F439478

General Info

Members Datasets Scaffolds Average Seq Length
419 245 838 85

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100738992|Ga0070708_1007389922
Length 99
Sequence VAEPLRRSAPESAAHSLGGPERTCAGCGRRAPQRELLRFAASDGVLVAGRTKPGRGAYTCRSLACFERAVARGMFARVLRQQVRIGPELRGLYTGDSHG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.17
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 14.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100738992 3300005445 Unclassified 925
2 Ga0070676_10221125 3300005328 Bacteria 1251
3 Ga0070683_100100321 3300005329 Bacteria 2725
4 Ga0070683_100657169 3300005329 Bacteria 1004
5 Ga0070683_100867393 3300005329 Unclassified 866
6 Ga0070683_101282651 3300005329 Bacteria 704
7 Ga0070683_102353475 3300005329 Unclassified 511
8 Ga0070680_100018442 3300005336 Bacteria 5513
9 Ga0070682_100576388 3300005337 Bacteria 885
10 Ga0070682_100585051 3300005337 Bacteria 879
11 Ga0070682_100627131 3300005337 Bacteria 853
12 Ga0068868_100354249 3300005338 Bacteria 1258
13 Ga0068868_100691615 3300005338 Bacteria 912
14 Ga0068868_101613974 3300005338 Bacteria 610
15 Ga0070660_100061889 3300005339 Bacteria 2907
16 Ga0070687_101453709 3300005343 Bacteria 514
17 Ga0070661_100140360 3300005344 Bacteria 1821
18 Ga0070661_100640426 3300005344 Bacteria 862
19 Ga0070661_100943427 3300005344 Unclassified 714
20 Ga0070668_100005894 3300005347 Bacteria 9082
21 Ga0070669_100206534 3300005353 Bacteria 1548
22 Ga0070669_101569315 3300005353 Bacteria 573
23 Ga0070675_100030807 3300005354 Bacteria 4332
24 Ga0070675_100182174 3300005354 Bacteria 1816
25 Ga0070675_100879285 3300005354 Unclassified 821
26 Ga0070674_101166394 3300005356 Bacteria 683
27 Ga0070688_101034821 3300005365 Unclassified 654
28 Ga0070688_101270518 3300005365 Bacteria 593
29 Ga0070659_100523331 3300005366 Bacteria 1013
30 Ga0070659_100918281 3300005366 Unclassified 766
31 Ga0070714_100171967 3300005435 Bacteria 1966
32 Ga0070701_11030621 3300005438 Unclassified 575
33 Ga0070701_11119367 3300005438 Unclassified 555
34 Ga0070711_101616739 3300005439 Archaea 567
35 Ga0070705_100483956 3300005440 Bacteria 936
36 Ga0070694_100076123 3300005444 Bacteria 2323
37 Ga0070708_100971317 3300005445 Bacteria 797
38 Ga0070708_101776323 3300005445 Unclassified 573
39 Ga0070708_102252497 3300005445 Bacteria 503
40 Ga0070663_100835780 3300005455 Bacteria 792
41 Ga0070663_101063123 3300005455 Bacteria 706
42 Ga0070678_100025558 3300005456 Bacteria 3975
43 Ga0070678_101689629 3300005456 Bacteria 596
44 Ga0070678_101967568 3300005456 Bacteria 553
45 Ga0070662_100011744 3300005457 Bacteria 5784
46 Ga0070662_101180821 3300005457 Unclassified 658
47 Ga0070681_10012878 3300005458 Bacteria 8306
48 Ga0070681_10634814 3300005458 Bacteria 983
49 Ga0068867_100155643 3300005459 Bacteria 1799
50 Ga0068867_100486267 3300005459 Bacteria 1058
51 Ga0068867_100670589 3300005459 Bacteria 912
52 Ga0070685_10502949 3300005466 Bacteria 858
53 Ga0070685_10712018 3300005466 Bacteria 733
54 Ga0070685_10718485 3300005466 Bacteria 730
55 Ga0070706_100137443 3300005467 Bacteria 2280
56 Ga0070707_101396030 3300005468 Unclassified 667
57 Ga0070698_100491453 3300005471 Bacteria 1165
58 Ga0070698_100504553 3300005471 Bacteria 1148
59 Ga0070699_100130998 3300005518 Bacteria 2210
60 Ga0070699_100342933 3300005518 Bacteria 1345
61 Ga0070699_100358968 3300005518 Bacteria 1313
62 Ga0070699_100557148 3300005518 Bacteria 1044
63 Ga0070679_100057930 3300005530 Bacteria 3861
64 Ga0070684_100030352 3300005535 Bacteria 4591
65 Ga0070684_100415839 3300005535 Bacteria 1241
66 Ga0070684_100439816 3300005535 Bacteria 1205
67 Ga0070684_100720350 3300005535 Unclassified 931
68 Ga0070697_100528089 3300005536 Bacteria 1034
69 Ga0070697_100583349 3300005536 Bacteria 982
70 Ga0070697_101365316 3300005536 Unclassified 632
71 Ga0070672_100371716 3300005543 Bacteria 1222
72 Ga0070672_100382607 3300005543 Bacteria 1204
73 Ga0070672_101047821 3300005543 Bacteria 724
