F439326

General Info

Members Datasets Scaffolds Average Seq Length
418 214 836 410

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10332012|Ga0207674_103320121
Length 431
Sequence LPLLERTRVEIYLPDLPSPEYQKLLRSFEQELTYAFGGASLGLARRLGLPFLLSQAALANAADQRNDNRILVIFELSGGNDGLNTVVPYADDAYYGARPQIGIKPKALRKIDEHFGFSPGMAGFETLYKDGKLAIVHGCGYENPSFSHFTSMAYWHTAAPNSGEEYGWVGRLADAMDPDPKPNYIVNIDATQSLAVRSRLHTPVVFDDPEKFTRNAFFNEKPLLTQVAEAEASTVNPTQRYLLDVARSAQEASALVRQAWAKYKTPIDYGIVSLNLAKVAALIDAGMPTRLYYVAFRNNAFDTHVQQADLHRRLLTYASDAVYGFMRDMERIGRADDVSMMIFSEFGRRVPENTSQGTDHGAANNMFLVGKHVRGGHYGEIPSLTKLDALDNLAYTTDFRRVYATVMQGWLGFSNTSSVLRGEFAPFPVFS

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.48
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 0.48
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 11.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10332012 3300026116 Bacteria 1470
2 Ga0058863_10047659 3300004799 Bacteria 2841
3 Ga0058862_12630550 3300004803 Bacteria 1476
4 Ga0070658_10001759 3300005327 Bacteria 18230
5 Ga0070658_10025623 3300005327 Bacteria 4727
6 Ga0070683_100003327 3300005329 Bacteria 12997
7 Ga0070683_100009936 3300005329 Bacteria 8159
8 Ga0070683_100023143 3300005329 Bacteria 5555
9 Ga0070683_100035277 3300005329 Unclassified 4572
10 Ga0070683_100096144 3300005329 Unclassified 2786
11 Ga0070690_100005095 3300005330 Bacteria 7359
12 Ga0070677_10037853 3300005333 Bacteria 1884
13 Ga0068869_100000524 3300005334 Bacteria 21367
14 Ga0068869_100120926 3300005334 Bacteria 2003
15 Ga0070680_100067577 3300005336 Unclassified 2932
16 Ga0070682_100068227 3300005337 Bacteria 2267
17 Ga0068868_100007433 3300005338 Bacteria 7800
18 Ga0068868_100015384 3300005338 Bacteria 5657
19 Ga0068868_100126728 3300005338 Bacteria 2086
20 Ga0070689_100002939 3300005340 Bacteria 11208
21 Ga0070691_10000535 3300005341 Bacteria 14335
22 Ga0070668_100227895 3300005347 Bacteria 1539
23 Ga0070671_100045884 3300005355 Bacteria 3633
24 Ga0070674_100091223 3300005356 Unclassified 2200
25 Ga0070673_100069696 3300005364 Bacteria 2819
26 Ga0070673_100170638 3300005364 Unclassified 1857
27 Ga0070659_100039826 3300005366 Bacteria 3670
28 Ga0070667_100090867 3300005367 Bacteria 2625
29 Ga0070667_100255702 3300005367 Bacteria 1567
30 Ga0070714_100002237 3300005435 Bacteria 14233
31 Ga0070714_100027953 3300005435 Bacteria 4674
32 Ga0070713_100003610 3300005436 Bacteria 10230
33 Ga0070713_100004458 3300005436 Bacteria 9407
34 Ga0070713_100011924 3300005436 Bacteria 6356
35 Ga0070710_10163275 3300005437 Bacteria 1383
36 Ga0070701_10000275 3300005438 Bacteria 16779
37 Ga0070711_100024182 3300005439 Bacteria 3959
38 Ga0070711_100029390 3300005439 Bacteria 3626
39 Ga0070700_100000379 3300005441 Bacteria 22793
40 Ga0070700_100075811 3300005441 Bacteria 2158
41 Ga0070694_100020391 3300005444 Archaea 4225
42 Ga0070708_100189014 3300005445 Bacteria 1926
43 Ga0070678_100307592 3300005456 Bacteria 1349
44 Ga0070681_10012532 3300005458 Bacteria 8414
45 Ga0070681_10031418 3300005458 Bacteria 5332
46 Ga0070681_10044698 3300005458 Bacteria 4434
47 Ga0070681_10055377 3300005458 Bacteria 3948
48 Ga0070681_10115207 3300005458 Bacteria 2626
49 Ga0070681_10156221 3300005458 Bacteria 2206
50 Ga0068867_100000191 3300005459 Bacteria 40494
