F439364

General Info

Members Datasets Scaffolds Average Seq Length
418 235 836 285

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0035716|Ga0495639_0035716_364_1323
Length 319
Sequence MGAMTCNVSGTGPSLYYEPKPSVDVYLIDGTYELFRHYYAVPSARDADGREVGAVRGVLTSLLGMMTVNTTYIGVATDHVIESFRNDLWAGYKTGEGIDPDLFAQFPLLEEMLSALGVAVWPMVEFEADDALAAAAERAAADPRVDRVYICTPDKDLAQSVRGERVVQLDRRMRTVRDEAGVVKRFGVPPASIPDYLALVGDNSDGYPGLAGWGAVSTAAVLAKYGHIESIPADWTAWHVNASRPSALAATLARDRDRALLFRDLATLRTDIPLFDSVDQLRWNGPTSAFQPLAARLDAAQHPPAPNPLRPQRRLAGPR

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
131 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
162 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 2.15
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0035716 3300046475 Bacteria 2224
2 Ga0065715_10183440 3300005293 Bacteria 1461
3 Ga0065715_10238497 3300005293 Bacteria 1208
4 Ga0065707_10012445 3300005295 Bacteria 2046
5 Ga0070658_10029559 3300005327 Bacteria 4402
6 Ga0070676_10001832 3300005328 Bacteria 10818
7 Ga0070683_100327122 3300005329 Bacteria 1459
8 Ga0070690_100006409 3300005330 Bacteria 6670
9 Ga0070670_100076740 3300005331 Bacteria 2871
10 Ga0070670_100132694 3300005331 Bacteria 2151
11 Ga0070670_100160445 3300005331 Unclassified 1948
12 Ga0070677_10176239 3300005333 Bacteria 1015
13 Ga0070666_10121828 3300005335 Bacteria 1809
14 Ga0068868_100427639 3300005338 Bacteria 1148
15 Ga0070689_100061906 3300005340 Bacteria 2910
16 Ga0070689_100120867 3300005340 Bacteria 2092
17 Ga0070691_10001319 3300005341 Bacteria 10544
18 Ga0070687_100009582 3300005343 Bacteria 4156
19 Ga0070661_100277141 3300005344 Bacteria 1300
20 Ga0070661_100394451 3300005344 Unclassified 1093
21 Ga0070668_100081111 3300005347 Bacteria 2543
22 Ga0070669_100033547 3300005353 Unclassified 3714
23 Ga0070669_100058706 3300005353 Bacteria 2824
24 Ga0070675_100006544 3300005354 Bacteria 8954
25 Ga0070675_100020177 3300005354 Bacteria 5318
26 Ga0070675_100043461 3300005354 Bacteria 3672
27 Ga0070671_100012998 3300005355 Bacteria 6710
28 Ga0070671_100051061 3300005355 Bacteria 3439
29 Ga0070671_100066025 3300005355 Bacteria 3015
30 Ga0070674_100007384 3300005356 Bacteria 6482
31 Ga0070674_100122211 3300005356 Bacteria 1929
32 Ga0070674_100358364 3300005356 Bacteria 1180
33 Ga0070674_100367983 3300005356 Bacteria 1166
34 Ga0070674_100373661 3300005356 Bacteria 1158
35 Ga0070673_100018270 3300005364 Bacteria 5004
36 Ga0070673_100073407 3300005364 Bacteria 2754
37 Ga0070673_100621626 3300005364 Bacteria 987
38 Ga0070688_100233750 3300005365 Bacteria 1302
39 Ga0070688_100437642 3300005365 Bacteria 975
40 Ga0070713_100022190 3300005436 Unclassified 4901
41 Ga0070705_100036361 3300005440 Unclassified 2768
42 Ga0070705_100123626 3300005440 Bacteria 1675
43 Ga0070708_100300496 3300005445 Bacteria 1511
44 Ga0070678_100013232 3300005456 Bacteria 5164
45 Ga0070678_100166229 3300005456 Bacteria 1792
46 Ga0070662_100349573 3300005457 Bacteria 1211
47 Ga0068867_100018181 3300005459 Bacteria 4995
48 Ga0070698_100030212 3300005471 Bacteria 5620
49 Ga0070699_100047798 3300005518 Bacteria 3702
50 Ga0070697_100286618 3300005536 Unclassified 1414
51 Ga0070672_100050845 3300005543 Bacteria 3230
52 Ga0070672_100084309 3300005543 Bacteria 2552
53 Ga0070672_100140650 3300005543 Bacteria 1990
54 Ga0070672_100265917 3300005543 Bacteria 1447
55 Ga0070686_100001028 3300005544 Bacteria 16042
56 Ga0070686_100056567 3300005544 Bacteria 2516
57 Ga0070686_100233637 3300005544 Bacteria 1335
58 Ga0070695_100014453 3300005545 Bacteria 4759
59 Ga0070695_100031161 3300005545 Bacteria 3324
60 Ga0070696_100008516 3300005546 Bacteria 6868
61 Ga0070665_100148405 3300005548 Bacteria 2347
62 Ga0070665_100225809 3300005548 Bacteria 1873
63 Ga0070704_100018525 3300005549 Bacteria 4454
64 Ga0070664_100041476 3300005564 Bacteria 3884
65 Ga0070664_100204789 3300005564 Unclassified 1762
66 Ga0070664_100211510 3300005564 Bacteria 1733
67 Ga0068854_100102407 3300005578 Bacteria 2148
68 Ga0070702_100001833 3300005615 Bacteria 8851
69 Ga0068866_10100023 3300005718 Bacteria 1598
