F439406

General Info

Members Datasets Scaffolds Average Seq Length
418 262 836 186

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_25769_c1|nmdc:mga0n895_25769_c1_987_1613
Length 208
Sequence VLPSARSVRSPERLALQVKEVGVTSLAALWLPILVSSVIVFVASSVIHMTSPWHKGDYPKMPREEGVMDALRPFAIPPGDYFMPRPSSRQELRTPEFATKVTKGPVVMMTVMPSGPMSMGRNLGMWFVYLVVMGLFAAYIASRALPPGTDYLQVFRFTGTIAFIGYSAALWQMSIWYRRAWTTTIKSTIDGLIYALLTAGTFGWLWPR

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
209 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
252 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.02
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 24.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_25769_c1 3300050512 Bacteria 5561
2 Ga0065712_10080975 3300005290 Bacteria 3047
3 Ga0065712_10195209 3300005290 Unclassified 1131
4 Ga0065715_10144806 3300005293 Bacteria 1803
5 Ga0065707_10404870 3300005295 Bacteria 848
6 Ga0070658_10002687 3300005327 Bacteria 14792
7 Ga0070690_100007889 3300005330 Bacteria 6106
8 Ga0070690_100293432 3300005330 Bacteria 1164
9 Ga0070670_100016001 3300005331 Bacteria 6437
10 Ga0068869_100073004 3300005334 Bacteria 2544
11 Ga0068869_100105354 3300005334 Unclassified 2139
12 Ga0070666_10002822 3300005335 Bacteria 10495
13 Ga0070666_10035016 3300005335 Unclassified 3328
14 Ga0070680_100059493 3300005336 Bacteria 3126
15 Ga0070682_100066752 3300005337 Bacteria 2290
16 Ga0068868_100003562 3300005338 Bacteria 10843
17 Ga0068868_100261764 3300005338 Bacteria 1459
18 Ga0070660_100796089 3300005339 Bacteria 795
19 Ga0070689_100011605 3300005340 Bacteria 6315
20 Ga0070689_100165587 3300005340 Unclassified 1789
21 Ga0070687_100144231 3300005343 Bacteria 1390
22 Ga0070661_100025544 3300005344 Bacteria 4246
23 Ga0070661_100489151 3300005344 Bacteria 983
24 Ga0070692_10030420 3300005345 Bacteria 2699
25 Ga0070669_101043965 3300005353 Unclassified 702
26 Ga0070671_100116206 3300005355 Bacteria 2249
27 Ga0070671_100156474 3300005355 Bacteria 1925
28 Ga0070674_100068812 3300005356 Unclassified 2496
29 Ga0070673_100025802 3300005364 Unclassified 4331
30 Ga0070673_101527014 3300005364 Bacteria 630
31 Ga0070688_100000683 3300005365 Bacteria 16890
32 Ga0070659_100684106 3300005366 Bacteria 886
33 Ga0070667_100021133 3300005367 Bacteria 5407
34 Ga0070667_100160476 3300005367 Bacteria 1980
35 Ga0070703_10000196 3300005406 Bacteria 29410
36 Ga0070709_10010106 3300005434 Bacteria 5217
37 Ga0070709_10237425 3300005434 Unclassified 1307
38 Ga0070714_100005282 3300005435 Bacteria 9842
39 Ga0070713_100000967 3300005436 Bacteria 18403
40 Ga0070713_100051596 3300005436 Unclassified 3402
41 Ga0070713_101066919 3300005436 Bacteria 780
42 Ga0070710_10055033 3300005437 Unclassified 2246
43 Ga0070710_10145728 3300005437 Bacteria 1456
44 Ga0070701_10019702 3300005438 Bacteria 3191
45 Ga0070711_100004919 3300005439 Bacteria 7930
46 Ga0070711_100095688 3300005439 Bacteria 2149
47 Ga0070705_100001698 3300005440 Bacteria 11492
48 Ga0070705_100030659 3300005440 Bacteria 2971
49 Ga0070705_100555248 3300005440 Unclassified 881
50 Ga0070705_100613659 3300005440 Bacteria 843
51 Ga0070700_100128485 3300005441 Bacteria 1707
52 Ga0070694_100048356 3300005444 Bacteria 2861
53 Ga0070694_100206433 3300005444 Bacteria 1467
54 Ga0070708_100019175 3300005445 Bacteria 5742
55 Ga0070708_100078855 3300005445 Bacteria 2978
56 Ga0070708_100102325 3300005445 Bacteria 2624
57 Ga0070678_100017778 3300005456 Bacteria 4588
58 Ga0070662_100024879 3300005457 Bacteria 4130
59 Ga0070662_100434145 3300005457 Bacteria 1088
60 Ga0070706_100000191 3300005467 Bacteria 76922
61 Ga0070707_100101209 3300005468 Bacteria 2792
62 Ga0070707_100120709 3300005468 Bacteria 2545
63 Ga0070707_100414136 3300005468 Bacteria 1308
64 Ga0070707_100509225 3300005468 Bacteria 1166
65 Ga0070707_100534961 3300005468 Bacteria 1134
66 Ga0070698_100102995 3300005471 Bacteria 2825
67 Ga0070698_100440891 3300005471 Bacteria 1238
68 Ga0070699_100012190 3300005518 Bacteria 7418
69 Ga0070699_100016158 3300005518 Bacteria 6407