51 Ga0070685_10001419 3300005466 Bacteria 12571
52 Ga0070707_100001319 3300005468 Bacteria 24394
53 Ga0070699_100161952 3300005518 Bacteria 1980
54 Ga0070679_100003510 3300005530 Bacteria 14359
55 Ga0070679_100056356 3300005530 Bacteria 3916
56 Ga0070684_100013490 3300005535 Bacteria 6592
57 Ga0070684_100017158 3300005535 Bacteria 5934
58 Ga0070684_100017410 3300005535 Bacteria 5897
59 Ga0070684_100137013 3300005535 Bacteria 2212
60 Ga0070697_100153833 3300005536 Bacteria 1940
61 Ga0070686_100000103 3300005544 Bacteria 58400
62 Ga0070695_100012347 3300005545 Bacteria 5122
63 Ga0070696_100065698 3300005546 Bacteria 2543
64 Ga0070693_100025515 3300005547 Unclassified 3182
65 Ga0070665_100027729 3300005548 Bacteria 5702
66 Ga0070704_100020669 3300005549 Bacteria 4250
67 Ga0068855_100032641 3300005563 Bacteria 6216
68 Ga0068855_100034685 3300005563 Bacteria 6014
69 Ga0068855_100130641 3300005563 Bacteria 2869
70 Ga0068855_100181115 3300005563 Unclassified 2382
71 Ga0068857_100001079 3300005577 Bacteria 21112
72 Ga0068857_100173202 3300005577 Bacteria 1962
73 Ga0068854_100084079 3300005578 Bacteria 2354
74 Ga0068856_100001598 3300005614 Bacteria 23676
75 Ga0068856_100054850 3300005614 Bacteria 3932
76 Ga0068856_100101902 3300005614 Bacteria 2864
77 Ga0068856_100117279 3300005614 Bacteria 2662
78 Ga0068856_100163799 3300005614 Bacteria 2235
79 Ga0070702_100000081 3300005615 Bacteria 27675
80 Ga0068852_100003646 3300005616 Bacteria 10786
81 Ga0068852_100098606 3300005616 Bacteria 2632
82 Ga0068859_100006333 3300005617 Bacteria 12006
83 Ga0068859_100184463 3300005617 Bacteria 2170
84 Ga0068859_100233233 3300005617 Bacteria 1929
85 Ga0068866_10000201 3300005718 Bacteria 28091
86 Ga0068861_100000679 3300005719 Bacteria 20302
87 Ga0068870_10011007 3300005840 Unclassified 4179
88 Ga0068863_100028748 3300005841 Bacteria 5308
89 Ga0068858_100000455 3300005842 Bacteria 42847
90 Ga0068858_100039723 3300005842 Bacteria 4362
91 Ga0068858_100057582 3300005842 Unclassified 3592
92 Ga0068858_100065683 3300005842 Bacteria 3358
93 Ga0068858_100159854 3300005842 Bacteria 2121
94 Ga0068860_100001308 3300005843 Bacteria 27073
95 Ga0068860_100037954 3300005843 Bacteria 4610
96 Ga0068860_100045578 3300005843 Bacteria 4182
97 Ga0068860_100257313 3300005843 Bacteria 1701
98 Ga0068862_100001753 3300005844 Bacteria 19644
99 Ga0081455_10022885 3300005937 Bacteria 5827
100 Ga0081538_10036385 3300005981 Bacteria 3213
101 Ga0081539_10012634 3300005985 Bacteria 6475
102 Ga0097621_100007567 3300006237 Bacteria 7781
103 Ga0097621_100095392 3300006237 Bacteria 2495
104 Ga0068871_100133234 3300006358 Bacteria 2108
105 Ga0068871_100166423 3300006358 Bacteria 1888
106 Ga0075428_100001343 3300006844 Bacteria 26113
107 Ga0075428_100214906 3300006844 Bacteria 2077
108 Ga0075430_100000825 3300006846 Bacteria 24210
109 Ga0075431_100001040 3300006847 Bacteria 24745
110 Ga0075431_100093429 3300006847 Bacteria 3104
111 Ga0075433_10015583 3300006852 Bacteria 6242
112 Ga0075433_10063583 3300006852 Bacteria 3233
113 Ga0075434_100103587 3300006871 Bacteria 2854
114 Ga0075434_100119457 3300006871 Bacteria 2650
115 Ga0075434_100130669 3300006871 Unclassified 2530
116 Ga0075429_100000030 3300006880 Bacteria 65324