70 Ga0068861_100114757 3300005719 Unclassified 2163
71 Ga0068863_100023252 3300005841 Bacteria 5923
72 Ga0068858_100304608 3300005842 Bacteria 1521
73 Ga0068858_100348874 3300005842 Bacteria 1417
74 Ga0068860_100208638 3300005843 Bacteria 1895
75 Ga0068860_100349553 3300005843 Bacteria 1455
76 Ga0068862_100045192 3300005844 Bacteria 3757
77 Ga0068862_100199661 3300005844 Bacteria 1803
78 Ga0081539_10000089 3300005985 Bacteria 212146
79 Ga0081539_10040199 3300005985 Bacteria 2748
80 Ga0070717_10003604 3300006028 Bacteria 11107
81 Ga0075432_10043125 3300006058 Bacteria 1580
82 Ga0070716_100094142 3300006173 Bacteria 1820
83 Ga0075367_10075855 3300006178 Bacteria 2028
84 Ga0075367_10086041 3300006178 Bacteria 1907
85 Ga0075366_10029785 3300006195 Bacteria 3207
86 Ga0075366_10047890 3300006195 Bacteria 2534
87 Ga0075366_10105987 3300006195 Bacteria 1690
88 Ga0097621_100106647 3300006237 Bacteria 2363
89 Ga0075428_100034864 3300006844 Bacteria 5549
90 Ga0075428_100242920 3300006844 Bacteria 1942
91 Ga0075430_100003846 3300006846 Bacteria 12639
92 Ga0075430_100038221 3300006846 Bacteria 4067
93 Ga0075430_100039788 3300006846 Bacteria 3980
94 Ga0075431_100010829 3300006847 Bacteria 9171
95 Ga0075431_100013533 3300006847 Bacteria 8244
96 Ga0075431_100106018 3300006847 Bacteria 2900
97 Ga0075431_100139334 3300006847 Bacteria 2501
98 Ga0075431_100251185 3300006847 Unclassified 1797
99 Ga0075431_100319392 3300006847 Bacteria 1566
100 Ga0075434_100295461 3300006871 Bacteria 1640
101 Ga0075429_100022105 3300006880 Bacteria 5516
102 Ga0075429_100029797 3300006880 Bacteria 4741
103 Ga0068865_100403561 3300006881 Unclassified 1120
104 Ga0075436_100000590 3300006914 Bacteria 23764
105 Ga0075436_100005851 3300006914 Bacteria 8447
106 Ga0075435_100000132 3300007076 Bacteria 41961
107 Ga0075435_100000370 3300007076 Bacteria 27562
108 Ga0075435_100055428 3300007076 Bacteria 3201
109 Ga0075435_100085310 3300007076 Bacteria 2599
110 Ga0105240_10171184 3300009093 Bacteria 2572
111 Ga0111539_10025788 3300009094 Bacteria 7199
112 Ga0111539_10131753 3300009094 Bacteria 2927
113 Ga0111539_10209742 3300009094 Bacteria 2270
114 Ga0105245_10007084 3300009098 Bacteria 9837
115 Ga0114129_10001928 3300009147 Bacteria 28353
116 Ga0114129_10002504 3300009147 Bacteria 25478
117 Ga0114129_10079577 3300009147 Bacteria 4557
118 Ga0114129_10196865 3300009147 Bacteria 2732
119 Ga0114129_10207323 3300009147 Bacteria 2652
120 Ga0114129_10996750 3300009147 Bacteria 1055
121 Ga0105243_10009242 3300009148 Bacteria 7527
122 Ga0105241_10135987 3300009174 Unclassified 1996
123 Ga0105242_10014175 3300009176 Bacteria 6173
124 Ga0105242_10023199 3300009176 Bacteria 4891
125 Ga0105242_10346339 3300009176 Bacteria 1371
126 Ga0105242_10363653 3300009176 Bacteria 1340
127 Ga0105248_10055787 3300009177 Bacteria 4433
128 Ga0105248_10210269 3300009177 Bacteria 2192
129 Ga0105248_10291938 3300009177 Bacteria 1836
130 Ga0105248_10362502 3300009177 Unclassified 1632
131 Ga0105248_10380269 3300009177 Bacteria 1590
132 Ga0105248_10763464 3300009177 Bacteria 1091
133 Ga0105249_10372704 3300009553 Bacteria 1452
134 Ga0157374_10546548 3300013296 Bacteria 1166
135 Ga0157378_10016524 3300013297 Bacteria 6463
136 Ga0157378_10368024 3300013297 Bacteria 1408
137 Ga0157375_10141015 3300013308 Bacteria 2537
138 Ga0157375_10630722 3300013308 Bacteria 1229
139 Ga0157375_10931654 3300013308 Bacteria 1011
140 Ga0157380_10018092 3300014326 Bacteria 5227
141 Ga0157380_10333627 3300014326 Bacteria 1411
142 Ga0157377_10158046 3300014745 Bacteria 1407
143 Ga0157376_10388856 3300014969 Bacteria 1346
144 Ga0157376_10433301 3300014969 Bacteria 1278
145 Ga0213875_10050916 3300021388 Bacteria 1940
146 Ga0207653_10091241 3300025885 Unclassified 1067
147 Ga0207682_10128278 3300025893 Bacteria 1130
148 Ga0207642_10136826 3300025899 Unclassified 1286
149 Ga0207680_10010801 3300025903 Bacteria 4584
150 Ga0207645_10003475 3300025907 Bacteria 11939
151 Ga0207705_10058611 3300025909 Bacteria 2778
152 Ga0207654_10032267 3300025911 Bacteria 2892