70 Ga0070679_101533370 3300005530 Unclassified 614
71 Ga0070684_100085367 3300005535 Bacteria 2799
72 Ga0070684_100620414 3300005535 Bacteria 1006
73 Ga0070697_100013676 3300005536 Bacteria 6368
74 Ga0070697_100081755 3300005536 Bacteria 2662
75 Ga0070697_100185945 3300005536 Bacteria 1762
76 Ga0068853_100926629 3300005539 Unclassified 837
77 Ga0070686_100004985 3300005544 Bacteria 7326
78 Ga0070686_100078673 3300005544 Unclassified 2178
79 Ga0070686_100079495 3300005544 Bacteria 2168
80 Ga0070695_100584744 3300005545 Bacteria 874
81 Ga0070696_100019853 3300005546 Bacteria 4555
82 Ga0070696_100232948 3300005546 Bacteria 1386
83 Ga0070696_100404247 3300005546 Bacteria 1069
84 Ga0070696_100729105 3300005546 Bacteria 810
85 Ga0070693_100001226 3300005547 Bacteria 11574
86 Ga0070693_100005660 3300005547 Bacteria 6028
87 Ga0070693_101170899 3300005547 Bacteria 589
88 Ga0070665_100011617 3300005548 Bacteria 8903
89 Ga0070704_100239386 3300005549 Bacteria 1484
90 Ga0070704_100378958 3300005549 Bacteria 1201
91 Ga0070664_100002451 3300005564 Bacteria 14940
92 Ga0070664_100305246 3300005564 Unclassified 1439
93 Ga0070664_101113395 3300005564 Unclassified 744
94 Ga0068857_101563275 3300005577 Archaea 643
95 Ga0068854_100003182 3300005578 Bacteria 10248
96 Ga0068854_100014090 3300005578 Bacteria 5263
97 Ga0068854_100076126 3300005578 Bacteria 2465
98 Ga0068854_100645260 3300005578 Unclassified 908
99 Ga0070702_100024316 3300005615 Bacteria 3230
100 Ga0070702_100757607 3300005615 Bacteria 746
101 Ga0068852_100065770 3300005616 Bacteria 3164
102 Ga0068859_100001898 3300005617 Bacteria 21302
103 Ga0068859_100550718 3300005617 Unclassified 1248
104 Ga0068864_100003963 3300005618 Bacteria 12193
105 Ga0068864_100078094 3300005618 Bacteria 2896
106 Ga0068864_100180009 3300005618 Unclassified 1932
107 Ga0068864_100945899 3300005618 Bacteria 852
108 Ga0068866_10082894 3300005718 Bacteria 1726
109 Ga0068851_10158162 3300005834 Bacteria 1243
110 Ga0068863_100006358 3300005841 Bacteria 11585
111 Ga0068858_100013260 3300005842 Bacteria 7768
112 Ga0068860_100016372 3300005843 Bacteria 7230
113 Ga0068860_100016610 3300005843 Bacteria 7178
114 Ga0081538_10022739 3300005981 Bacteria 4531
115 Ga0070715_10008013 3300006163 Bacteria 3664
116 Ga0070716_100003748 3300006173 Bacteria 7197
117 Ga0070712_100119980 3300006175 Unclassified 1977
118 Ga0097621_100005718 3300006237 Bacteria 8780
119 Ga0068871_100051606 3300006358 Bacteria 3330
120 Ga0068871_100130400 3300006358 Bacteria 2131
121 Ga0075428_100001716 3300006844 Bacteria 23411
122 Ga0075428_100034045 3300006844 Bacteria 5619
123 Ga0075430_101140066 3300006846 Unclassified 642
124 Ga0075431_100015829 3300006847 Bacteria 7648
125 Ga0075431_100017346 3300006847 Bacteria 7317
126 Ga0075431_100976099 3300006847 Bacteria 815
127 Ga0075433_10019786 3300006852 Bacteria 5617
128 Ga0075433_10155266 3300006852 Bacteria 2036
129 Ga0075434_100006791 3300006871 Bacteria 10523
130 Ga0075434_101019610 3300006871 Bacteria 841
131 Ga0075429_100006899 3300006880 Bacteria 9862
132 Ga0068865_100143471 3300006881 Bacteria 1803
133 Ga0075436_100001492 3300006914 Bacteria 15960
134 Ga0075436_100103059 3300006914 Bacteria 1988
135 Ga0097620_100001898 3300006931 Bacteria 21302
136 Ga0097620_100550773 3300006931 Unclassified 1248
137 Ga0075435_100006613 3300007076 Bacteria 8208
138 Ga0075435_100030723 3300007076 Bacteria 4227
139 Ga0075435_100053829 3300007076 Bacteria 3247
140 Ga0075435_100478566 3300007076 Unclassified 1075
141 Ga0099795_10080000 3300007788 Bacteria 1249
142 Ga0105240_10080365 3300009093 Bacteria 4009
143 Ga0105240_10320028 3300009093 Unclassified 1768
144 Ga0111539_11065981 3300009094 Bacteria 939
145 Ga0111539_11094755 3300009094 Unclassified 926
146 Ga0105245_10005274 3300009098 Bacteria 11352
147 Ga0105245_10011568 3300009098 Bacteria 7687
148 Ga0105245_10142918 3300009098 Bacteria 2255
149 Ga0105247_10035120 3300009101 Unclassified 3054
150 Ga0114129_10019601 3300009147 Bacteria 9627
151 Ga0114129_11045448 3300009147 Bacteria 1026