74 Ga0070686_100670886 3300005544 Bacteria 824
75 Ga0070686_101057669 3300005544 Bacteria 668
76 Ga0070695_101142190 3300005545 Bacteria 639
77 Ga0070695_101155691 3300005545 Bacteria 635
78 Ga0070695_101396219 3300005545 Unclassified 581
79 Ga0070693_100140238 3300005547 Bacteria 1521
80 Ga0070693_100299200 3300005547 Bacteria 1084
81 Ga0070693_101027104 3300005547 Bacteria 625
82 Ga0070665_100583697 3300005548 Bacteria 1130
83 Ga0070704_101213871 3300005549 Bacteria 688
84 Ga0070704_101778934 3300005549 Unclassified 570
85 Ga0068855_100370760 3300005563 Bacteria 1574
86 Ga0068855_100462155 3300005563 Bacteria 1384
87 Ga0068855_100911432 3300005563 Bacteria 928
88 Ga0070664_101365085 3300005564 Bacteria 670
89 Ga0068857_102078623 3300005577 Unclassified 557
90 Ga0068854_100361416 3300005578 Bacteria 1191
91 Ga0068856_100171528 3300005614 Bacteria 2181
92 Ga0068856_100624204 3300005614 Bacteria 1099
93 Ga0068856_100770362 3300005614 Bacteria 982
94 Ga0068856_101433969 3300005614 Unclassified 705
95 Ga0070702_100565196 3300005615 Bacteria 847
96 Ga0068852_101572495 3300005616 Bacteria 680
97 Ga0068861_100013778 3300005719 Bacteria 5663
98 Ga0068861_101400810 3300005719 Bacteria 683
99 Ga0068870_10548792 3300005840 Unclassified 778
100 Ga0068863_101094906 3300005841 Unclassified 801
101 Ga0068858_101231689 3300005842 Bacteria 736
102 Ga0068860_100369228 3300005843 Bacteria 1415
103 Ga0068862_102073701 3300005844 Unclassified 580
104 Ga0068862_102133674 3300005844 Bacteria 571
105 Ga0070715_10811512 3300006163 Bacteria 569
106 Ga0070716_101014692 3300006173 Bacteria 657
107 Ga0070712_101329675 3300006175 Bacteria 626
108 Ga0070712_101626739 3300006175 Bacteria 565
109 Ga0097621_100130625 3300006237 Bacteria 2138
110 Ga0097621_101266091 3300006237 Bacteria 696
111 Ga0068871_100172889 3300006358 Bacteria 1853
112 Ga0068871_100179699 3300006358 Bacteria 1818
113 Ga0068871_100495211 3300006358 Bacteria 1101
114 Ga0075428_100894667 3300006844 Bacteria 942
115 Ga0075430_100389057 3300006846 Bacteria 1151
116 Ga0075433_11132674 3300006852 Unclassified 680
117 Ga0075434_100235951 3300006871 Bacteria 1849
118 Ga0075434_102504171 3300006871 Unclassified 517
119 Ga0068865_100346087 3300006881 Bacteria 1203
120 Ga0068865_100894080 3300006881 Bacteria 772
121 Ga0068865_101490745 3300006881 Bacteria 606
122 Ga0105240_11795598 3300009093 Bacteria 639
123 Ga0111539_10807698 3300009094 Bacteria 1092
124 Ga0105245_10265359 3300009098 Bacteria 1672
125 Ga0105245_12120924 3300009098 Bacteria 616
126 Ga0105245_13193984 3300009098 Bacteria 508
127 Ga0105243_10650190 3300009148 Unclassified 1022
128 Ga0105243_10734287 3300009148 Bacteria 966
129 Ga0105243_11172339 3300009148 Bacteria 780
130 Ga0105241_12266141 3300009174 Unclassified 540
131 Ga0105242_10345476 3300009176 Bacteria 1373
132 Ga0105242_10607849 3300009176 Bacteria 1057
133 Ga0105249_10914576 3300009553 Bacteria 944
134 Ga0105249_12884157 3300009553 Bacteria 552
135 Ga0105239_10643338 3300010375 Bacteria 1211
136 Ga0105239_11793529 3300010375 Unclassified 711
137 Ga0105246_10142745 3300011119 Bacteria 1803
138 Ga0105246_10282382 3300011119 Bacteria 1332
139 Ga0105246_10713273 3300011119 Bacteria 880
140 Ga0157347_1045426 3300012502 Bacteria 592
141 Ga0157374_10041829 3300013296 Bacteria 4225
142 Ga0157374_10801104 3300013296 Bacteria 958
143 Ga0157374_12638557 3300013296 Bacteria 530
144 Ga0157378_10750290 3300013297 Bacteria 999
145 Ga0163162_11633877 3300013306 Unclassified 735
146 Ga0163162_13212230 3300013306 Bacteria 524
147 Ga0157372_10833698 3300013307 Bacteria 1071
148 Ga0157372_12070594 3300013307 Bacteria 654
149 Ga0157375_10289673 3300013308 Bacteria 1800
150 Ga0157375_10727648 3300013308 Bacteria 1145
151 Ga0157375_10848472 3300013308 Bacteria 1060
152 Ga0157375_10897335 3300013308 Bacteria 1030
153 Ga0157375_11085437 3300013308 Bacteria 936
154 Ga0157375_11504843 3300013308 Unclassified 794
155 Ga0163163_10500387 3300014325 Bacteria 1277