153 Ga0207707_10352254 3300025912 Bacteria 1268
154 Ga0207695_10057684 3300025913 Bacteria 4033
155 Ga0207649_10180834 3300025920 Bacteria 1476
156 Ga0207681_10054981 3300025923 Unclassified 2709
157 Ga0207681_10057581 3300025923 Bacteria 2657
158 Ga0207681_10128821 3300025923 Bacteria 1868
159 Ga0207694_10196153 3300025924 Bacteria 1642
160 Ga0207650_10030161 3300025925 Bacteria 3904
161 Ga0207650_10046306 3300025925 Bacteria 3203
162 Ga0207650_10286470 3300025925 Bacteria 1342
163 Ga0207659_10013110 3300025926 Bacteria 5300
164 Ga0207659_10041572 3300025926 Bacteria 3219
165 Ga0207700_10003320 3300025928 Bacteria 9331
166 Ga0207644_10023787 3300025931 Bacteria 4200
167 Ga0207644_10066618 3300025931 Bacteria 2623
168 Ga0207706_10484291 3300025933 Bacteria 1069
169 Ga0207686_10007112 3300025934 Bacteria 6020
170 Ga0207686_10386608 3300025934 Bacteria 1062
171 Ga0207709_10390094 3300025935 Bacteria 1062
172 Ga0207670_10054050 3300025936 Bacteria 2708
173 Ga0207670_10157204 3300025936 Unclassified 1693
174 Ga0207669_10095438 3300025937 Bacteria 1949
175 Ga0207669_10191623 3300025937 Bacteria 1475
176 Ga0207691_10013657 3300025940 Bacteria 7760
177 Ga0207691_10079533 3300025940 Bacteria 2950
178 Ga0207691_10096036 3300025940 Bacteria 2650
179 Ga0207691_10199610 3300025940 Bacteria 1741
180 Ga0207711_10024582 3300025941 Bacteria 5050
181 Ga0207711_10333191 3300025941 Bacteria 1404
182 Ga0207711_10618650 3300025941 Bacteria 1010
183 Ga0207661_10281707 3300025944 Bacteria 1486
184 Ga0207679_10159723 3300025945 Bacteria 1844
185 Ga0207679_10223929 3300025945 Bacteria 1584
186 Ga0207667_10230476 3300025949 Bacteria 1897
187 Ga0207651_10037465 3300025960 Bacteria 3177
188 Ga0207651_10051741 3300025960 Bacteria 2796
189 Ga0207651_10261092 3300025960 Bacteria 1422
190 Ga0207640_10003015 3300025981 Bacteria 9055
191 Ga0207677_10106123 3300026023 Bacteria 2080
192 Ga0207677_10249341 3300026023 Bacteria 1441
193 Ga0207703_10396660 3300026035 Bacteria 1279
194 Ga0207639_10649007 3300026041 Bacteria 976
195 Ga0207678_10167921 3300026067 Bacteria 1874
196 Ga0207708_10009327 3300026075 Bacteria 7265
197 Ga0207708_10176670 3300026075 Bacteria 1694
198 Ga0207708_10254646 3300026075 Bacteria 1416
199 Ga0207641_10114657 3300026088 Bacteria 2395
200 Ga0207648_10018100 3300026089 Bacteria 6382
201 Ga0207648_10020007 3300026089 Bacteria 6038
202 Ga0207674_10008657 3300026116 Bacteria 11722
203 Ga0207675_100030050 3300026118 Bacteria 5059
204 Ga0207675_100076478 3300026118 Bacteria 3135
205 Ga0207675_100212002 3300026118 Bacteria 1863
206 Ga0207675_100251871 3300026118 Bacteria 1709
207 Ga0207683_10038982 3300026121 Bacteria 4144
208 Ga0207683_10040451 3300026121 Bacteria 4068
209 Ga0207683_10113181 3300026121 Bacteria 2430
210 Ga0207428_10001052 3300027907 Bacteria 30380
211 Ga0268266_10038490 3300028379 Bacteria 4071
212 Ga0268266_10116721 3300028379 Bacteria 2371
213 Ga0268265_10022690 3300028380 Bacteria 4414
214 Ga0268265_10194334 3300028380 Bacteria 1755
215 Ga0268264_10553168 3300028381 Bacteria 1129
216 Ga0307408_100037924 3300031548 Bacteria 3397
217 Ga0307408_100051499 3300031548 Bacteria 2966
218 Ga0307408_100085720 3300031548 Bacteria 2366
219 Ga0307405_10031602 3300031731 Unclassified 3119
220 Ga0307413_10394680 3300031824 Bacteria 1082
221 Ga0307406_10458373 3300031901 Bacteria 1024
222 Ga0307412_10260988 3300031911 Bacteria 1350
223 Ga0307409_100035487 3300031995 Bacteria 3655
224 Ga0307409_100081029 3300031995 Bacteria 2622
225 Ga0307416_100011068 3300032002 Bacteria 5996
226 Ga0307416_100017849 3300032002 Bacteria 4979
227 Ga0307416_100301301 3300032002 Bacteria 1593
228 Ga0307416_100884025 3300032002 Bacteria 993
229 Ga0307411_10002684 3300032005 Bacteria 7978
230 Ga0307415_100021898 3300032126 Bacteria 3937
231 Ga0373930_0000833 3300034816 Bacteria 4377
232 Ga0373958_0001184 3300034819 Bacteria 3468
233 Ga0373959_0008822 3300034820 Bacteria 1725
234 Ga0373938_0000566 3300034957 Bacteria 5976
235 Ga0373928_0003029 3300035084 Bacteria 3228
236 Ga0373929_0000438 3300035085 Bacteria 7876