152 Ga0114129_11969745 3300009147 Bacteria 707
153 Ga0105243_10452724 3300009148 Bacteria 1205
154 Ga0105241_10008784 3300009174 Bacteria 7424
155 Ga0105241_10051611 3300009174 Bacteria 3137
156 Ga0105241_10065504 3300009174 Unclassified 2808
157 Ga0105242_10008835 3300009176 Bacteria 7733
158 Ga0105242_10123740 3300009176 Bacteria 2223
159 Ga0105242_11294091 3300009176 Bacteria 752
160 Ga0105248_10035498 3300009177 Bacteria 5577
161 Ga0105248_10135683 3300009177 Bacteria 2776
162 Ga0105248_11192511 3300009177 Bacteria 861
163 Ga0105238_10185235 3300009551 Bacteria 2058
164 Ga0105238_10581330 3300009551 Unclassified 1127
165 Ga0105239_10090642 3300010375 Bacteria 3373
166 Ga0105239_10364901 3300010375 Unclassified 1631
167 Ga0105246_10125988 3300011119 Unclassified 1905
168 Ga0157373_10188168 3300013100 Unclassified 1454
169 Ga0157369_10025028 3300013105 Bacteria 6630
170 Ga0157374_10004115 3300013296 Bacteria 12209
171 Ga0157378_10018467 3300013297 Bacteria 6126
172 Ga0157378_10087508 3300013297 Unclassified 2826
173 Ga0163162_10005903 3300013306 Bacteria 11845
174 Ga0163162_10066492 3300013306 Bacteria 3653
175 Ga0157372_10141575 3300013307 Bacteria 2771
176 Ga0157372_10257861 3300013307 Bacteria 2025
177 Ga0157372_10460585 3300013307 Unclassified 1482
178 Ga0157375_10014727 3300013308 Bacteria 6988
179 Ga0163163_10010324 3300014325 Bacteria 8394
180 Ga0163163_10208255 3300014325 Unclassified 2004
181 Ga0157380_10012533 3300014326 Bacteria 6152
182 Ga0182008_10269020 3300014497 Unclassified 884
183 Ga0157377_10054362 3300014745 Unclassified 2267
184 Ga0157379_10000468 3300014968 Bacteria 32782
185 Ga0157376_10004741 3300014969 Bacteria 9464
186 Ga0157376_10008607 3300014969 Bacteria 7375
187 Ga0228598_1018327 3300024227 Unclassified 1380
188 Ga0207656_10034848 3300025321 Unclassified 2104
189 Ga0207653_10000250 3300025885 Bacteria 34622
190 Ga0207692_10054116 3300025898 Bacteria 2047
191 Ga0207642_10028397 3300025899 Bacteria 2303
192 Ga0207647_10117014 3300025904 Unclassified 1574
193 Ga0207685_10003439 3300025905 Bacteria 3850
194 Ga0207685_10091516 3300025905 Bacteria 1282
195 Ga0207699_10011086 3300025906 Bacteria 4543
196 Ga0207699_10134447 3300025906 Bacteria 1617
197 Ga0207645_10459267 3300025907 Unclassified 860
198 Ga0207643_10100770 3300025908 Bacteria 1694
199 Ga0207705_10227654 3300025909 Bacteria 1417
200 Ga0207684_10000049 3300025910 Bacteria 240008
201 Ga0207684_10067876 3300025910 Bacteria 3031
202 Ga0207695_10143217 3300025913 Bacteria 2337
203 Ga0207671_10598539 3300025914 Unclassified 879
204 Ga0207693_10000325 3300025915 Bacteria 44161
205 Ga0207663_10007700 3300025916 Bacteria 5603
206 Ga0207663_10120293 3300025916 Bacteria 1797
207 Ga0207657_10000571 3300025919 Bacteria 39136
208 Ga0207646_10088013 3300025922 Bacteria 2779
209 Ga0207646_10179712 3300025922 Bacteria 1911
210 Ga0207646_10266453 3300025922 Bacteria 1548
211 Ga0207646_10569533 3300025922 Bacteria 1018
212 Ga0207687_10002822 3300025927 Bacteria 11780
213 Ga0207687_10008180 3300025927 Bacteria 6844
214 Ga0207700_10051394 3300025928 Unclassified 3076
215 Ga0207700_10065628 3300025928 Unclassified 2770
216 Ga0207700_10912230 3300025928 Bacteria 786
217 Ga0207664_10003452 3300025929 Bacteria 10537
218 Ga0207644_10070514 3300025931 Bacteria 2555
219 Ga0207644_10116008 3300025931 Bacteria 2031
220 Ga0207644_10187103 3300025931 Unclassified 1626
221 Ga0207690_10145560 3300025932 Bacteria 1751
222 Ga0207706_10013570 3300025933 Bacteria 7402
223 Ga0207706_10108464 3300025933 Bacteria 2443
224 Ga0207706_10256694 3300025933 Unclassified 1526
225 Ga0207686_10002346 3300025934 Bacteria 10346
226 Ga0207686_10029698 3300025934 Bacteria 3228
227 Ga0207670_10057829 3300025936 Unclassified 2631
228 Ga0207669_10025728 3300025937 Bacteria 3187
229 Ga0207665_10010778 3300025939 Bacteria 6001
230 Ga0207711_10000206 3300025941 Bacteria 62928
231 Ga0207711_11048406 3300025941 Bacteria 755
232 Ga0207689_10019545 3300025942 Bacteria 5708
233 Ga0207689_10028154 3300025942 Bacteria 4699