156 Ga0163163_10853724 3300014325 Unclassified 974
157 Ga0163163_12263046 3300014325 Bacteria 602
158 Ga0163163_12801267 3300014325 Unclassified 544
159 Ga0163163_12851099 3300014325 Bacteria 539
160 Ga0157380_10329390 3300014326 Bacteria 1419
161 Ga0157380_10605691 3300014326 Bacteria 1085
162 Ga0157377_10295801 3300014745 Bacteria 1066
163 Ga0157377_10462789 3300014745 Bacteria 878
164 Ga0157379_11070961 3300014968 Bacteria 771
165 Ga0157379_11112245 3300014968 Bacteria 757
166 Ga0157376_10307576 3300014969 Bacteria 1503
167 Ga0157376_10316901 3300014969 Bacteria 1481
168 Ga0157376_10757971 3300014969 Bacteria 980
169 Ga0157376_11135120 3300014969 Unclassified 808
170 Ga0163161_10910127 3300017792 Bacteria 746
171 Ga0163161_11208590 3300017792 Bacteria 654
172 Ga0207692_10033367 3300025898 Bacteria 2482
173 Ga0207688_10401314 3300025901 Bacteria 850
174 Ga0207680_10594975 3300025903 Bacteria 791
175 Ga0207643_10212691 3300025908 Bacteria 1181
176 Ga0207643_10650298 3300025908 Bacteria 680
177 Ga0207684_10162929 3300025910 Bacteria 1921
178 Ga0207654_10157903 3300025911 Bacteria 1462
179 Ga0207707_10009696 3300025912 Bacteria 8354
180 Ga0207693_10000417 3300025915 Bacteria 38685
181 Ga0207693_10610004 3300025915 Bacteria 849
182 Ga0207660_10046517 3300025917 Bacteria 3062
183 Ga0207657_10135634 3300025919 Bacteria 2014
184 Ga0207649_10600509 3300025920 Bacteria 846
185 Ga0207652_10011117 3300025921 Bacteria 7255
186 Ga0207646_11847654 3300025922 Unclassified 516
187 Ga0207650_10709957 3300025925 Bacteria 850
188 Ga0207659_10139947 3300025926 Bacteria 1878
189 Ga0207687_10108288 3300025927 Bacteria 2057
190 Ga0207687_11897827 3300025927 Bacteria 509
191 Ga0207644_11704129 3300025931 Bacteria 528
192 Ga0207690_10472781 3300025932 Bacteria 1011
193 Ga0207706_10204616 3300025933 Bacteria 1731
194 Ga0207686_10081424 3300025934 Bacteria 2113
195 Ga0207686_10413092 3300025934 Bacteria 1031
196 Ga0207709_10394463 3300025935 Bacteria 1056
197 Ga0207670_11871523 3300025936 Unclassified 510
198 Ga0207669_10270079 3300025937 Bacteria 1277
199 Ga0207704_10209293 3300025938 Bacteria 1434
200 Ga0207665_10582579 3300025939 Bacteria 872
201 Ga0207691_10628915 3300025940 Bacteria 908
202 Ga0207691_10937167 3300025940 Bacteria 724
203 Ga0207691_11461926 3300025940 Unclassified 560
204 Ga0207661_10007239 3300025944 Bacteria 7889
205 Ga0207661_10452461 3300025944 Bacteria 1170
206 Ga0207667_10465556 3300025949 Bacteria 1284
207 Ga0207651_11062508 3300025960 Bacteria 725
208 Ga0207668_10552201 3300025972 Bacteria 998
209 Ga0207677_10236885 3300026023 Bacteria 1474
210 Ga0207677_10310402 3300026023 Bacteria 1307
211 Ga0207639_11624091 3300026041 Bacteria 606
212 Ga0207678_10216053 3300026067 Bacteria 1641
213 Ga0207678_10504348 3300026067 Bacteria 1055
214 Ga0207702_10006756 3300026078 Bacteria 9845
215 Ga0207702_10038996 3300026078 Bacteria 3980
216 Ga0207702_10594048 3300026078 Bacteria 1086
217 Ga0207641_10758779 3300026088 Bacteria 958
218 Ga0207648_11026599 3300026089 Bacteria 773
219 Ga0207676_10646989 3300026095 Bacteria 1020
220 Ga0207674_10645259 3300026116 Bacteria 1022
221 Ga0207683_10042579 3300026121 Bacteria 3966
222 Ga0207683_10205509 3300026121 Bacteria 1791
223 Ga0207683_10705609 3300026121 Bacteria 935
224 Ga0268266_10153425 3300028379 Bacteria 2079
225 Ga0268266_10334005 3300028379 Bacteria 1421
226 Ga0265334_10171623 3300028573 Bacteria 759
227 Ga0265338_10007820 3300028800 Bacteria 13144
228 Ga0307408_100223676 3300031548 Bacteria 1537
229 Ga0307408_102402047 3300031548 Unclassified 512
230 Ga0265313_10262923 3300031595 Bacteria 701
231 Ga0307405_10238483 3300031731 Bacteria 1345
232 Ga0307413_10013987 3300031824 Bacteria 4059
233 Ga0307413_10214527 3300031824 Bacteria 1401
234 Ga0307410_10011881 3300031852 Bacteria 5004
235 Ga0307406_10080362 3300031901 Bacteria 2164
236 Ga0307407_10088207 3300031903 Bacteria 1894
237 Ga0307412_10405320 3300031911 Bacteria 1111
238 Ga0307409_100002463 3300031995 Bacteria 9693