237 Ga0373949_0001198 3300035090 Bacteria 7691
238 Ga0373951_0000438 3300035091 Bacteria 12144
239 Ga0373952_0023549 3300035092 Bacteria 1316
240 Ga0373932_0001431 3300035112 Bacteria 6690
241 Ga0373939_0001806 3300035114 Bacteria 5149
242 Ga0373941_0000237 3300035115 Bacteria 10627
243 Ga0373945_0009630 3300035116 Bacteria 3168
244 Ga0373960_0000749 3300035121 Bacteria 6771
245 Ga0373943_0005069 3300035170 Bacteria 5939
246 Ga0373946_0024461 3300035171 Bacteria 2366
247 Ga0373946_0056526 3300035171 Bacteria 1657
248 Ga0373955_0153645 3300035172 Bacteria 1355
249 Ga0373942_0000601 3300035207 Bacteria 10108
250 Ga0373961_0001430 3300035241 Bacteria 7090
251 Ga0373962_0000229 3300035242 Bacteria 11793
252 Ga0373931_0029405 3300035691 Bacteria 2820
253 Ga0373935_0167562 3300035692 Bacteria 1501
254 Ga0373927_0000242 3300035695 Bacteria 42856
255 Ga0373947_0006518 3300035725 Bacteria 6772
256 Ga0373937_0099198 3300036401 Bacteria 2702
257 Ga0373937_0289963 3300036401 Bacteria 1546
258 Ga0373925_0000027 3300037068 Bacteria 154706
259 Ga0436364_0827572 3300037853 Bacteria 1562
260 Ga0436365_0808234 3300039437 Bacteria 2043
261 Ga0436363_1528337 3300039450 Bacteria 7967
262 Ga0451841_0842878 3300041498 Bacteria 3210
263 Ga0451849_0583858 3300041505 Bacteria 5831
264 Ga0451853_1182729 3300041512 Bacteria 10776
265 Ga0439450_023132 3300042008 Bacteria 1346
266 Ga0450895_001345 3300042132 Bacteria 1691
267 Ga0439435_0004543 3300042436 Bacteria 3000
268 Ga0439464_0007251 3300042439 Bacteria 2899
269 Ga0451576_0011162 3300045051 Bacteria 10241
270 Ga0495651_0373262 3300046462 Bacteria 937
271 Ga0495664_0063032 3300046477 Bacteria 2209
272 Ga0495608_0006706 3300046511 Bacteria 8164
273 Ga0495640_0232241 3300046533 Bacteria 1160
274 Ga0495598_0119311 3300046537 Bacteria 893
275 Ga0495667_0081226 3300046559 Bacteria 2107
276 Ga0495659_0107780 3300046664 Unclassified 1085
277 Ga0495658_0225984 3300046683 Bacteria 1173
278 Ga0495669_0031071 3300046684 Bacteria 2344
279 Ga0495613_0000862 3300046689 Bacteria 23262
280 Ga0495613_0083869 3300046689 Bacteria 2314
281 Ga0495600_0045550 3300046809 Bacteria 2862
282 Ga0495684_0002527 3300047471 Bacteria 14580
283 Ga0496102_0021907 3300048905 Bacteria 5658
284 Ga0496105_0099634 3300048908 Bacteria 2400
285 Ga0496106_0065968 3300048909 Bacteria 2756
286 Ga0496107_0144800 3300048910 Bacteria 1757
287 Ga0496107_0293022 3300048910 Bacteria 1211
288 Ga0496110_0073902 3300048913 Bacteria 3026
289 Ga0496112_0040281 3300048915 Bacteria 4568
290 Ga0496112_0578353 3300048915 Bacteria 1056
291 Ga0496113_0159836 3300048916 Bacteria 1781
292 Ga0501031_0005588 3300049568 Bacteria 8193
293 Ga0501032_0056504 3300049569 Bacteria 2638
294 Ga0501033_0046092 3300049570 Bacteria 3242
295 Ga0501033_0138135 3300049570 Bacteria 1763
296 Ga0501034_0143064 3300049571 Bacteria 2370
297 Ga0501034_0285888 3300049571 Bacteria 1588
298 Ga0501036_0000221 3300049572 Bacteria 38294
299 Ga0501036_0042411 3300049572 Bacteria 3852
300 Ga0501036_0202572 3300049572 Bacteria 1669
301 Ga0501036_0248190 3300049572 Bacteria 1492
302 Ga0501037_0053507 3300049573 Bacteria 2953
303 Ga0501038_0012764 3300049574 Bacteria 7674
304 Ga0501038_0026094 3300049574 Bacteria 5204
305 Ga0501039_0000788 3300049575 Bacteria 22794
306 Ga0501039_0002874 3300049575 Bacteria 12886
307 Ga0501040_0000471 3300049576 Bacteria 23955
308 Ga0501040_0005623 3300049576 Bacteria 8101
309 Ga0501040_0122766 3300049576 Bacteria 1823
310 Ga0501040_0156575 3300049576 Bacteria 1609
311 Ga0501041_0003061 3300049577 Bacteria 9599
312 Ga0501041_0043213 3300049577 Bacteria 2740
313 Ga0501042_0000138 3300049578 Bacteria 31848
314 Ga0501042_0000501 3300049578 Bacteria 20351
315 Ga0501043_0025021 3300049579 Bacteria 4684
316 Ga0501043_0164302 3300049579 Bacteria 1734
317 Ga0501046_0000494 3300049580 Bacteria 39283
318 Ga0501046_0005736 3300049580 Bacteria 11080
319 Ga0501047_0072024 3300049581 Bacteria 3326
320 Ga0501048_0001294 3300049582 Bacteria 18985
321 Ga0501048_0031357 3300049582 Bacteria 3845