234 Ga0207661_10475784 3300025944 Bacteria 1140
235 Ga0207679_10504029 3300025945 Unclassified 1080
236 Ga0207667_10066432 3300025949 Bacteria 3759
237 Ga0207651_10008148 3300025960 Bacteria 5638
238 Ga0207640_10023530 3300025981 Unclassified 3703
239 Ga0207640_10032110 3300025981 Unclassified 3253
240 Ga0207640_10603037 3300025981 Unclassified 930
241 Ga0207677_10003987 3300026023 Bacteria 7876
242 Ga0207677_10349434 3300026023 Unclassified 1238
243 Ga0207703_10011006 3300026035 Bacteria 7049
244 Ga0207708_10657051 3300026075 Bacteria 893
245 Ga0207702_10052882 3300026078 Bacteria 3438
246 Ga0207641_10015244 3300026088 Bacteria 6298
247 Ga0207648_10040739 3300026089 Unclassified 4080
248 Ga0207676_10005992 3300026095 Bacteria 8576
249 Ga0207676_10007884 3300026095 Bacteria 7574
250 Ga0207676_10101217 3300026095 Unclassified 2389
251 Ga0207674_10277804 3300026116 Bacteria 1622
252 Ga0207675_101370642 3300026118 Bacteria 728
253 Ga0207683_10000671 3300026121 Bacteria 31464
254 Ga0207698_10265472 3300026142 Bacteria 1579
255 Ga0268266_10038167 3300028379 Unclassified 4090
256 Ga0268265_10702261 3300028380 Bacteria 977
257 Ga0268264_10010254 3300028381 Bacteria 7757
258 Ga0268264_10108576 3300028381 Unclassified 2426
259 Ga0265337_1055494 3300028556 Bacteria 1106
260 Ga0265338_10050693 3300028800 Bacteria 3748
261 Ga0265338_10070949 3300028800 Bacteria 2983
262 Ga0265325_10240750 3300031241 Bacteria 822
263 Ga0265339_10300106 3300031249 Bacteria 766
264 Ga0265316_10054941 3300031344 Bacteria 3117
265 Ga0307408_100463463 3300031548 Bacteria 1102
266 Ga0307408_100866263 3300031548 Bacteria 824
267 Ga0265313_10247164 3300031595 Bacteria 728
268 Ga0307405_10053683 3300031731 Bacteria 2512
269 Ga0307413_10036556 3300031824 Bacteria 2828
270 Ga0307410_10533804 3300031852 Bacteria 970
271 Ga0307406_10067607 3300031901 Bacteria 2330
272 Ga0307406_10106028 3300031901 Bacteria 1924
273 Ga0307407_10078186 3300031903 Bacteria 1992
274 Ga0307407_10152920 3300031903 Bacteria 1501
275 Ga0307412_10040888 3300031911 Bacteria 3002
276 Ga0307412_10694069 3300031911 Unclassified 873
277 Ga0307412_10848978 3300031911 Bacteria 796
278 Ga0307409_100054227 3300031995 Bacteria 3086
279 Ga0307409_100056072 3300031995 Bacteria 3046
280 Ga0307416_100003834 3300032002 Bacteria 8938
281 Ga0307416_100082689 3300032002 Unclassified 2721
282 Ga0307416_100919852 3300032002 Bacteria 975
283 Ga0307414_10016596 3300032004 Bacteria 4480
284 Ga0307414_10658547 3300032004 Bacteria 944
285 Ga0307411_10031452 3300032005 Bacteria 3266
286 Ga0307411_10040147 3300032005 Bacteria 2966
287 Ga0307415_100219542 3300032126 Unclassified 1523
288 Ga0307415_100774087 3300032126 Bacteria 873
289 Ga0373930_0013197 3300034816 Unclassified 1519
290 Ga0373948_0000219 3300034817 Bacteria 6713
291 Ga0373950_0000394 3300034818 Bacteria 5353
292 Ga0373959_0015083 3300034820 Unclassified 1415
293 Ga0373938_0020075 3300034957 Unclassified 1342
294 Ga0373928_0000623 3300035084 Bacteria 6964
295 Ga0373929_0000653 3300035085 Bacteria 6671
296 Ga0373934_0003806 3300035086 Bacteria 5558
297 Ga0373934_0264694 3300035086 Bacteria 711
298 Ga0373940_0006798 3300035088 Unclassified 2556
299 Ga0373949_0000327 3300035090 Bacteria 16860
300 Ga0373951_0002606 3300035091 Bacteria 4531
301 Ga0373952_0003341 3300035092 Unclassified 2892
302 Ga0373923_0014735 3300035111 Unclassified 2942
303 Ga0373923_0355507 3300035111 Unclassified 700
304 Ga0373932_0001349 3300035112 Bacteria 6873
305 Ga0373939_0002269 3300035114 Bacteria 4549
306 Ga0373939_0031294 3300035114 Bacteria 1537
307 Ga0373941_0000704 3300035115 Bacteria 6838
308 Ga0373945_0026707 3300035116 Unclassified 2012
309 Ga0373945_0103748 3300035116 Unclassified 1115
310 Ga0373953_0001566 3300035117 Bacteria 6680
311 Ga0373953_0263220 3300035117 Unclassified 750
312 Ga0373954_0169654 3300035118 Unclassified 1068
313 Ga0373957_0001063 3300035120 Bacteria 7250
314 Ga0373960_0052292 3300035121 Unclassified 1215
315 Ga0373943_0399313 3300035170 Unclassified 793
