10415832 3300025923 Bacteria 1088
261 Ga0207650_10311321 3300025925 Bacteria 1288
262 Ga0207659_10146135 3300025926 Bacteria 1841
263 Ga0207659_10783688 3300025926 Bacteria 819
264 Ga0207687_10225283 3300025927 Bacteria 1478
265 Ga0207687_10726405 3300025927 Bacteria 844
266 Ga0207700_10020272 3300025928 Bacteria 4511
267 Ga0207664_10062480 3300025929 Bacteria 2974
268 Ga0207664_10099477 3300025929 Bacteria 2400
269 Ga0207664_10174187 3300025929 Bacteria 1843
270 Ga0207644_10174509 3300025931 Bacteria 1680
271 Ga0207690_10008556 3300025932 Bacteria 6072
272 Ga0207690_10059640 3300025932 Bacteria 2586
273 Ga0207690_10223079 3300025932 Unclassified 1443
274 Ga0207706_10000319 3300025933 Bacteria 52048
275 Ga0207706_10106969 3300025933 Unclassified 2461
276 Ga0207670_10002432 3300025936 Bacteria 9768
277 Ga0207670_10046323 3300025936 Bacteria 2888
278 Ga0207670_10831458 3300025936 Bacteria 771
279 Ga0207704_10277252 3300025938 Bacteria 1273
280 Ga0207665_10052606 3300025939 Bacteria 2744
281 Ga0207665_10087506 3300025939 Bacteria 2153
282 Ga0207665_10116375 3300025939 Unclassified 1884
283 Ga0207691_10091868 3300025940 Bacteria 2719
284 Ga0207691_10180727 3300025940 Bacteria 1843
285 Ga0207689_10118420 3300025942 Bacteria 2178
286 Ga0207661_10002670 3300025944 Bacteria 12269
287 Ga0207661_10379395 3300025944 Bacteria 1279
288 Ga0207679_10064836 3300025945 Bacteria 2732
289 Ga0207679_10952189 3300025945 Bacteria 786
290 Ga0207651_10179226 3300025960 Bacteria 1679
291 Ga0207712_10009557 3300025961 Bacteria 6137
292 Ga0207712_10146725 3300025961 Unclassified 1817
293 Ga0207668_10160214 3300025972 Bacteria 1752
294 Ga0207658_10226797 3300025986 Bacteria 1575
295 Ga0207658_10239234 3300025986 Bacteria 1537
296 Ga0207677_10031380 3300026023 Bacteria 3403
297 Ga0207677_10974667 3300026023 Bacteria 768
298 Ga0207677_11096222 3300026023 Bacteria 726
299 Ga0207703_10006716 3300026035 Bacteria 9181
300 Ga0207703_10230030 3300026035 Unclassified 1662
301 Ga0207678_10001543 3300026067 Bacteria 21125
302 Ga0207678_10581928 3300026067 Bacteria 981
303 Ga0207708_10088226 3300026075 Bacteria 2389
304 Ga0207702_10076751 3300026078 Bacteria 2888
305 Ga0207676_10144879 3300026095 Bacteria 2039
306 Ga0207674_10451935 3300026116 Bacteria 1242
307 Ga0207675_100017226 3300026118 Bacteria 6746
308 Ga0207683_10020550 3300026121 Bacteria 5649
309 Ga0210002_1007902 3300027617 Bacteria 1616
310 Ga0209974_10084824 3300027876 Bacteria 1094
311 Ga0268266_10017239 3300028379 Bacteria 6167
312 Ga0268266_10596102 3300028379 Bacteria 1061
313 Ga0268265_10060258 3300028380 Bacteria 2908
314 Ga0268264_10030963 3300028381 Bacteria 4387
315 Ga0373926_0067780 3300035083 Bacteria 1308
316 Ga0373936_0081595 3300035113 Bacteria 1347
317 Ga0373954_0150033 3300035118 Bacteria 1139
318 Ga0373960_0122620 3300035121 Bacteria 864
319 Ga0373943_0330944 3300035170 Bacteria 870
320 Ga0373943_0432761 3300035170 Bacteria 763
321 Ga0373955_0124070 3300035172 Bacteria 1503
322 Ga0373924_0498335 3300035410 Bacteria 547
323 Ga0373935_0002008 3300035692 Bacteria 11477
324 Ga0373935_0060589 3300035692 Bacteria 2421
325 Ga0373935_0079956 3300035692 Bacteria 2123