117 Ga0068865_100000113 3300006881 Bacteria 41428
118 Ga0068865_100088468 3300006881 Bacteria 2241
119 Ga0075436_100144399 3300006914 Bacteria 1673
120 Ga0097620_100006333 3300006931 Bacteria 12006
121 Ga0097620_100184472 3300006931 Bacteria 2170
122 Ga0097620_100233218 3300006931 Bacteria 1929
123 Ga0075435_100032956 3300007076 Bacteria 4094
124 Ga0075435_100196654 3300007076 Bacteria 1708
125 Ga0099794_10011083 3300007265 Bacteria 3852
126 Ga0099795_10003064 3300007788 Bacteria 4076
127 Ga0099795_10019463 3300007788 Bacteria 2198
128 Ga0105240_10003162 3300009093 Bacteria 25900
129 Ga0105240_10095334 3300009093 Bacteria 3628
130 Ga0105240_10164073 3300009093 Bacteria 2636
131 Ga0105240_10370582 3300009093 Bacteria 1619
132 Ga0111539_10116720 3300009094 Unclassified 3129
133 Ga0111539_10190427 3300009094 Unclassified 2394
134 Ga0105245_10000299 3300009098 Bacteria 47457
135 Ga0105245_10000681 3300009098 Bacteria 30711
136 Ga0105245_10003313 3300009098 Bacteria 14461
137 Ga0105245_10009759 3300009098 Bacteria 8365
138 Ga0105245_10247392 3300009098 Bacteria 1731
139 Ga0105245_10257302 3300009098 Bacteria 1698
140 Ga0105247_10015426 3300009101 Bacteria 4577
141 Ga0114129_10000330 3300009147 Bacteria 55300
142 Ga0114129_10025130 3300009147 Bacteria 8442
143 Ga0114129_10050667 3300009147 Bacteria 5832
144 Ga0114129_10231871 3300009147 Bacteria 2486
145 Ga0114129_10337304 3300009147 Bacteria 2000
146 Ga0105243_10004244 3300009148 Bacteria 11357
147 Ga0105243_10008669 3300009148 Bacteria 7798
148 Ga0105241_10019619 3300009174 Bacteria 4988
149 Ga0105241_10028944 3300009174 Unclassified 4129
150 Ga0105241_10039798 3300009174 Bacteria 3547
151 Ga0105241_10079206 3300009174 Unclassified 2569
152 Ga0105241_10097357 3300009174 Unclassified 2332
153 Ga0105241_10182510 3300009174 Unclassified 1741
154 Ga0105241_10185375 3300009174 Bacteria 1729
155 Ga0105242_10000201 3300009176 Bacteria 46357
156 Ga0105242_10006814 3300009176 Bacteria 8809
157 Ga0105242_10013538 3300009176 Bacteria 6309
158 Ga0105242_10077590 3300009176 Bacteria 2771
159 Ga0105248_10003682 3300009177 Bacteria 16982
160 Ga0105248_10006339 3300009177 Bacteria 12976
161 Ga0105248_10063361 3300009177 Bacteria 4150
162 Ga0105248_10117815 3300009177 Unclassified 2995
163 Ga0105248_10203444 3300009177 Bacteria 2231
164 Ga0105237_10002468 3300009545 Bacteria 22939
165 Ga0105237_10009968 3300009545 Bacteria 10138
166 Ga0105237_10089573 3300009545 Bacteria 3066
167 Ga0105238_10010078 3300009551 Bacteria 9478
168 Ga0105238_10072573 3300009551 Unclassified 3437
169 Ga0105238_10084138 3300009551 Bacteria 3170
170 Ga0105238_10124609 3300009551 Bacteria 2556
171 Ga0105249_10258250 3300009553 Unclassified 1730
172 Ga0099796_10000784 3300010159 Bacteria 5733
173 Ga0099796_10007393 3300010159 Bacteria 2869
174 Ga0105239_10005790 3300010375 Bacteria 14418
175 Ga0105239_10006477 3300010375 Bacteria 13578
176 Ga0105239_10011861 3300010375 Bacteria 9723
177 Ga0105239_10015537 3300010375 Bacteria 8431
178 Ga0105239_10018773 3300010375 Bacteria 7639
179 Ga0105239_10028735 3300010375 Bacteria 6114
180 Ga0105239_10112333 3300010375 Bacteria 3021
181 Ga0157371_10044582 3300013102 Bacteria 3157
182 Ga0157370_10001241 3300013104 Bacteria 31886