239 Ga0307409_100586359 3300031995 Bacteria 1100
240 Ga0307416_100026444 3300032002 Bacteria 4276
241 Ga0307414_10017204 3300032004 Bacteria 4418
242 Ga0307411_10057946 3300032005 Bacteria 2561
243 Ga0307415_100091303 3300032126 Bacteria 2205
244 Ga0395899_0749635 3300037312 Bacteria 608
245 Ga0395900_1559362 3300037418 Bacteria 572
246 Ga0395898_0879916 3300037466 Bacteria 834
247 Ga0395905_1622374 3300037471 Unclassified 552
248 Ga0395901_0014586 3300038443 Bacteria 7988
249 Ga0395901_1044725 3300038443 Bacteria 790
250 Ga0436360_0044408 3300039438 Bacteria 9561
251 Ga0436360_1377913 3300039438 Bacteria 1109
252 Ga0439465_0067097 3300041413 Bacteria 1197
253 Ga0451833_0714406 3300041491 Bacteria 844
254 Ga0451839_0950997 3300041496 Bacteria 639
255 Ga0451843_0477764 3300041509 Unclassified 519
256 Ga0451853_1512390 3300041512 Bacteria 1850
257 Ga0439431_0074734 3300041997 Unclassified 907
258 Ga0439431_0279140 3300041997 Unclassified 500
259 Ga0439437_062922 3300042000 Bacteria 505
260 Ga0439441_002778 3300042001 Bacteria 2502
261 Ga0450920_049124 3300042122 Unclassified 845
262 Ga0450891_010325 3300042129 Bacteria 860
263 Ga0439446_0001077 3300042156 Bacteria 6020
264 Ga0439446_0109204 3300042156 Bacteria 881
265 Ga0439434_0306702 3300042435 Bacteria 549
266 Ga0439459_0046456 3300042438 Bacteria 940
267 Ga0439460_0274848 3300042461 Unclassified 586
268 Ga0466963_0030761 3300044694 Bacteria 3465
269 Ga0466968_0383971 3300044735 Bacteria 686
270 Ga0466960_0005196 3300044901 Bacteria 5145
271 Ga0466960_0528596 3300044901 Unclassified 694
272 Ga0466958_0016788 3300045836 Bacteria 4221
273 Ga0466967_0013521 3300045976 Bacteria 6311
274 Ga0466967_0052304 3300045976 Bacteria 3584
275 Ga0495617_231823 3300046452 Bacteria 572
276 Ga0495591_113569 3300046458 Bacteria 664
277 Ga0495584_0391859 3300046491 Unclassified 706
278 Ga0495584_0423591 3300046491 Bacteria 677
279 Ga0495585_0220999 3300046492 Bacteria 956
280 Ga0495585_0588821 3300046492 Unclassified 524
281 Ga0495596_0318956 3300046500 Archaea 604
282 Ga0495607_0250115 3300046501 Bacteria 854
283 Ga0495628_0441987 3300046516 Bacteria 945
284 Ga0495630_0320062 3300046517 Unclassified 1186
285 Ga0495644_0167441 3300046523 Bacteria 843
286 Ga0495663_0081597 3300046525 Bacteria 1042
287 Ga0495587_0464323 3300046536 Bacteria 701
288 Ga0495667_0154374 3300046559 Bacteria 1478
289 Ga0495656_0084329 3300046615 Bacteria 1441
290 Ga0495656_0434127 3300046615 Unclassified 690
291 Ga0495656_0532142 3300046615 Bacteria 625
292 Ga0495668_0092080 3300046616 Bacteria 1661
293 Ga0495611_0588369 3300046648 Bacteria 503
294 Ga0495635_0311787 3300046663 Bacteria 1054
295 Ga0495661_0336396 3300046665 Unclassified 747
296 Ga0495661_0599813 3300046665 Unclassified 518
297 Ga0495658_0377182 3300046683 Bacteria 903
298 Ga0495670_0628454 3300046691 Bacteria 585
299 Ga0495649_0653612 3300046694 Unclassified 517
300 Ga0495589_0178183 3300046794 Bacteria 1009
301 Ga0495589_0214431 3300046794 Bacteria 906
302 Ga0495600_0719556 3300046809 Bacteria 599
303 Ga0495660_0278593 3300046810 Bacteria 766
304 Ga0495674_0040465 3300047319 Bacteria 4169
305 Ga0495676_0420290 3300047321 Bacteria 885
306 Ga0495684_0265075 3300047471 Bacteria 1245
307 Ga0495602_0666240 3300048088 Bacteria 709
308 Ga0496100_0030771 3300048903 Bacteria 3332
309 Ga0496100_0190191 3300048903 Bacteria 1490
310 Ga0496100_0450358 3300048903 Unclassified 987
311 Ga0496100_0546952 3300048903 Bacteria 895
312 Ga0496100_0899391 3300048903 Unclassified 695
313 Ga0496101_0003443 3300048904 Bacteria 9876
314 Ga0496101_0012022 3300048904 Bacteria 5769
315 Ga0496101_0046494 3300048904 Bacteria 3113
316 Ga0496101_0072263 3300048904 Bacteria 2532
317 Ga0496102_0023971 3300048905 Bacteria 5424
318 Ga0496102_0298502 3300048905 Bacteria 1518
319 Ga0496103_0015206 3300048906 Bacteria 4575
320 Ga0496104_0002034 3300048907 Bacteria 17569
321 Ga0496104_0030037 3300048907 Bacteria 5047
322 Ga0496104_0159330 3300048907 Bacteria 2165