326 Ga0373935_0966155 3300035692 Bacteria 632
327 Ga0373927_0125718 3300035695 Bacteria 1674
328 Ga0373933_0567226 3300035724 Bacteria 745
329 Ga0373947_0265673 3300035725 Bacteria 1138
330 Ga0373947_0562706 3300035725 Bacteria 776
331 Ga0373937_0099945 3300036401 Bacteria 2691
332 Ga0395900_0015539 3300037418 Bacteria 7759
333 Ga0395900_0182633 3300037418 Bacteria 2131
334 Ga0395900_0186743 3300037418 Bacteria 2104
335 Ga0395898_0002564 3300037466 Bacteria 21295
336 Ga0395905_0816608 3300037471 Unclassified 835
337 Ga0395901_0000662 3300038443 Bacteria 39642
338 Ga0395901_0606177 3300038443 Unclassified 1104
339 Ga0439458_0063576 3300042157 Unclassified 924
340 Ga0451576_0700195 3300045051 Bacteria 1064
341 Ga0495592_0001180 3300046454 Bacteria 18116
342 Ga0495603_0110273 3300046455 Bacteria 1605
343 Ga0495629_0057199 3300046459 Bacteria 2727
344 Ga0495629_0412635 3300046459 Bacteria 917
345 Ga0495629_0695538 3300046459 Bacteria 675
346 Ga0495641_0060349 3300046461 Bacteria 1714
347 Ga0495641_0444401 3300046461 Bacteria 590
348 Ga0495653_0166153 3300046463 Bacteria 1527
349 Ga0495580_0331321 3300046472 Unclassified 1034
350 Ga0495582_0163059 3300046473 Bacteria 1268
351 Ga0495664_0068889 3300046477 Bacteria 2112
352 Ga0495664_0121205 3300046477 Unclassified 1582
353 Ga0495584_0078812 3300046491 Bacteria 1658
354 Ga0495594_0506136 3300046499 Unclassified 686
355 Ga0495608_0169700 3300046511 Bacteria 1384
356 Ga0495618_0109793 3300046514 Bacteria 1766
357 Ga0495628_0007987 3300046516 Bacteria 9116
358 Ga0495630_0061526 3300046517 Bacteria 2819
359 Ga0495630_0550625 3300046517 Bacteria 884
360 Ga0495652_0008562 3300046529 Bacteria 9329
361 Ga0495665_0193485 3300046531 Bacteria 1055
362 Ga0495640_0230386 3300046533 Bacteria 1165
363 Ga0495640_0440131 3300046533 Bacteria 797
364 Ga0495586_0004897 3300046535 Bacteria 7163
365 Ga0495587_0089200 3300046536 Bacteria 1782
366 Ga0495645_0006532 3300046543 Bacteria 8095
367 Ga0495634_0062315 3300046642 Bacteria 2477
368 Ga0495634_0383139 3300046642 Bacteria 838
369 Ga0495635_0249403 3300046663 Bacteria 1197
370 Ga0495657_0119316 3300046675 Unclassified 1663
371 Ga0495623_0029730 3300046679 Unclassified 3516
372 Ga0495646_0021275 3300046680 Bacteria 4100
373 Ga0495646_0495527 3300046680 Bacteria 628
374 Ga0495647_0013369 3300046681 Bacteria 2844
375 Ga0495669_0089840 3300046684 Bacteria 1417
376 Ga0495624_0075321 3300046690 Bacteria 2096
377 Ga0495649_0393987 3300046694 Unclassified 696
378 Ga0495600_0679304 3300046809 Bacteria 621
379 Ga0495581_0185110 3300047315 Bacteria 1218
380 Ga0495581_0342984 3300047315 Bacteria 872
381 Ga0495674_0126816 3300047319 Unclassified 2152
382 Ga0495680_0349014 3300047322 Bacteria 1031
383 Ga0495680_0424316 3300047322 Bacteria 914
384 Ga0495680_0472246 3300047322 Bacteria 855
385 Ga0495675_0041121 3300047444 Bacteria 2946
386 Ga0495684_0075893 3300047471 Bacteria 2553
387 Ga0496100_0077111 3300048903 Bacteria 2240
388 Ga0496100_0494708 3300048903 Unclassified 942
389 Ga0496101_0046105 3300048904 Bacteria 3125
390 Ga0496101_0118248 3300048904 Bacteria 2002
391 Ga0496102_0087512 3300048905 Bacteria 2878