183 Ga0157370_10009354 3300013104 Bacteria 10484
184 Ga0157370_10147429 3300013104 Unclassified 2191
185 Ga0157370_10311817 3300013104 Unclassified 1452
186 Ga0157369_10013120 3300013105 Bacteria 9377
187 Ga0157369_10090963 3300013105 Unclassified 3258
188 Ga0157374_10016540 3300013296 Bacteria 6486
189 Ga0157374_10030200 3300013296 Unclassified 4917
190 Ga0157374_10337023 3300013296 Bacteria 1497
191 Ga0157378_10000357 3300013297 Bacteria 44996
192 Ga0157378_10007054 3300013297 Bacteria 9810
193 Ga0157378_10063340 3300013297 Bacteria 3304
194 Ga0157378_10099683 3300013297 Bacteria 2651
195 Ga0163162_10013210 3300013306 Bacteria 8065
196 Ga0163162_10144438 3300013306 Archaea 2494
197 Ga0163162_10234657 3300013306 Bacteria 1965
198 Ga0157372_10003860 3300013307 Bacteria 16108
199 Ga0157372_10042493 3300013307 Bacteria 5028
200 Ga0157372_10079831 3300013307 Bacteria 3701
201 Ga0157372_10107478 3300013307 Bacteria 3192
202 Ga0157375_10002215 3300013308 Bacteria 16817
203 Ga0157375_10011284 3300013308 Bacteria 7888
204 Ga0157375_10013776 3300013308 Bacteria 7209
205 Ga0157375_10029045 3300013308 Bacteria 5195
206 Ga0157375_10135935 3300013308 Bacteria 2582
207 Ga0157375_10219050 3300013308 Bacteria 2061
208 Ga0163163_10000755 3300014325 Bacteria 27525
209 Ga0163163_10042231 3300014325 Unclassified 4465
210 Ga0163163_10124926 3300014325 Unclassified 2610
211 Ga0163163_10199065 3300014325 Bacteria 2051
212 Ga0163163_10339452 3300014325 Bacteria 1557
213 Ga0163163_10413616 3300014325 Bacteria 1407
214 Ga0157380_10005079 3300014326 Bacteria 9191
215 Ga0157379_10102115 3300014968 Unclassified 2574
216 Ga0157376_10051177 3300014969 Unclassified 3431
217 Ga0157376_10131221 3300014969 Bacteria 2236
218 Ga0213875_10033500 3300021388 Bacteria 2427
219 Ga0213875_10058149 3300021388 Bacteria 1810
220 Ga0224572_1009627 3300024225 Bacteria 1806
221 Ga0207642_10001006 3300025899 Bacteria 8836
222 Ga0207642_10076808 3300025899 Bacteria 1609
223 Ga0207645_10056661 3300025907 Bacteria 2502
224 Ga0207643_10005687 3300025908 Bacteria 6667
225 Ga0207705_10011651 3300025909 Bacteria 6352
226 Ga0207705_10028659 3300025909 Bacteria 3969
227 Ga0207654_10005763 3300025911 Bacteria 6255
228 Ga0207707_10000698 3300025912 Bacteria 33306
229 Ga0207707_10113945 3300025912 Bacteria 2363
230 Ga0207695_10001613 3300025913 Bacteria 36581
231 Ga0207695_10014537 3300025913 Bacteria 9316
232 Ga0207695_10211321 3300025913 Unclassified 1851
233 Ga0207695_10254840 3300025913 Bacteria 1654
234 Ga0207695_10292070 3300025913 Bacteria 1522
235 Ga0207671_10010471 3300025914 Bacteria 7646
236 Ga0207671_10095353 3300025914 Bacteria 2247
237 Ga0207671_10101040 3300025914 Bacteria 2185
238 Ga0207663_10011195 3300025916 Bacteria 4807
239 Ga0207663_10088255 3300025916 Bacteria 2050
240 Ga0207660_10053129 3300025917 Unclassified 2887
241 Ga0207657_10000879 3300025919 Bacteria 31764
242 Ga0207652_10029103 3300025921 Bacteria 4615
243 Ga0207652_10046140 3300025921 Bacteria 3717
244 Ga0207646_10002407 3300025922 Bacteria 22080
245 Ga0207694_10005717 3300025924 Bacteria 9530
246 Ga0207694_10048959 3300025924 Bacteria 3271
247 Ga0207694_10056971 3300025924 Unclassified 3037
248 Ga0207694_10128974 3300025924 Bacteria 2026