316 Ga0373946_0024078 3300035171 Unclassified 2383
317 Ga0373946_0171516 3300035171 Bacteria 1024
318 Ga0373955_0006836 3300035172 Bacteria 5213
319 Ga0373942_0000710 3300035207 Bacteria 9238
320 Ga0373961_0000847 3300035241 Bacteria 10330
321 Ga0373962_0000196 3300035242 Bacteria 12776
322 Ga0373924_0004984 3300035410 Bacteria 4673
323 Ga0373931_0000510 3300035691 Bacteria 15893
324 Ga0373935_0021336 3300035692 Bacteria 3965
325 Ga0373935_0046876 3300035692 Unclassified 2731
326 Ga0373935_0058964 3300035692 Bacteria 2452
327 Ga0373935_0279389 3300035692 Bacteria 1175
328 Ga0373927_0006638 3300035695 Bacteria 7876
329 Ga0373927_0008806 3300035695 Bacteria 6782
330 Ga0373927_0090853 3300035695 Unclassified 1983
331 Ga0373927_0231120 3300035695 Unclassified 1215
332 Ga0373933_0073024 3300035724 Bacteria 2090
333 Ga0373933_0127319 3300035724 Unclassified 1599
334 Ga0373947_0071464 3300035725 Unclassified 2128
335 Ga0373947_0151165 3300035725 Unclassified 1495
336 Ga0373937_0054268 3300036401 Bacteria 3677
337 Ga0373937_0264194 3300036401 Unclassified 1623
338 Ga0373937_1261569 3300036401 Unclassified 687
339 Ga0395900_0479406 3300037418 Bacteria 1197
340 Ga0439453_0069087 3300041408 Unclassified 744
341 Ga0451793_0241009 3300041452 Unclassified 902
342 Ga0451807_0458398 3300041486 Bacteria 1211
343 Ga0466961_0077934 3300044693 Bacteria 2099
344 Ga0466959_0114566 3300045049 Bacteria 1921
345 Ga0451576_0005025 3300045051 Bacteria 16797
346 Ga0451576_0075045 3300045051 Bacteria 3518
347 Ga0451576_0357608 3300045051 Bacteria 1529
348 Ga0495629_0026044 3300046459 Bacteria 4156
349 Ga0495580_0052677 3300046472 Bacteria 2873
350 Ga0495580_0069730 3300046472 Unclassified 2456
351 Ga0495580_0168427 3300046472 Bacteria 1515
352 Ga0495580_0344505 3300046472 Bacteria 1010
353 Ga0495582_0062661 3300046473 Bacteria 2054
354 Ga0495639_0007690 3300046475 Bacteria 4634
355 Ga0495662_0080706 3300046476 Unclassified 1582
356 Ga0495662_0109142 3300046476 Unclassified 1355
357 Ga0495594_0362699 3300046499 Unclassified 825
358 Ga0495628_0243692 3300046516 Unclassified 1344
359 Ga0495640_0059397 3300046533 Bacteria 2605
360 Ga0495586_0028975 3300046535 Unclassified 2964
361 Ga0495587_0119732 3300046536 Bacteria 1508
362 Ga0495621_0002732 3300046539 Bacteria 4786
363 Ga0495667_0243890 3300046559 Bacteria 1144
364 Ga0495634_0156675 3300046642 Unclassified 1438
365 Ga0495635_0058279 3300046663 Bacteria 2657
366 Ga0495635_0118392 3300046663 Bacteria 1807
367 Ga0495659_0069122 3300046664 Bacteria 1320
368 Ga0495588_0490519 3300046674 Unclassified 644
369 Ga0495657_0281958 3300046675 Unclassified 994
370 Ga0495647_0008488 3300046681 Bacteria 3455
371 Ga0495658_0016275 3300046683 Bacteria 3827
372 Ga0495669_0307956 3300046684 Unclassified 764
373 Ga0495613_0006348 3300046689 Bacteria 8843
374 Ga0495600_0023264 3300046809 Bacteria 3985
375 Ga0495581_0054621 3300047315 Bacteria 2305
376 Ga0495674_0250665 3300047319 Unclassified 1457
377 Ga0495684_0071441 3300047471 Unclassified 2637
378 Ga0496101_0033853 3300048904 Bacteria 3607
379 Ga0496102_0051232 3300048905 Bacteria 3761
380 Ga0496102_0134059 3300048905 Bacteria 2320
381 Ga0496102_0364727 3300048905 Bacteria 1360
382 Ga0496103_0307674 3300048906 Unclassified 1019
383 Ga0496104_0033047 3300048907 Bacteria 4816
384 Ga0496105_0012571 3300048908 Bacteria 6707
385 Ga0496106_0218967 3300048909 Bacteria 1518
386 Ga0496108_0246604 3300048911 Unclassified 1554
387 Ga0496108_0457295 3300048911 Bacteria 1115
388 Ga0496109_0002530 3300048912 Bacteria 15325
389 Ga0496109_0541464 3300048912 Bacteria 1098
390 Ga0496112_0004784 3300048915 Bacteria 11548
391 Ga0496112_0717784 3300048915 Unclassified 927
392 Ga0496112_1458809 3300048915 Bacteria 598
393 Ga0496113_0048855 3300048916 Bacteria 3149
394 Ga0496113_0182440 3300048916 Unclassified 1664
395 Ga0496114_0026486 3300048917 Bacteria 4747
396 Ga0496115_0156787 3300048918 Bacteria 1881
397 Ga0501292_034377 3300049515 Bacteria 861
398 Ga0501299_007746 3300049522 Bacteria 1724