322 Ga0501048_0113568 3300049582 Bacteria 1913
323 Ga0501067_0010892 3300049583 Bacteria 5033
324 Ga0501068_0003149 3300049584 Bacteria 8835
325 Ga0501068_0021381 3300049584 Bacteria 3777
326 Ga0501069_0123877 3300049585 Bacteria 1477
327 Ga0501069_0174508 3300049585 Bacteria 1241
328 Ga0501070_0017256 3300049586 Bacteria 6062
329 Ga0501071_0000169 3300049587 Bacteria 28314
330 Ga0501071_0000692 3300049587 Bacteria 17636
331 Ga0501071_0119392 3300049587 Bacteria 1954
332 Ga0501072_0001908 3300049588 Bacteria 15523
333 Ga0501072_0008873 3300049588 Bacteria 7639
334 Ga0501072_0078718 3300049588 Bacteria 2610
335 Ga0501072_0448193 3300049588 Bacteria 1022
336 Ga0501073_0055496 3300049589 Unclassified 2772
337 Ga0501073_0149089 3300049589 Bacteria 1621
338 Ga0501074_0013522 3300049590 Bacteria 5932
339 Ga0501074_0026626 3300049590 Bacteria 4193
340 Ga0501074_0081970 3300049590 Bacteria 2314
341 Ga0501075_0007399 3300049591 Bacteria 7618
342 Ga0501075_0009540 3300049591 Bacteria 6794
343 Ga0501075_0208102 3300049591 Bacteria 1492
344 Ga0501076_0000190 3300049592 Bacteria 36750
345 Ga0501076_0001052 3300049592 Bacteria 18111
346 Ga0501076_0012837 3300049592 Bacteria 6269
347 Ga0501076_0106535 3300049592 Bacteria 2263
348 Ga0501076_0281511 3300049592 Bacteria 1362
349 Ga0501077_0002612 3300049593 Bacteria 10787
350 Ga0501077_0003204 3300049593 Bacteria 9857
351 Ga0501077_0212307 3300049593 Bacteria 1230
352 Ga0501079_0000743 3300049741 Bacteria 22128
353 Ga0501079_0045662 3300049741 Bacteria 3380
354 Ga0501079_0190020 3300049741 Unclassified 1603
355 Ga0501080_0027677 3300049742 Bacteria 5271
356 Ga0501080_0049569 3300049742 Bacteria 3908
357 Ga0501080_0229374 3300049742 Bacteria 1698
358 Ga0501081_0000600 3300049743 Bacteria 20561
359 Ga0501081_0002055 3300049743 Bacteria 12558
360 Ga0501081_0388939 3300049743 Bacteria 1031
361 Ga0501035_0017069 3300049822 Bacteria 6688
362 Ga0501044_0010080 3300049823 Bacteria 10271
363 Ga0501045_0001815 3300049824 Bacteria 14433
364 Ga0501045_0002439 3300049824 Bacteria 12640
365 Ga0501045_0132372 3300049824 Bacteria 1854
366 Ga0501045_0149916 3300049824 Bacteria 1735
367 nmdc:mga0k408_133848_c1 3300050493 Bacteria 1472
368 nmdc:mga0k408_171751_c1 3300050493 Bacteria 1292
369 nmdc:mga0k408_30220_c1 3300050493 Bacteria 3088
370 nmdc:mga0k408_75167_c1 3300050493 Bacteria 1974
371 nmdc:mga05p37_117645_c1 3300050507 Bacteria 3266
372 nmdc:mga05p37_252425_c1 3300050507 Bacteria 2115
373 nmdc:mga05p37_436_c1 3300050507 Bacteria 45285
374 nmdc:mga05p37_85_c1 3300050507 Bacteria 83588
375 nmdc:mga09592_21336_c1 3300050508 Bacteria 5339
376 nmdc:mga09592_272687_c1 3300050508 Bacteria 1467
377 nmdc:mga09592_33308_c1 3300050508 Bacteria 4300
378 nmdc:mga09592_56820_c1 3300050508 Unclassified 3307
379 nmdc:mga09592_75928_c1 3300050508 Bacteria 2858
380 nmdc:mga0qj67_14245_c1 3300050509 Bacteria 6009
381 nmdc:mga0qj67_221068_c1 3300050509 Bacteria 1538
382 nmdc:mga0qj67_79930_c1 3300050509 Bacteria 2619
383 nmdc:mga06r32_12519_c1 3300050510 Bacteria 7656
384 nmdc:mga06r32_225498_c1 3300050510 Unclassified 1862
385 nmdc:mga06r32_63849_c1 3300050510 Bacteria 3550
386 nmdc:mga06r32_96080_c1 3300050510 Bacteria 2901
387 nmdc:mga08y16_12595_c1 3300050511 Bacteria 8896
388 nmdc:mga08y16_1779_c1 3300050511 Bacteria 21818
389 nmdc:mga08y16_28955_c1 3300050511 Bacteria 5838
390 nmdc:mga08y16_356776_c1 3300050511 Unclassified 1501
391 nmdc:mga08y16_501222_c1 3300050511 Bacteria 1233
392 nmdc:mga08y16_62288_c1 3300050511 Bacteria 3895
393 nmdc:mga0n895_187530_c1 3300050512 Bacteria 2099
394 nmdc:mga0n895_364196_c1 3300050512 Bacteria 1464
395 nmdc:mga0n895_64_c1 3300050512 Bacteria 62327
396 nmdc:mga0rr50_101_c1 3300050513 Bacteria 48216
397 nmdc:mga0rr50_87_c1 3300050513 Bacteria 52403
398 nmdc:mga0rr50_89867_c1 3300050513 Bacteria 2389
399 nmdc:mga08x19_126_c1 3300050514 Bacteria 67080
400 nmdc:mga08x19_19881_c1 3300050514 Bacteria 4128
401 nmdc:mga08x19_240068_c1 3300050514 Bacteria 1249
402 nmdc:mga08x19_59334_c1 3300050514 Bacteria 2477
403 nmdc:mga0a205_11786_c1 3300050515 Bacteria 8067