392 Ga0496102_0506315 3300048905 Unclassified 1130
393 Ga0496102_1143315 3300048905 Unclassified 698
394 Ga0496103_0107251 3300048906 Bacteria 1772
395 Ga0496104_0057625 3300048907 Bacteria 3676
396 Ga0496105_0313662 3300048908 Bacteria 1258
397 Ga0496106_0064921 3300048909 Unclassified 2778
398 Ga0496108_0127419 3300048911 Bacteria 2186
399 Ga0496109_0064092 3300048912 Bacteria 3362
400 Ga0496110_0158153 3300048913 Bacteria 2053
401 Ga0496111_0059081 3300048914 Bacteria 2778
402 Ga0496112_0034900 3300048915 Bacteria 4895
403 Ga0496112_0149485 3300048915 Bacteria 2303
404 Ga0496112_0163069 3300048915 Bacteria 2195
405 Ga0496113_0072684 3300048916 Bacteria 2618
406 Ga0496114_0005101 3300048917 Bacteria 10235
407 Ga0496114_0039784 3300048917 Bacteria 3891
408 Ga0496114_1522845 3300048917 Unclassified 557
409 Ga0496115_0067958 3300048918 Bacteria 2884
410 Ga0496115_0121620 3300048918 Bacteria 2148
411 Ga0501067_0121138 3300049583 Bacteria 1456
412 nmdc:mga05p37_129733_c1 3300050507 Bacteria 3093
413 nmdc:mga05p37_73259_c1 3300050507 Bacteria 3507
414 nmdc:mga05p37_763441_c1 3300050507 Unclassified 1064
415 nmdc:mga08x19_603369_c1 3300050514 Archaea 778
416 nmdc:mga0a205_827969_c1 3300050515 Unclassified 773
417 Ga0495601_0223949 3300053077 Bacteria 1229
418 Ga0495595_0117963 3300053084 Bacteria 1291
419 Ga0495619_0083031 3300053085 Unclassified 2160
420 Ga0070707_100038931
421 SwRhRL2b_contig_3868829
422 CNXas_1000232
423 JGI24743J22301_10013879
424 JGI24035J26624_1003681
425 JGI24035J26624_1005540
426 JGI25406J46586_10000071
427 JGI25405J52794_10001890
428 JGI25405J52794_10011072
429 JGI25405J52794_10022853
430 Ga0065704_10015579
431 Ga0065704_10079293
432 Ga0065704_10153123
433 Ga0065712_10001577
434 Ga0065715_10000579
435 Ga0065715_10003307
436 Ga0065715_10146447
437 Ga0065715_10220392
438 Ga0065707_10146870
439 Ga0065707_10192199
440 Ga0070658_10567993
441 Ga0070676_10000548
442 Ga0070683_100003999
443 Ga0070690_100059857
444 Ga0070690_100070005
445 Ga0070670_100413451
446 Ga0068869_100792198
447 Ga0070666_10151212
448 Ga0070680_100064177
449 Ga0070682_100104408
450 Ga0068868_100169278
451 Ga0068868_100871410
452 Ga0070660_100030191
453 Ga0070660_100282672
454 Ga0070660_100317256
455 Ga0070689_100001974
456 Ga0070689_100163171
457 Ga0070689_100319334
458 Ga0070687_100007195
459 Ga0070687_100068475
460 Ga0070687_100308886
461 Ga0070661_100178768
462 Ga0070668_100005968
463 Ga0070668_100104711
464 Ga0070669_100002334
465 Ga0070675_100004733
466 Ga0070675_100004919
467 Ga0070675_100146904
468 Ga0070675_100174917
469 Ga0070671_100128076
470 Ga0070671_100610751
471 Ga0070674_100553049
472 Ga0070674_100635560
473 Ga0070673_100032241
474 Ga0070688_100008653
475 Ga0070688_100012096
476 Ga0070688_100032874
477 Ga0070659_100001682
478 Ga0070659_100080855
479 Ga0070659_100182919
480 Ga0070667_100005183
481 Ga0070667_100341168
482 Ga0070667_100804610
483 Ga0070709_10004014
484 Ga0070709_10086345
485 Ga0070714_100025105
486 Ga0070714_100150869
487 Ga0070713_100175165
488 Ga0070710_10014948
489 Ga0070710_10063372
490 Ga0070711_100040941
491 Ga0070711_100479123
492 Ga0070705_100035681
493 Ga0070700_100053126