399 Ga0501249_055889 3300049679 Bacteria 911
400 nmdc:mga05p37_13975_c1 3300050507 Bacteria 9626
401 nmdc:mga05p37_617091_c1 3300050507 Bacteria 1221
402 nmdc:mga09592_123408_c1 3300050508 Unclassified 2226
403 nmdc:mga09592_21961_c1 3300050508 Bacteria 5264
404 nmdc:mga0qj67_112442_c1 3300050509 Unclassified 2198
405 nmdc:mga06r32_225904_c1 3300050510 Bacteria 1861
406 nmdc:mga06r32_31820_c1 3300050510 Bacteria 4958
407 nmdc:mga0rr50_15323_c1 3300050513 Bacteria 5057
408 nmdc:mga0rr50_2687_c1 3300050513 Bacteria 10076
409 nmdc:mga0rr50_277427_c1 3300050513 Bacteria 1398
410 nmdc:mga0rr50_446680_c1 3300050513 Unclassified 1096
411 nmdc:mga0rr50_99906_c1 3300050513 Unclassified 2277
412 nmdc:mga08x19_29568_c1 3300050514 Bacteria 3437
413 nmdc:mga0a205_13000_c1 3300050515 Bacteria 7726
414 nmdc:mga0a205_14542_c1 3300050515 Bacteria 7343
415 nmdc:mga0a205_542293_c1 3300050515 Bacteria 1019
416 nmdc:mga0a205_950471_c1 3300050515 Unclassified 706
417 Ga0495619_0445758 3300053085 Unclassified 892
418 Ga0501084_0571641 3300054114 Bacteria 955
419 nmdc:mga0n895_25769_c1
420 Ga0065712_10080975
421 Ga0065712_10195209
422 Ga0065715_10144806
423 Ga0065707_10404870
424 Ga0070658_10002687
425 Ga0070690_100007889
426 Ga0070690_100293432
427 Ga0070670_100016001
428 Ga0068869_100073004
429 Ga0068869_100105354
430 Ga0070666_10002822
431 Ga0070666_10035016
432 Ga0070680_100059493
433 Ga0070682_100066752
434 Ga0068868_100003562
435 Ga0068868_100261764
436 Ga0070660_100796089
437 Ga0070689_100011605
438 Ga0070689_100165587
439 Ga0070687_100144231
440 Ga0070661_100025544
441 Ga0070661_100489151
442 Ga0070692_10030420
443 Ga0070669_101043965
444 Ga0070671_100116206
445 Ga0070671_100156474
446 Ga0070674_100068812
447 Ga0070673_100025802
448 Ga0070673_101527014
449 Ga0070688_100000683
450 Ga0070659_100684106
451 Ga0070667_100021133
452 Ga0070667_100160476
453 Ga0070703_10000196
454 Ga0070709_10010106
455 Ga0070709_10237425
456 Ga0070714_100005282
457 Ga0070713_100000967
458 Ga0070713_100051596
459 Ga0070713_101066919
460 Ga0070710_10055033
461 Ga0070710_10145728
462 Ga0070701_10019702
463 Ga0070711_100004919
464 Ga0070711_100095688
465 Ga0070705_100001698
466 Ga0070705_100030659
467 Ga0070705_100555248
468 Ga0070705_100613659
469 Ga0070700_100128485
470 Ga0070694_100048356
471 Ga0070694_100206433
472 Ga0070708_100019175
473 Ga0070708_100078855
474 Ga0070708_100102325
475 Ga0070678_100017778
476 Ga0070662_100024879
477 Ga0070662_100434145
478 Ga0070706_100000191
479 Ga0070707_100101209
480 Ga0070707_100120709
481 Ga0070707_100414136
482 Ga0070707_100509225
483 Ga0070707_100534961
484 Ga0070698_100102995
485 Ga0070698_100440891
486 Ga0070699_100012190
487 Ga0070699_100016158
488 Ga0070679_101533370
489 Ga0070684_100085367
490 Ga0070684_100620414
491 Ga0070697_100013676
492 Ga0070697_100081755
493 Ga0070697_100185945
494 Ga0068853_100926629
495 Ga0070686_100004985
496 Ga0070686_100078673
497 Ga0070686_100079495
498 Ga0070695_100584744
499 Ga0070696_100019853
500 Ga0070696_100232948
501 Ga0070696_100404247
502 Ga0070696_100729105
503 Ga0070693_100001226
504 Ga0070693_100005660
505 Ga0070693_101170899
506 Ga0070665_100011617
507 Ga0070704_100239386
508 Ga0070704_100378958
509 Ga0070664_100002451
510 Ga0070664_100305246
511 Ga0070664_101113395
512 Ga0068857_101563275
513 Ga0068854_100003182
514 Ga0068854_100014090
515 Ga0068854_100076126
516 Ga0068854_100645260
517 Ga0070702_100024316
518 Ga0070702_100757607
519 Ga0068852_100065770
520 Ga0068859_100001898
521 Ga0068859_100550718
522 Ga0068864_100003963
523 Ga0068864_100078094
524 Ga0068864_100180009
525 Ga0068864_100945899
526 Ga0068866_10082894
527 Ga0068851_10158162
528 Ga0068863_100006358
529 Ga0068858_100013260
530 Ga0068860_100016372
531 Ga0068860_100016610
532 Ga0081538_10022739
533 Ga0070715_10008013
534 Ga0070716_100003748
535 Ga0070712_100119980
536 Ga0097621_100005718
537 Ga0068871_100051606
538 Ga0068871_100130400
539 Ga0075428_100001716
540 Ga0075428_100034045
541 Ga0075430_101140066
542 Ga0075431_100015829
543 Ga0075431_100017346