404 nmdc:mga0a205_198872_c1 3300050515 Bacteria 1895
405 Ga0495601_0050487 3300053077 Bacteria 2623
406 Ga0495619_0003672 3300053085 Bacteria 9891
407 Ga0501084_0000799 3300054114 Bacteria 24093
408 Ga0501084_0027541 3300054114 Bacteria 4748
409 Ga0590071_000404 3300059421 Bacteria 12682
410 Ga0590074_000781 3300059423 Bacteria 4889
411 Ga0590075_000146 3300059424 Bacteria 18748
412 Ga0590077_000074 3300059426 Bacteria 24920
413 Ga0501082_0011027 3300060353 Bacteria 7772
414 Ga0501082_0011720 3300060353 Bacteria 7537
415 Ga0501082_0075169 3300060353 Bacteria 2911
416 Ga0501082_0248134 3300060353 Bacteria 1549
417 Ga0530510_0001024 3300061734 Bacteria 18504
418 Ga0530510_0054633 3300061734 Bacteria 2886
419 Ga0495639_0035716
420 Ga0065715_10183440
421 Ga0065715_10238497
422 Ga0065707_10012445
423 Ga0070658_10029559
424 Ga0070676_10001832
425 Ga0070683_100327122
426 Ga0070690_100006409
427 Ga0070670_100076740
428 Ga0070670_100132694
429 Ga0070670_100160445
430 Ga0070677_10176239
431 Ga0070666_10121828
432 Ga0068868_100427639
433 Ga0070689_100061906
434 Ga0070689_100120867
435 Ga0070691_10001319
436 Ga0070687_100009582
437 Ga0070661_100277141
438 Ga0070661_100394451
439 Ga0070668_100081111
440 Ga0070669_100033547
441 Ga0070669_100058706
442 Ga0070675_100006544
443 Ga0070675_100020177
444 Ga0070675_100043461
445 Ga0070671_100012998
446 Ga0070671_100051061
447 Ga0070671_100066025
448 Ga0070674_100007384
449 Ga0070674_100122211
450 Ga0070674_100358364
451 Ga0070674_100367983
452 Ga0070674_100373661
453 Ga0070673_100018270
454 Ga0070673_100073407
455 Ga0070673_100621626
456 Ga0070688_100233750
457 Ga0070688_100437642
458 Ga0070713_100022190
459 Ga0070705_100036361
460 Ga0070705_100123626
461 Ga0070708_100300496
462 Ga0070678_100013232
463 Ga0070678_100166229
464 Ga0070662_100349573
465 Ga0068867_100018181
466 Ga0070698_100030212
467 Ga0070699_100047798
468 Ga0070697_100286618
469 Ga0070672_100050845
470 Ga0070672_100084309
471 Ga0070672_100140650
472 Ga0070672_100265917
473 Ga0070686_100001028
474 Ga0070686_100056567
475 Ga0070686_100233637
476 Ga0070695_100014453
477 Ga0070695_100031161
478 Ga0070696_100008516
479 Ga0070665_100148405
480 Ga0070665_100225809
481 Ga0070704_100018525
482 Ga0070664_100041476
483 Ga0070664_100204789
484 Ga0070664_100211510
485 Ga0068854_100102407
486 Ga0070702_100001833
487 Ga0068866_10100023
488 Ga0068861_100114757
489 Ga0068863_100023252
490 Ga0068858_100304608
491 Ga0068858_100348874
492 Ga0068860_100208638
493 Ga0068860_100349553
494 Ga0068862_100045192
495 Ga0068862_100199661
496 Ga0081539_10000089
497 Ga0081539_10040199
498 Ga0070717_10003604
499 Ga0075432_10043125
500 Ga0070716_100094142
501 Ga0075367_10075855
502 Ga0075367_10086041
503 Ga0075366_10029785
504 Ga0075366_10047890
505 Ga0075366_10105987
506 Ga0097621_100106647
507 Ga0075428_100034864
508 Ga0075428_100242920
509 Ga0075430_100003846
510 Ga0075430_100038221
511 Ga0075430_100039788
512 Ga0075431_100010829
513 Ga0075431_100013533
514 Ga0075431_100106018
515 Ga0075431_100139334
516 Ga0075431_100251185
517 Ga0075431_100319392
518 Ga0075434_100295461
519 Ga0075429_100022105
520 Ga0075429_100029797
521 Ga0068865_100403561
522 Ga0075436_100000590
523 Ga0075436_100005851
524 Ga0075435_100000132
525 Ga0075435_100000370
526 Ga0075435_100055428
527 Ga0075435_100085310
528 Ga0105240_10171184
529 Ga0111539_10025788
530 Ga0111539_10131753
531 Ga0111539_10209742
532 Ga0105245_10007084
533 Ga0114129_10001928
534 Ga0114129_10002504
535 Ga0114129_10079577
536 Ga0114129_10196865
537 Ga0114129_10207323
538 Ga0114129_10996750
539 Ga0105243_10009242
540 Ga0105241_10135987
541 Ga0105242_10014175
542 Ga0105242_10023199
543 Ga0105242_10346339
544 Ga0105242_10363653
545 Ga0105248_10055787
546 Ga0105248_10210269
547 Ga0105248_10291938
548 Ga0105248_10362502
549 Ga0105248_10380269
550 Ga0105248_10763464
551 Ga0105249_10372704
552 Ga0157374_10546548
553 Ga0157378_10016524
554 Ga0157378_10368024
555 Ga0157375_10141015
556 Ga0157375_10630722
557 Ga0157375_10931654
558 Ga0157380_10018092