323 Ga0496104_0162017 3300048907 Bacteria 2145
324 Ga0496104_0178442 3300048907 Bacteria 2034
325 Ga0496105_0000050 3300048908 Bacteria 93402
326 Ga0496105_0122563 3300048908 Bacteria 2143
327 Ga0496105_0124255 3300048908 Bacteria 2127
328 Ga0496106_0034609 3300048909 Bacteria 3774
329 Ga0496106_0376230 3300048909 Bacteria 1141
330 Ga0496106_0413274 3300048909 Bacteria 1084
331 Ga0496107_0067962 3300048910 Bacteria 2586
332 Ga0496107_0113101 3300048910 Bacteria 1996
333 Ga0496108_0002704 3300048911 Bacteria 14173
334 Ga0496108_0035646 3300048911 Bacteria 4136
335 Ga0496108_0351976 3300048911 Bacteria 1285
336 Ga0496108_1028067 3300048911 Bacteria 703
337 Ga0496109_0001247 3300048912 Bacteria 21102
338 Ga0496109_0002493 3300048912 Bacteria 15427
339 Ga0496109_0241322 3300048912 Bacteria 1701
340 Ga0496109_0267865 3300048912 Bacteria 1609
341 Ga0496109_0878757 3300048912 Bacteria 834
342 Ga0496110_0002214 3300048913 Bacteria 14529
343 Ga0496110_0038696 3300048913 Bacteria 4151
344 Ga0496110_0038805 3300048913 Bacteria 4145
345 Ga0496110_0901264 3300048913 Bacteria 790
346 Ga0496111_0000240 3300048914 Bacteria 26236
347 Ga0496111_0003419 3300048914 Bacteria 9822
348 Ga0496111_1125868 3300048914 Unclassified 559
349 Ga0496112_0376271 3300048915 Bacteria 1361
350 Ga0496112_1660218 3300048915 Unclassified 552
351 Ga0496113_0077918 3300048916 Bacteria 2535
352 Ga0496113_0135844 3300048916 Bacteria 1932
353 Ga0496114_0002175 3300048917 Bacteria 14929
354 Ga0496114_0005710 3300048917 Bacteria 9757
355 Ga0496114_0026121 3300048917 Bacteria 4778
356 Ga0496114_0097519 3300048917 Bacteria 2504
357 Ga0496115_0003301 3300048918 Bacteria 11584
358 Ga0496115_0184867 3300048918 Bacteria 1722
359 Ga0501031_0000646 3300049568 Bacteria 20687
360 Ga0501031_0483504 3300049568 Unclassified 799
361 Ga0501032_0407742 3300049569 Bacteria 873
362 Ga0501033_0089104 3300049570 Bacteria 2257
363 Ga0501036_0001820 3300049572 Bacteria 16535
364 Ga0501037_0040197 3300049573 Bacteria 3442
365 Ga0501038_0042334 3300049574 Bacteria 3966
366 Ga0501038_0464198 3300049574 Bacteria 972
367 Ga0501038_0899383 3300049574 Unclassified 654
368 Ga0501039_0003181 3300049575 Bacteria 12282
369 Ga0501040_0002160 3300049576 Bacteria 12700
370 Ga0501040_0701815 3300049576 Bacteria 732
371 Ga0501041_0007422 3300049577 Bacteria 6437
372 Ga0501041_0681665 3300049577 Bacteria 657
373 Ga0501042_0019987 3300049578 Bacteria 4658
374 Ga0501043_0374157 3300049579 Bacteria 1079
375 Ga0501046_0010682 3300049580 Bacteria 7874
376 Ga0501046_0144646 3300049580 Bacteria 1796
377 Ga0501048_0012967 3300049582 Bacteria 6190
378 Ga0501068_0098703 3300049584 Bacteria 1809
379 Ga0501069_0011213 3300049585 Bacteria 4754
380 Ga0501070_0281647 3300049586 Bacteria 1356
381 Ga0501071_0019964 3300049587 Bacteria 4654
382 Ga0501072_0002180 3300049588 Bacteria 14628
383 Ga0501072_0389972 3300049588 Bacteria 1105
384 Ga0501073_0217396 3300049589 Bacteria 1320
385 Ga0501075_0022233 3300049591 Bacteria 4630
386 Ga0501075_1333321 3300049591 Unclassified 544
387 Ga0501076_0003223 3300049592 Bacteria 11404
388 Ga0501077_0000973 3300049593 Bacteria 17237
389 Ga0501077_0853379 3300049593 Bacteria 586
390 Ga0501077_1126346 3300049593 Unclassified 505
391 Ga0501235_138466 3300049669 Bacteria 622
392 Ga0501079_0321525 3300049741 Bacteria 1211
393 Ga0501079_0472245 3300049741 Bacteria 985
394 Ga0501079_0569619 3300049741 Unclassified 891
395 Ga0501080_0091031 3300049742 Bacteria 2833
396 Ga0501081_0109413 3300049743 Bacteria 1960
397 Ga0501081_1243390 3300049743 Unclassified 564
398 Ga0501081_1548535 3300049743 Unclassified 504
399 Ga0501083_0127410 3300049744 Bacteria 1668
400 Ga0501035_0132279 3300049822 Bacteria 2174
401 Ga0501035_0538407 3300049822 Bacteria 958
402 Ga0501044_0184171 3300049823 Bacteria 2054
403 Ga0501045_0001798 3300049824 Bacteria 14481
404 Ga0501045_0453364 3300049824 Bacteria 953
405 Ga0501045_0473064 3300049824 Bacteria 931