544 Ga0075431_100976099
545 Ga0075433_10019786
546 Ga0075433_10155266
547 Ga0075434_100006791
548 Ga0075434_101019610
549 Ga0075429_100006899
550 Ga0068865_100143471
551 Ga0075436_100001492
552 Ga0075436_100103059
553 Ga0097620_100001898
554 Ga0097620_100550773
555 Ga0075435_100006613
556 Ga0075435_100030723
557 Ga0075435_100053829
558 Ga0075435_100478566
559 Ga0099795_10080000
560 Ga0105240_10080365
561 Ga0105240_10320028
562 Ga0111539_11065981
563 Ga0111539_11094755
564 Ga0105245_10005274
565 Ga0105245_10011568
566 Ga0105245_10142918
567 Ga0105247_10035120
568 Ga0114129_10019601
569 Ga0114129_11045448
570 Ga0114129_11969745
571 Ga0105243_10452724
572 Ga0105241_10008784
573 Ga0105241_10051611
574 Ga0105241_10065504
575 Ga0105242_10008835
576 Ga0105242_10123740
577 Ga0105242_11294091
578 Ga0105248_10035498
579 Ga0105248_10135683
580 Ga0105248_11192511
581 Ga0105238_10185235
582 Ga0105238_10581330
583 Ga0105239_10090642
584 Ga0105239_10364901
585 Ga0105246_10125988
586 Ga0157373_10188168
587 Ga0157369_10025028
588 Ga0157374_10004115
589 Ga0157378_10018467
590 Ga0157378_10087508
591 Ga0163162_10005903
592 Ga0163162_10066492
593 Ga0157372_10141575
594 Ga0157372_10257861
595 Ga0157372_10460585
596 Ga0157375_10014727
597 Ga0163163_10010324
598 Ga0163163_10208255
599 Ga0157380_10012533
600 Ga0182008_10269020
601 Ga0157377_10054362
602 Ga0157379_10000468
603 Ga0157376_10004741
604 Ga0157376_10008607
605 Ga0228598_1018327
606 Ga0207656_10034848
607 Ga0207653_10000250
608 Ga0207692_10054116
609 Ga0207642_10028397
610 Ga0207647_10117014
611 Ga0207685_10003439
612 Ga0207685_10091516
613 Ga0207699_10011086
614 Ga0207699_10134447
615 Ga0207645_10459267
616 Ga0207643_10100770
617 Ga0207705_10227654
618 Ga0207684_10000049
619 Ga0207684_10067876
620 Ga0207695_10143217
621 Ga0207671_10598539
622 Ga0207693_10000325
623 Ga0207663_10007700
624 Ga0207663_10120293
625 Ga0207657_10000571
626 Ga0207646_10088013
627 Ga0207646_10179712
628 Ga0207646_10266453
629 Ga0207646_10569533
630 Ga0207687_10002822
631 Ga0207687_10008180
632 Ga0207700_10051394
633 Ga0207700_10065628
634 Ga0207700_10912230
635 Ga0207664_10003452
636 Ga0207644_10070514
637 Ga0207644_10116008
638 Ga0207644_10187103
639 Ga0207690_10145560
640 Ga0207706_10013570
641 Ga0207706_10108464
642 Ga0207706_10256694
643 Ga0207686_10002346
644 Ga0207686_10029698
645 Ga0207670_10057829
646 Ga0207669_10025728
647 Ga0207665_10010778
648 Ga0207711_10000206
649 Ga0207711_11048406
650 Ga0207689_10019545
651 Ga0207689_10028154
652 Ga0207661_10475784
653 Ga0207679_10504029
654 Ga0207667_10066432
655 Ga0207651_10008148
656 Ga0207640_10023530
657 Ga0207640_10032110
658 Ga0207640_10603037
659 Ga0207677_10003987
660 Ga0207677_10349434
661 Ga0207703_10011006
662 Ga0207708_10657051
663 Ga0207702_10052882
664 Ga0207641_10015244
665 Ga0207648_10040739
666 Ga0207676_10005992
667 Ga0207676_10007884
668 Ga0207676_10101217
669 Ga0207674_10277804
670 Ga0207675_101370642
671 Ga0207683_10000671
672 Ga0207698_10265472
673 Ga0268266_10038167
674 Ga0268265_10702261
675 Ga0268264_10010254
676 Ga0268264_10108576
677 Ga0265337_1055494
678 Ga0265338_10050693
679 Ga0265338_10070949
680 Ga0265325_10240750
681 Ga0265339_10300106
682 Ga0265316_10054941
683 Ga0307408_100463463
684 Ga0307408_100866263
685 Ga0265313_10247164
686 Ga0307405_10053683
687 Ga0307413_10036556
688 Ga0307410_10533804
689 Ga0307406_10067607
690 Ga0307406_10106028
691 Ga0307407_10078186
692 Ga0307407_10152920
693 Ga0307412_10040888
694 Ga0307412_10694069
695 Ga0307412_10848978
696 Ga0307409_100054227
697 Ga0307409_100056072
698 Ga0307416_100003834
699 Ga0307416_100082689
700 Ga0307416_100919852
701 Ga0307414_10016596
702 Ga0307414_10658547
703 Ga0307411_10031452
704 Ga0307411_10040147
705 Ga0307415_100219542
706 Ga0307415_100774087
707 Ga0373930_0013197
708 Ga0373948_0000219
709 Ga0373950_0000394
710 Ga0373959_0015083
711 Ga0373938_0020075
712 Ga0373928_0000623
713 Ga0373929_0000653
714 Ga0373934_0003806
715 Ga0373934_0264694
716 Ga0373940_0006798
717 Ga0373949_0000327