494 Ga0070694_100107283
495 Ga0070708_100027353
496 Ga0070708_100067022
497 Ga0070708_100102004
498 Ga0070663_100070519
499 Ga0070663_100668266
500 Ga0070678_100059952
501 Ga0070678_100282327
502 Ga0070662_100000885
503 Ga0070662_100615133
504 Ga0070685_10016765
505 Ga0070706_100026711
506 Ga0070706_100076065
507 Ga0070706_100101502
508 Ga0070706_100392666
509 Ga0070707_100000673
510 Ga0070707_100036110
511 Ga0070707_100047788
512 Ga0070707_100103974
513 Ga0070707_100161149
514 Ga0070698_100006651
515 Ga0070698_100020471
516 Ga0070679_100211360
517 Ga0070684_100002179
518 Ga0070684_100083675
519 Ga0070684_100328042
520 Ga0070684_100558682
521 Ga0070697_100004236
522 Ga0070697_100009557
523 Ga0070697_100037916
524 Ga0070697_100059869
525 Ga0070697_100729583
526 Ga0070672_100167086
527 Ga0070695_100020488
528 Ga0070696_100504583
529 Ga0070693_100649554
530 Ga0070665_100032764
531 Ga0070665_100049214
532 Ga0070665_100318447
533 Ga0070665_100383248
534 Ga0070665_100946835
535 Ga0068855_100313901
536 Ga0070664_100035415
537 Ga0070664_100119264
538 Ga0068857_100150522
539 Ga0068856_100031619
540 Ga0070702_100053800
541 Ga0068852_100567239
542 Ga0068864_100161175
543 Ga0068861_100052367
544 Ga0068863_100062708
545 Ga0068863_100353914
546 Ga0068858_100009255
547 Ga0068860_100032211
548 Ga0068860_100369223
549 Ga0081455_10000517
550 Ga0081455_10001023
551 Ga0081455_10008472
552 Ga0081455_10018757
553 Ga0081455_10072343
554 Ga0081455_10111522
555 Ga0081455_10346791
556 Ga0081455_10381817
557 Ga0081540_1016799
558 Ga0081539_10000026
559 Ga0081539_10003337
560 Ga0081539_10036572
561 Ga0081539_10093690
562 Ga0070717_10013023
563 Ga0070717_10274834
564 Ga0070717_10496755
565 Ga0070716_100120259
566 Ga0070716_100380457
567 Ga0070712_100015471
568 Ga0070712_100074940
569 Ga0070712_100371965
570 Ga0070712_100427782
571 Ga0097621_100806082
572 Ga0068871_100175763
573 Ga0068871_101134714
574 Ga0068865_100221645
575 Ga0099794_10154010
576 Ga0099795_10102763
577 Ga0105245_10162301
578 Ga0105245_10498513
579 Ga0105245_11285289
580 Ga0105247_10314977
581 Ga0105237_10089696
582 Ga0105249_10001542
583 Ga0105249_10020485
584 Ga0105249_10155347
585 Ga0105249_10243365
586 Ga0105249_12649468
587 Ga0099796_10126163
588 Ga0105239_10026364
589 Ga0105239_10051274
590 Ga0105239_10111092
591 Ga0105239_10352196
592 Ga0105239_10568355
593 Ga0105246_10311942
594 Ga0105246_10497734
595 Ga0157373_10580278
596 Ga0157369_10015937
597 Ga0157374_10034571
598 Ga0157374_10077873
599 Ga0157374_10835909
600 Ga0157374_11258022
601 Ga0157378_10005615
602 Ga0157378_10013810
603 Ga0157378_10015675
604 Ga0157378_10074882
605 Ga0157378_10109557
606 Ga0157378_10215808
607 Ga0157378_10291096
608 Ga0157378_10358769
609 Ga0157378_10501036
610 Ga0157378_11087066
611 Ga0163162_10024039
612 Ga0163162_10316043
613 Ga0163162_10361424
614 Ga0163162_10953596
615 Ga0157372_10023379
616 Ga0157372_10181903
617 Ga0157375_10006962
618 Ga0157375_10038990
619 Ga0157375_10403002
620 Ga0157375_11566969
621 Ga0163163_10076185
622 Ga0163163_10795713
623 Ga0157377_10160695
624 Ga0157377_10263864
625 Ga0157379_10029158
626 Ga0157376_10018811
627 Ga0157376_10461086