559 Ga0157380_10333627
560 Ga0157377_10158046
561 Ga0157376_10388856
562 Ga0157376_10433301
563 Ga0213875_10050916
564 Ga0207653_10091241
565 Ga0207682_10128278
566 Ga0207642_10136826
567 Ga0207680_10010801
568 Ga0207645_10003475
569 Ga0207705_10058611
570 Ga0207654_10032267
571 Ga0207707_10352254
572 Ga0207695_10057684
573 Ga0207649_10180834
574 Ga0207681_10054981
575 Ga0207681_10057581
576 Ga0207681_10128821
577 Ga0207694_10196153
578 Ga0207650_10030161
579 Ga0207650_10046306
580 Ga0207650_10286470
581 Ga0207659_10013110
582 Ga0207659_10041572
583 Ga0207700_10003320
584 Ga0207644_10023787
585 Ga0207644_10066618
586 Ga0207706_10484291
587 Ga0207686_10007112
588 Ga0207686_10386608
589 Ga0207709_10390094
590 Ga0207670_10054050
591 Ga0207670_10157204
592 Ga0207669_10095438
593 Ga0207669_10191623
594 Ga0207691_10013657
595 Ga0207691_10079533
596 Ga0207691_10096036
597 Ga0207691_10199610
598 Ga0207711_10024582
599 Ga0207711_10333191
600 Ga0207711_10618650
601 Ga0207661_10281707
602 Ga0207679_10159723
603 Ga0207679_10223929
604 Ga0207667_10230476
605 Ga0207651_10037465
606 Ga0207651_10051741
607 Ga0207651_10261092
608 Ga0207640_10003015
609 Ga0207677_10106123
610 Ga0207677_10249341
611 Ga0207703_10396660
612 Ga0207639_10649007
613 Ga0207678_10167921
614 Ga0207708_10009327
615 Ga0207708_10176670
616 Ga0207708_10254646
617 Ga0207641_10114657
618 Ga0207648_10018100
619 Ga0207648_10020007
620 Ga0207674_10008657
621 Ga0207675_100030050
622 Ga0207675_100076478
623 Ga0207675_100212002
624 Ga0207675_100251871
625 Ga0207683_10038982
626 Ga0207683_10040451
627 Ga0207683_10113181
628 Ga0207428_10001052
629 Ga0268266_10038490
630 Ga0268266_10116721
631 Ga0268265_10022690
632 Ga0268265_10194334
633 Ga0268264_10553168
634 Ga0307408_100037924
635 Ga0307408_100051499
636 Ga0307408_100085720
637 Ga0307405_10031602
638 Ga0307413_10394680
639 Ga0307406_10458373
640 Ga0307412_10260988
641 Ga0307409_100035487
642 Ga0307409_100081029
643 Ga0307416_100011068
644 Ga0307416_100017849
645 Ga0307416_100301301
646 Ga0307416_100884025
647 Ga0307411_10002684
648 Ga0307415_100021898
649 Ga0373930_0000833
650 Ga0373958_0001184
651 Ga0373959_0008822
652 Ga0373938_0000566
653 Ga0373928_0003029
654 Ga0373929_0000438
655 Ga0373949_0001198
656 Ga0373951_0000438
657 Ga0373952_0023549
658 Ga0373932_0001431
659 Ga0373939_0001806
660 Ga0373941_0000237
661 Ga0373945_0009630
662 Ga0373960_0000749
663 Ga0373943_0005069
664 Ga0373946_0024461
665 Ga0373946_0056526
666 Ga0373955_0153645
667 Ga0373942_0000601
668 Ga0373961_0001430
669 Ga0373962_0000229
670 Ga0373931_0029405
671 Ga0373935_0167562
672 Ga0373927_0000242
673 Ga0373947_0006518
674 Ga0373937_0099198
675 Ga0373937_0289963
676 Ga0373925_0000027
677 Ga0436364_0827572
678 Ga0436365_0808234
679 Ga0436363_1528337
680 Ga0451841_0842878
681 Ga0451849_0583858
682 Ga0451853_1182729
683 Ga0439450_023132
684 Ga0450895_001345
685 Ga0439435_0004543
686 Ga0439464_0007251
687 Ga0451576_0011162
688 Ga0495651_0373262
689 Ga0495664_0063032
690 Ga0495608_0006706
691 Ga0495640_0232241
692 Ga0495598_0119311
693 Ga0495667_0081226
694 Ga0495659_0107780
695 Ga0495658_0225984
696 Ga0495669_0031071
697 Ga0495613_0000862
698 Ga0495613_0083869
699 Ga0495600_0045550
700 Ga0495684_0002527
701 Ga0496102_0021907
702 Ga0496105_0099634
703 Ga0496106_0065968
704 Ga0496107_0144800
705 Ga0496107_0293022
706 Ga0496110_0073902
707 Ga0496112_0040281
708 Ga0496112_0578353
709 Ga0496113_0159836
710 Ga0501031_0005588
711 Ga0501032_0056504
712 Ga0501033_0046092
713 Ga0501033_0138135
714 Ga0501034_0143064
715 Ga0501034_0285888
716 Ga0501036_0000221
717 Ga0501036_0042411
718 Ga0501036_0202572
719 Ga0501036_0248190
720 Ga0501037_0053507
721 Ga0501038_0012764
722 Ga0501038_0026094
723 Ga0501039_0000788
724 Ga0501039_0002874
725 Ga0501040_0000471
726 Ga0501040_0005623
727 Ga0501040_0122766
728 Ga0501040_0156575
729 Ga0501041_0003061
730 Ga0501041_0043213
731 Ga0501042_0000138
732 Ga0501042_0000501
733 Ga0501043_0025021
734 Ga0501043_0164302
735 Ga0501046_0000494
736 Ga0501046_0005736
737 Ga0501047_0072024
738 Ga0501048_0001294