406 Ga0501045_0778122 3300049824 Unclassified 705
407 nmdc:mga0n895_207093_c1 3300050512 Bacteria 1992
408 nmdc:mga0a205_403084_c1 3300050515 Bacteria 1231
409 nmdc:mga0a205_418346_c1 3300050515 Bacteria 1202
410 Ga0495612_0137571 3300053078 Bacteria 1058
411 Ga0495619_0105459 3300053085 Bacteria 1922
412 Ga0501084_0005079 3300054114 Bacteria 10770
413 Ga0501084_0032935 3300054114 Bacteria 4336
414 Ga0501084_1627794 3300054114 Bacteria 540
415 Ga0590071_015536 3300059421 Bacteria 1785
416 Ga0590077_043019 3300059426 Bacteria 1006
417 Ga0501082_0002714 3300060353 Bacteria 15456
418 Ga0501082_0704017 3300060353 Bacteria 884
419 Ga0530510_1112334 3300061734 Unclassified 605
420 Ga0070708_100738992
421 Ga0070676_10221125
422 Ga0070683_100100321
423 Ga0070683_100657169
424 Ga0070683_100867393
425 Ga0070683_101282651
426 Ga0070683_102353475
427 Ga0070680_100018442
428 Ga0070682_100576388
429 Ga0070682_100585051
430 Ga0070682_100627131
431 Ga0068868_100354249
432 Ga0068868_100691615
433 Ga0068868_101613974
434 Ga0070660_100061889
435 Ga0070687_101453709
436 Ga0070661_100140360
437 Ga0070661_100640426
438 Ga0070661_100943427
439 Ga0070668_100005894
440 Ga0070669_100206534
441 Ga0070669_101569315
442 Ga0070675_100030807
443 Ga0070675_100182174
444 Ga0070675_100879285
445 Ga0070674_101166394
446 Ga0070688_101034821
447 Ga0070688_101270518
448 Ga0070659_100523331
449 Ga0070659_100918281
450 Ga0070714_100171967
451 Ga0070701_11030621
452 Ga0070701_11119367
453 Ga0070711_101616739
454 Ga0070705_100483956
455 Ga0070694_100076123
456 Ga0070708_100971317
457 Ga0070708_101776323
458 Ga0070708_102252497
459 Ga0070663_100835780
460 Ga0070663_101063123
461 Ga0070678_100025558
462 Ga0070678_101689629
463 Ga0070678_101967568
464 Ga0070662_100011744
465 Ga0070662_101180821
466 Ga0070681_10012878
467 Ga0070681_10634814
468 Ga0068867_100155643
469 Ga0068867_100486267
470 Ga0068867_100670589
471 Ga0070685_10502949
472 Ga0070685_10712018
473 Ga0070685_10718485
474 Ga0070706_100137443
475 Ga0070707_101396030
476 Ga0070698_100491453
477 Ga0070698_100504553
478 Ga0070699_100130998
479 Ga0070699_100342933
480 Ga0070699_100358968
481 Ga0070699_100557148
482 Ga0070679_100057930
483 Ga0070684_100030352
484 Ga0070684_100415839
485 Ga0070684_100439816
486 Ga0070684_100720350
487 Ga0070697_100528089
488 Ga0070697_100583349
489 Ga0070697_101365316
490 Ga0070672_100371716
491 Ga0070672_100382607
492 Ga0070672_101047821
493 Ga0070686_100670886
494 Ga0070686_101057669
495 Ga0070695_101142190
496 Ga0070695_101155691
497 Ga0070695_101396219
498 Ga0070693_100140238
499 Ga0070693_100299200
500 Ga0070693_101027104
501 Ga0070665_100583697
502 Ga0070704_101213871
503 Ga0070704_101778934
504 Ga0068855_100370760
505 Ga0068855_100462155
506 Ga0068855_100911432
507 Ga0070664_101365085
508 Ga0068857_102078623
509 Ga0068854_100361416
510 Ga0068856_100171528
511 Ga0068856_100624204
512 Ga0068856_100770362
513 Ga0068856_101433969
514 Ga0070702_100565196
515 Ga0068852_101572495
516 Ga0068861_100013778
517 Ga0068861_101400810
518 Ga0068870_10548792
519 Ga0068863_101094906
520 Ga0068858_101231689
521 Ga0068860_100369228
522 Ga0068862_102073701
523 Ga0068862_102133674
524 Ga0070715_10811512
525 Ga0070716_101014692
526 Ga0070712_101329675
527 Ga0070712_101626739
528 Ga0097621_100130625
529 Ga0097621_101266091
530 Ga0068871_100172889
531 Ga0068871_100179699
532 Ga0068871_100495211
533 Ga0075428_100894667
534 Ga0075430_100389057
535 Ga0075433_11132674
536 Ga0075434_100235951
537 Ga0075434_102504171
538 Ga0068865_100346087
539 Ga0068865_100894080
540 Ga0068865_101490745
541 Ga0105240_11795598
542 Ga0111539_10807698
543 Ga0105245_10265359
544 Ga0105245_12120924
545 Ga0105245_13193984
546 Ga0105243_10650190
547 Ga0105243_10734287
548 Ga0105243_11172339
549 Ga0105241_12266141
550 Ga0105242_10345476
551 Ga0105242_10607849
552 Ga0105249_10914576
553 Ga0105249_12884157
554 Ga0105239_10643338
555 Ga0105239_11793529
556 Ga0105246_10142745
557 Ga0105246_10282382