718 Ga0373951_0002606
719 Ga0373952_0003341
720 Ga0373923_0014735
721 Ga0373923_0355507
722 Ga0373932_0001349
723 Ga0373939_0002269
724 Ga0373939_0031294
725 Ga0373941_0000704
726 Ga0373945_0026707
727 Ga0373945_0103748
728 Ga0373953_0001566
729 Ga0373953_0263220
730 Ga0373954_0169654
731 Ga0373957_0001063
732 Ga0373960_0052292
733 Ga0373943_0399313
734 Ga0373946_0024078
735 Ga0373946_0171516
736 Ga0373955_0006836
737 Ga0373942_0000710
738 Ga0373961_0000847
739 Ga0373962_0000196
740 Ga0373924_0004984
741 Ga0373931_0000510
742 Ga0373935_0021336
743 Ga0373935_0046876
744 Ga0373935_0058964
745 Ga0373935_0279389
746 Ga0373927_0006638
747 Ga0373927_0008806
748 Ga0373927_0090853
749 Ga0373927_0231120
750 Ga0373933_0073024
751 Ga0373933_0127319
752 Ga0373947_0071464
753 Ga0373947_0151165
754 Ga0373937_0054268
755 Ga0373937_0264194
756 Ga0373937_1261569
757 Ga0395900_0479406
758 Ga0439453_0069087
759 Ga0451793_0241009
760 Ga0451807_0458398
761 Ga0466961_0077934
762 Ga0466959_0114566
763 Ga0451576_0005025
764 Ga0451576_0075045
765 Ga0451576_0357608
766 Ga0495629_0026044
767 Ga0495580_0052677
768 Ga0495580_0069730
769 Ga0495580_0168427
770 Ga0495580_0344505
771 Ga0495582_0062661
772 Ga0495639_0007690
773 Ga0495662_0080706
774 Ga0495662_0109142
775 Ga0495594_0362699
776 Ga0495628_0243692
777 Ga0495640_0059397
778 Ga0495586_0028975
779 Ga0495587_0119732
780 Ga0495621_0002732
781 Ga0495667_0243890
782 Ga0495634_0156675
783 Ga0495635_0058279
784 Ga0495635_0118392
785 Ga0495659_0069122
786 Ga0495588_0490519
787 Ga0495657_0281958
788 Ga0495647_0008488
789 Ga0495658_0016275
790 Ga0495669_0307956
791 Ga0495613_0006348
792 Ga0495600_0023264
793 Ga0495581_0054621
794 Ga0495674_0250665
795 Ga0495684_0071441
796 Ga0496101_0033853
797 Ga0496102_0051232
798 Ga0496102_0134059
799 Ga0496102_0364727
800 Ga0496103_0307674
801 Ga0496104_0033047
802 Ga0496105_0012571
803 Ga0496106_0218967
804 Ga0496108_0246604
805 Ga0496108_0457295
806 Ga0496109_0002530
807 Ga0496109_0541464
808 Ga0496112_0004784
809 Ga0496112_0717784
810 Ga0496112_1458809
811 Ga0496113_0048855
812 Ga0496113_0182440
813 Ga0496114_0026486
814 Ga0496115_0156787
815 Ga0501292_034377
816 Ga0501299_007746
817 Ga0501249_055889
818 nmdc:mga05p37_13975_c1
819 nmdc:mga05p37_617091_c1
820 nmdc:mga09592_123408_c1
821 nmdc:mga09592_21961_c1
822 nmdc:mga0qj67_112442_c1
823 nmdc:mga06r32_225904_c1
824 nmdc:mga06r32_31820_c1
825 nmdc:mga0rr50_15323_c1
826 nmdc:mga0rr50_2687_c1
827 nmdc:mga0rr50_277427_c1
828 nmdc:mga0rr50_446680_c1
829 nmdc:mga0rr50_99906_c1
830 nmdc:mga08x19_29568_c1
831 nmdc:mga0a205_13000_c1
832 nmdc:mga0a205_14542_c1
833 nmdc:mga0a205_542293_c1
834 nmdc:mga0a205_950471_c1
835 Ga0495619_0445758
836 Ga0501084_0571641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.6093 102 182
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.552 97 182
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.5414 102 182
6e6t-assembly1.cif.gz_A dieckmann cyclase, ncmc, bound to cerulenin 0.427 109 178
5sv0-assembly1.cif.gz_B structure of the exbb/exbd complex from e. coli at ph 7.0 0.4216 92 183
ID Description Score Start End Superfamily
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6046 106 182 1.10.1760.20
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5339 11 182 1.20.120.550
af_A0A1D8PRT2_206_308_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.5311 102 173 1.10.1520.10
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.521 106 182 1.10.1760.20
af_Q7TP85_20_212_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.5135 83 143 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7Y4RLB5-F1-model_v4 DUF1761 domain-containing protein 0.9869 1 185 GO:0016020
AF-A0A2V6AUG6-F1-model_v4 DUF1761 domain-containing protein 0.9843 100 186 GO:0016020
AF-A0A3M1ADN1-F1-model_v4 DUF1761 domain-containing protein 0.982 1 186 GO:0016020
AF-A0A7Y2G1J1-F1-model_v4 DUF1761 domain-containing protein 0.9813 1 185 GO:0016020
AF-A0A800KL51-F1-model_v4 DUF1761 domain-containing protein 0.98 1 185 GO:0016020

Map