739 Ga0501048_0031357
740 Ga0501048_0113568
741 Ga0501067_0010892
742 Ga0501068_0003149
743 Ga0501068_0021381
744 Ga0501069_0123877
745 Ga0501069_0174508
746 Ga0501070_0017256
747 Ga0501071_0000169
748 Ga0501071_0000692
749 Ga0501071_0119392
750 Ga0501072_0001908
751 Ga0501072_0008873
752 Ga0501072_0078718
753 Ga0501072_0448193
754 Ga0501073_0055496
755 Ga0501073_0149089
756 Ga0501074_0013522
757 Ga0501074_0026626
758 Ga0501074_0081970
759 Ga0501075_0007399
760 Ga0501075_0009540
761 Ga0501075_0208102
762 Ga0501076_0000190
763 Ga0501076_0001052
764 Ga0501076_0012837
765 Ga0501076_0106535
766 Ga0501076_0281511
767 Ga0501077_0002612
768 Ga0501077_0003204
769 Ga0501077_0212307
770 Ga0501079_0000743
771 Ga0501079_0045662
772 Ga0501079_0190020
773 Ga0501080_0027677
774 Ga0501080_0049569
775 Ga0501080_0229374
776 Ga0501081_0000600
777 Ga0501081_0002055
778 Ga0501081_0388939
779 Ga0501035_0017069
780 Ga0501044_0010080
781 Ga0501045_0001815
782 Ga0501045_0002439
783 Ga0501045_0132372
784 Ga0501045_0149916
785 nmdc:mga0k408_133848_c1
786 nmdc:mga0k408_171751_c1
787 nmdc:mga0k408_30220_c1
788 nmdc:mga0k408_75167_c1
789 nmdc:mga05p37_117645_c1
790 nmdc:mga05p37_252425_c1
791 nmdc:mga05p37_436_c1
792 nmdc:mga05p37_85_c1
793 nmdc:mga09592_21336_c1
794 nmdc:mga09592_272687_c1
795 nmdc:mga09592_33308_c1
796 nmdc:mga09592_56820_c1
797 nmdc:mga09592_75928_c1
798 nmdc:mga0qj67_14245_c1
799 nmdc:mga0qj67_221068_c1
800 nmdc:mga0qj67_79930_c1
801 nmdc:mga06r32_12519_c1
802 nmdc:mga06r32_225498_c1
803 nmdc:mga06r32_63849_c1
804 nmdc:mga06r32_96080_c1
805 nmdc:mga08y16_12595_c1
806 nmdc:mga08y16_1779_c1
807 nmdc:mga08y16_28955_c1
808 nmdc:mga08y16_356776_c1
809 nmdc:mga08y16_501222_c1
810 nmdc:mga08y16_62288_c1
811 nmdc:mga0n895_187530_c1
812 nmdc:mga0n895_364196_c1
813 nmdc:mga0n895_64_c1
814 nmdc:mga0rr50_101_c1
815 nmdc:mga0rr50_87_c1
816 nmdc:mga0rr50_89867_c1
817 nmdc:mga08x19_126_c1
818 nmdc:mga08x19_19881_c1
819 nmdc:mga08x19_240068_c1
820 nmdc:mga08x19_59334_c1
821 nmdc:mga0a205_11786_c1
822 nmdc:mga0a205_198872_c1
823 Ga0495601_0050487
824 Ga0495619_0003672
825 Ga0501084_0000799
826 Ga0501084_0027541
827 Ga0590071_000404
828 Ga0590074_000781
829 Ga0590075_000146
830 Ga0590077_000074
831 Ga0501082_0011027
832 Ga0501082_0011720
833 Ga0501082_0075169
834 Ga0501082_0248134
835 Ga0530510_0001024
836 Ga0530510_0054633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

188

289

0.9

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

24

187

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zdb-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, di-magnesium and potassium 0.8563 2 262
3zda-assembly1.cif.gz_A structure of e. coli exoix in complex with a fragment of the flap1 dna oligonucleotide, potassium and magnesium 0.8561 1 262
3zdd-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov6 oligonucleotide and potassium 0.8554 1 262
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8547 1 262
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.8505 2 277
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8784 3 166 3.40.50.1010
af_Q2FYJ1_1_174_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8626 2 166 3.40.50.1010
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.862 2 165 3.40.50.1010
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.85 2 165 3.40.50.1010
af_O96139_99_238_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8374 1 111 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2Z5FSK1-F1-model_v4 DNA polymerase I 5'-3' exonuclease domain 0.9971 2 278 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A143PJV4-F1-model_v4 DNA polymerase I (EC 2.7.7.7) 0.9959 1 280 GO:0003677
GO:0003887
GO:0008409
GO:0017108
GO:0033567
AF-A0A6N8V103-F1-model_v4 Flap endonuclease 0.9942 1 276 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7X4EJ50-F1-model_v4 Flap endonuclease 0.994 1 276 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7C7WJV8-F1-model_v4 Flap endonuclease 0.9933 1 276 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map