628 Ga0157376_10561149
629 Ga0207666_1006236
630 Ga0207666_1008809
631 Ga0207666_1011003
632 Ga0207673_1000864
633 Ga0207673_1009242
634 Ga0207697_10000012
635 Ga0207697_10001954
636 Ga0207697_10014877
637 Ga0207697_10023201
638 Ga0207697_10098666
639 Ga0207697_10185330
640 Ga0207692_10007412
641 Ga0207692_10154878
642 Ga0207688_10190868
643 Ga0207680_10157370
644 Ga0207680_10431128
645 Ga0207680_10618531
646 Ga0207647_10003606
647 Ga0207699_10058298
648 Ga0207645_10000363
649 Ga0207645_10049236
650 Ga0207645_10220965
651 Ga0207684_10027578
652 Ga0207684_10101025
653 Ga0207684_10107680
654 Ga0207684_10124553
655 Ga0207684_10506007
656 Ga0207707_10793739
657 Ga0207693_10005451
658 Ga0207693_10070676
659 Ga0207693_10084163
660 Ga0207693_10089331
661 Ga0207693_10252817
662 Ga0207693_10429587
663 Ga0207693_10541687
664 Ga0207663_10014166
665 Ga0207663_10084598
666 Ga0207660_10087214
667 Ga0207662_10000175
668 Ga0207662_10062727
669 Ga0207657_10238629
670 Ga0207649_10314170
671 Ga0207652_10277822
672 Ga0207652_10687857
673 Ga0207646_10000590
674 Ga0207646_10029324
675 Ga0207646_10120673
676 Ga0207646_10133054
677 Ga0207646_10177420
678 Ga0207681_10320669
679 Ga0207681_10415832
680 Ga0207650_10311321
681 Ga0207659_10146135
682 Ga0207659_10783688
683 Ga0207687_10225283
684 Ga0207687_10726405
685 Ga0207700_10020272
686 Ga0207664_10062480
687 Ga0207664_10099477
688 Ga0207664_10174187
689 Ga0207644_10174509
690 Ga0207690_10008556
691 Ga0207690_10059640
692 Ga0207690_10223079
693 Ga0207706_10000319
694 Ga0207706_10106969
695 Ga0207670_10002432
696 Ga0207670_10046323
697 Ga0207670_10831458
698 Ga0207704_10277252
699 Ga0207665_10052606
700 Ga0207665_10087506
701 Ga0207665_10116375
702 Ga0207691_10091868
703 Ga0207691_10180727
704 Ga0207689_10118420
705 Ga0207661_10002670
706 Ga0207661_10379395
707 Ga0207679_10064836
708 Ga0207679_10952189
709 Ga0207651_10179226
710 Ga0207712_10009557
711 Ga0207712_10146725
712 Ga0207668_10160214
713 Ga0207658_10226797
714 Ga0207658_10239234
715 Ga0207677_10031380
716 Ga0207677_10974667
717 Ga0207677_11096222
718 Ga0207703_10006716
719 Ga0207703_10230030
720 Ga0207678_10001543
721 Ga0207678_10581928
722 Ga0207708_10088226
723 Ga0207702_10076751
724 Ga0207676_10144879
725 Ga0207674_10451935
726 Ga0207675_100017226
727 Ga0207683_10020550
728 Ga0210002_1007902
729 Ga0209974_10084824
730 Ga0268266_10017239
731 Ga0268266_10596102
732 Ga0268265_10060258
733 Ga0268264_10030963
734 Ga0373926_0067780
735 Ga0373936_0081595
736 Ga0373954_0150033
737 Ga0373960_0122620
738 Ga0373943_0330944
739 Ga0373943_0432761
740 Ga0373955_0124070
741 Ga0373924_0498335
742 Ga0373935_0002008
743 Ga0373935_0060589
744 Ga0373935_0079956
745 Ga0373935_0966155
746 Ga0373927_0125718
747 Ga0373933_0567226
748 Ga0373947_0265673
749 Ga0373947_0562706
750 Ga0373937_0099945
751 Ga0395900_0015539
752 Ga0395900_0182633
753 Ga0395900_0186743
754 Ga0395898_0002564
755 Ga0395905_0816608
756 Ga0395901_0000662
757 Ga0395901_0606177
758 Ga0439458_0063576
759 Ga0451576_0700195
760 Ga0495592_0001180
761 Ga0495603_0110273
762 Ga0495629_0057199
763 Ga0495629_0412635
764 Ga0495629_0695538
765 Ga0495641_0060349