558 Ga0105246_10713273
559 Ga0157347_1045426
560 Ga0157374_10041829
561 Ga0157374_10801104
562 Ga0157374_12638557
563 Ga0157378_10750290
564 Ga0163162_11633877
565 Ga0163162_13212230
566 Ga0157372_10833698
567 Ga0157372_12070594
568 Ga0157375_10289673
569 Ga0157375_10727648
570 Ga0157375_10848472
571 Ga0157375_10897335
572 Ga0157375_11085437
573 Ga0157375_11504843
574 Ga0163163_10500387
575 Ga0163163_10853724
576 Ga0163163_12263046
577 Ga0163163_12801267
578 Ga0163163_12851099
579 Ga0157380_10329390
580 Ga0157380_10605691
581 Ga0157377_10295801
582 Ga0157377_10462789
583 Ga0157379_11070961
584 Ga0157379_11112245
585 Ga0157376_10307576
586 Ga0157376_10316901
587 Ga0157376_10757971
588 Ga0157376_11135120
589 Ga0163161_10910127
590 Ga0163161_11208590
591 Ga0207692_10033367
592 Ga0207688_10401314
593 Ga0207680_10594975
594 Ga0207643_10212691
595 Ga0207643_10650298
596 Ga0207684_10162929
597 Ga0207654_10157903
598 Ga0207707_10009696
599 Ga0207693_10000417
600 Ga0207693_10610004
601 Ga0207660_10046517
602 Ga0207657_10135634
603 Ga0207649_10600509
604 Ga0207652_10011117
605 Ga0207646_11847654
606 Ga0207650_10709957
607 Ga0207659_10139947
608 Ga0207687_10108288
609 Ga0207687_11897827
610 Ga0207644_11704129
611 Ga0207690_10472781
612 Ga0207706_10204616
613 Ga0207686_10081424
614 Ga0207686_10413092
615 Ga0207709_10394463
616 Ga0207670_11871523
617 Ga0207669_10270079
618 Ga0207704_10209293
619 Ga0207665_10582579
620 Ga0207691_10628915
621 Ga0207691_10937167
622 Ga0207691_11461926
623 Ga0207661_10007239
624 Ga0207661_10452461
625 Ga0207667_10465556
626 Ga0207651_11062508
627 Ga0207668_10552201
628 Ga0207677_10236885
629 Ga0207677_10310402
630 Ga0207639_11624091
631 Ga0207678_10216053
632 Ga0207678_10504348
633 Ga0207702_10006756
634 Ga0207702_10038996
635 Ga0207702_10594048
636 Ga0207641_10758779
637 Ga0207648_11026599
638 Ga0207676_10646989
639 Ga0207674_10645259
640 Ga0207683_10042579
641 Ga0207683_10205509
642 Ga0207683_10705609
643 Ga0268266_10153425
644 Ga0268266_10334005
645 Ga0265334_10171623
646 Ga0265338_10007820
647 Ga0307408_100223676
648 Ga0307408_102402047
649 Ga0265313_10262923
650 Ga0307405_10238483
651 Ga0307413_10013987
652 Ga0307413_10214527
653 Ga0307410_10011881
654 Ga0307406_10080362
655 Ga0307407_10088207
656 Ga0307412_10405320
657 Ga0307409_100002463
658 Ga0307409_100586359
659 Ga0307416_100026444
660 Ga0307414_10017204
661 Ga0307411_10057946
662 Ga0307415_100091303
663 Ga0395899_0749635
664 Ga0395900_1559362
665 Ga0395898_0879916
666 Ga0395905_1622374
667 Ga0395901_0014586
668 Ga0395901_1044725
669 Ga0436360_0044408
670 Ga0436360_1377913
671 Ga0439465_0067097
672 Ga0451833_0714406
673 Ga0451839_0950997
674 Ga0451843_0477764
675 Ga0451853_1512390
676 Ga0439431_0074734
677 Ga0439431_0279140
678 Ga0439437_062922
679 Ga0439441_002778
680 Ga0450920_049124
681 Ga0450891_010325
682 Ga0439446_0001077
683 Ga0439446_0109204
684 Ga0439434_0306702
685 Ga0439459_0046456
686 Ga0439460_0274848
687 Ga0466963_0030761
688 Ga0466968_0383971
689 Ga0466960_0005196
690 Ga0466960_0528596
691 Ga0466958_0016788
692 Ga0466967_0013521
693 Ga0466967_0052304
694 Ga0495617_231823
695 Ga0495591_113569
696 Ga0495584_0391859
697 Ga0495584_0423591
698 Ga0495585_0220999
699 Ga0495585_0588821
700 Ga0495596_0318956
701 Ga0495607_0250115
702 Ga0495628_0441987
703 Ga0495630_0320062
704 Ga0495644_0167441
705 Ga0495663_0081597
706 Ga0495587_0464323
707 Ga0495667_0154374
708 Ga0495656_0084329
709 Ga0495656_0434127
710 Ga0495656_0532142
711 Ga0495668_0092080
712 Ga0495611_0588369
713 Ga0495635_0311787
714 Ga0495661_0336396
715 Ga0495661_0599813
716 Ga0495658_0377182
717 Ga0495670_0628454
718 Ga0495649_0653612
719 Ga0495589_0178183
720 Ga0495589_0214431
721 Ga0495600_0719556
722 Ga0495660_0278593
723 Ga0495674_0040465
724 Ga0495676_0420290
725 Ga0495684_0265075
726 Ga0495602_0666240
727 Ga0496100_0030771
728 Ga0496100_0190191
729 Ga0496100_0450358
730 Ga0496100_0546952
731 Ga0496100_0899391
732 Ga0496101_0003443
733 Ga0496101_0012022
734 Ga0496101_0046494
735 Ga0496101_0072263
736 Ga0496102_0023971
737 Ga0496102_0298502
738 Ga0496103_0015206
739 Ga0496104_0002034
740 Ga0496104_0030037
741 Ga0496104_0159330
742 Ga0496104_0162017
743 Ga0496104_0178442
744 Ga0496105_0000050
745 Ga0496105_0122563
746 Ga0496105_0124255
747 Ga0496106_0034609
748 Ga0496106_0376230
749 Ga0496106_0413274
750 Ga0496107_0067962
751 Ga0496107_0113101
752 Ga0496108_0002704
753 Ga0496108_0035646
754 Ga0496108_0351976
755 Ga0496108_1028067
756 Ga0496109_0001247
757 Ga0496109_0002493
758 Ga0496109_0241322
759 Ga0496109_0267865
760 Ga0496109_0878757
761 Ga0496110_0002214
762 Ga0496110_0038696
763 Ga0496110_0038805
764 Ga0496110_0901264
765 Ga0496111_0000240
766 Ga0496111_0003419
767 Ga0496111_1125868
768 Ga0496112_0376271
769 Ga0496112_1660218
770 Ga0496113_0077918
771 Ga0496113_0135844
772 Ga0496114_0002175
773 Ga0496114_0005710
774 Ga0496114_0026121
775 Ga0496114_0097519
776 Ga0496115_0003301
777 Ga0496115_0184867
778 Ga0501031_0000646
779 Ga0501031_0483504
780 Ga0501032_0407742
781 Ga0501033_0089104
782 Ga0501036_0001820
783 Ga0501037_0040197
784 Ga0501038_0042334
785 Ga0501038_0464198
786 Ga0501038_0899383
787 Ga0501039_0003181
788 Ga0501040_0002160
789 Ga0501040_0701815
790 Ga0501041_0007422
791 Ga0501041_0681665
792 Ga0501042_0019987
793 Ga0501043_0374157
794 Ga0501046_0010682
795 Ga0501046_0144646
796 Ga0501048_0012967
797 Ga0501068_0098703
798 Ga0501069_0011213
799 Ga0501070_0281647
800 Ga0501071_0019964
801 Ga0501072_0002180
802 Ga0501072_0389972
803 Ga0501073_0217396
804 Ga0501075_0022233
805 Ga0501075_1333321
806 Ga0501076_0003223
807 Ga0501077_0000973
808 Ga0501077_0853379
809 Ga0501077_1126346
810 Ga0501235_138466
811 Ga0501079_0321525
812 Ga0501079_0472245
813 Ga0501079_0569619
814 Ga0501080_0091031
815 Ga0501081_0109413
816 Ga0501081_1243390
817 Ga0501081_1548535
818 Ga0501083_0127410
819 Ga0501035_0132279
820 Ga0501035_0538407
821 Ga0501044_0184171
822 Ga0501045_0001798
823 Ga0501045_0453364
824 Ga0501045_0473064
825 Ga0501045_0778122
826 nmdc:mga0n895_207093_c1
827 nmdc:mga0a205_403084_c1
828 nmdc:mga0a205_418346_c1
829 Ga0495612_0137571
830 Ga0495619_0105459
831 Ga0501084_0005079
832 Ga0501084_0032935
833 Ga0501084_1627794
834 Ga0590071_015536
835 Ga0590077_043019
836 Ga0501082_0002714
837 Ga0501082_0704017
838 Ga0530510_1112334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04296

YlxR

Protein of unknown function (DUF448)

22

93

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ls2-assembly1.cif.gz_Q2 80s ribosome from mouse bound to eef2 (class i) 0.7281 3 54
7tm3-assembly1.cif.gz_W structure of the rabbit 80s ribosome stalled on a 2-tmd rhodopsin intermediate in complex with the multipass translocon 0.7222 3 54
1g2r-assembly1.cif.gz_A structure of cytosolic protein of unknown function coded by gene from nusa/infb region, a ylxr homologue 0.7137 3 78
7qgg-assembly1.cif.gz_X neuronal rna granules are ribosome complexes stalled at the pre-translocation state 0.7083 3 55
6lqm-assembly1.cif.gz_f cryo-em structure of a pre-60s ribosomal subunit - state c 0.7075 3 55
ID Description Score Start End Superfamily
af_I6XFF7_1_86_3.30.1230.10 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.7633 5 81 3.30.1230.10
af_Q9JLM4_495_534_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7571 2 50 3.30.40.10
af_Q9JLM4_495_534_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7135 2 50 3.30.40.10
1g2rA00 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.7135 3 78 3.30.1230.10
1vwxW00 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L24 0.7127 3 54 2.30.170.20
ID Description Score Start End GO Terms
AF-A0A7V9IFD9-F1-model_v4 YlxR family protein 0.9893 1 67
AF-A0A538L0M5-F1-model_v4 YlxR family protein 0.9685 1 77
AF-A0A7W1RVF1-F1-model_v4 DUF448 domain-containing protein 0.9642 5 74
AF-A0A538K257-F1-model_v4 YlxR family protein 0.9632 1 76
AF-A0A6I3BSN6-F1-model_v4 DUF448 domain-containing protein 0.9616 2 76

Map