766 Ga0495641_0444401
767 Ga0495653_0166153
768 Ga0495580_0331321
769 Ga0495582_0163059
770 Ga0495664_0068889
771 Ga0495664_0121205
772 Ga0495584_0078812
773 Ga0495594_0506136
774 Ga0495608_0169700
775 Ga0495618_0109793
776 Ga0495628_0007987
777 Ga0495630_0061526
778 Ga0495630_0550625
779 Ga0495652_0008562
780 Ga0495665_0193485
781 Ga0495640_0230386
782 Ga0495640_0440131
783 Ga0495586_0004897
784 Ga0495587_0089200
785 Ga0495645_0006532
786 Ga0495634_0062315
787 Ga0495634_0383139
788 Ga0495635_0249403
789 Ga0495657_0119316
790 Ga0495623_0029730
791 Ga0495646_0021275
792 Ga0495646_0495527
793 Ga0495647_0013369
794 Ga0495669_0089840
795 Ga0495624_0075321
796 Ga0495649_0393987
797 Ga0495600_0679304
798 Ga0495581_0185110
799 Ga0495581_0342984
800 Ga0495674_0126816
801 Ga0495680_0349014
802 Ga0495680_0424316
803 Ga0495680_0472246
804 Ga0495675_0041121
805 Ga0495684_0075893
806 Ga0496100_0077111
807 Ga0496100_0494708
808 Ga0496101_0046105
809 Ga0496101_0118248
810 Ga0496102_0087512
811 Ga0496102_0506315
812 Ga0496102_1143315
813 Ga0496103_0107251
814 Ga0496104_0057625
815 Ga0496105_0313662
816 Ga0496106_0064921
817 Ga0496108_0127419
818 Ga0496109_0064092
819 Ga0496110_0158153
820 Ga0496111_0059081
821 Ga0496112_0034900
822 Ga0496112_0149485
823 Ga0496112_0163069
824 Ga0496113_0072684
825 Ga0496114_0005101
826 Ga0496114_0039784
827 Ga0496114_1522845
828 Ga0496115_0067958
829 Ga0496115_0121620
830 Ga0501067_0121138
831 nmdc:mga05p37_129733_c1
832 nmdc:mga05p37_73259_c1
833 nmdc:mga05p37_763441_c1
834 nmdc:mga08x19_603369_c1
835 nmdc:mga0a205_827969_c1
836 Ga0495601_0223949
837 Ga0495595_0117963
838 Ga0495619_0083031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

201

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws6-assembly1.cif.gz_A the structure of thermus thermphillus hb8 hypothetical protein ttha0928 0.8689 1 181
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8626 1 184
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.861 27 180
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8587 1 183
1ws6-assembly1.cif.gz_A the structure of thermus thermphillus hb8 hypothetical protein ttha0928 0.8548 1 181
ID Description Score Start End Superfamily
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8714 24 184 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8661 24 184 3.40.50.150
1ws6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8646 1 181 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8603 1 183 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8601 43 99 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V6DFV5-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9932 110 185 GO:0003676
GO:0008168
GO:0032259
AF-A0A2V5NYJ6-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9925 107 185 GO:0003676
GO:0008168
GO:0032259
AF-A0A2V5NXD5-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9812 68 182 GO:0003676
GO:0008168
GO:0032259
AF-A0A2V6AGD5-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.976 74 185 GO:0003676
GO:0008168
GO:0032259
AF-A0A2V5URF0-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9702 46 185 GO:0003676
GO:0008168
GO:0031167

Map