249 Ga0207650_10081741 3300025925 Bacteria 2451
250 Ga0207687_10000430 3300025927 Bacteria 28463
251 Ga0207687_10004346 3300025927 Bacteria 9458
252 Ga0207687_10007599 3300025927 Bacteria 7129
253 Ga0207687_10028897 3300025927 Unclassified 3726
254 Ga0207700_10025034 3300025928 Unclassified 4138
255 Ga0207664_10052563 3300025929 Bacteria 3223
256 Ga0207664_10288758 3300025929 Bacteria 1441
257 Ga0207644_10030909 3300025931 Bacteria 3728
258 Ga0207644_10122583 3300025931 Bacteria 1981
259 Ga0207690_10067272 3300025932 Bacteria 2457
260 Ga0207706_10027223 3300025933 Bacteria 5114
261 Ga0207686_10000084 3300025934 Bacteria 79402
262 Ga0207686_10002038 3300025934 Bacteria 11139
263 Ga0207686_10005318 3300025934 Bacteria 6905
264 Ga0207686_10170215 3300025934 Bacteria 1535
265 Ga0207709_10001426 3300025935 Bacteria 16740
266 Ga0207709_10076119 3300025935 Bacteria 2147
267 Ga0207670_10005149 3300025936 Bacteria 7148
268 Ga0207704_10000166 3300025938 Bacteria 34959
269 Ga0207704_10168468 3300025938 Bacteria 1568
270 Ga0207711_10001210 3300025941 Bacteria 24453
271 Ga0207711_10010536 3300025941 Bacteria 7681
272 Ga0207711_10029065 3300025941 Bacteria 4659
273 Ga0207711_10141017 3300025941 Bacteria 2169
274 Ga0207689_10000272 3300025942 Bacteria 46619
275 Ga0207689_10016317 3300025942 Bacteria 6290
276 Ga0207661_10017731 3300025944 Bacteria 5275
277 Ga0207661_10018230 3300025944 Bacteria 5213
278 Ga0207661_10019054 3300025944 Bacteria 5108
279 Ga0207661_10242281 3300025944 Bacteria 1600
280 Ga0207667_10000253 3300025949 Bacteria 75314
281 Ga0207667_10001205 3300025949 Bacteria 32315
282 Ga0207667_10043055 3300025949 Bacteria 4793
283 Ga0207667_10054240 3300025949 Bacteria 4216
284 Ga0207667_10183245 3300025949 Unclassified 2150
285 Ga0207712_10045642 3300025961 Bacteria 3035
286 Ga0207712_10054652 3300025961 Archaea 2805
287 Ga0207668_10243328 3300025972 Bacteria 1457
288 Ga0207668_10274833 3300025972 Bacteria 1379
289 Ga0207658_10073459 3300025986 Bacteria 2596
290 Ga0207658_10136751 3300025986 Bacteria 1977
291 Ga0207677_10018813 3300026023 Unclassified 4155
292 Ga0207677_10025363 3300026023 Unclassified 3698
293 Ga0207703_10003702 3300026035 Bacteria 12729
294 Ga0207703_10036888 3300026035 Bacteria 3893
295 Ga0207703_10038869 3300026035 Bacteria 3801
296 Ga0207639_10210774 3300026041 Bacteria 1672
297 Ga0207708_10000134 3300026075 Bacteria 58313
298 Ga0207708_10104534 3300026075 Bacteria 2194
299 Ga0207702_10007579 3300026078 Bacteria 9242
300 Ga0207702_10028506 3300026078 Bacteria 4642
301 Ga0207648_10000433 3300026089 Bacteria 46203
302 Ga0207648_10028476 3300026089 Bacteria 4952
303 Ga0207648_10054207 3300026089 Unclassified 3503
304 Ga0207648_10060489 3300026089 Bacteria 3303
305 Ga0207674_10000097 3300026116 Bacteria 98549
306 Ga0207674_10001188 3300026116 Bacteria 33871
307 Ga0207674_10009807 3300026116 Bacteria 10905
308 Ga0207674_10047075 3300026116 Bacteria 4424
309 Ga0207674_10154603 3300026116 Bacteria 2249
310 Ga0207675_100000490 3300026118 Bacteria 38407
311 Ga0207675_100105659 3300026118 Unclassified 2654
312 Ga0207683_10006797 3300026121 Bacteria 9794
313 Ga0207683_10023033 3300026121 Bacteria 5353
314 Ga0207683_10076653 3300026121 Bacteria 2960
315 Ga0207698_10023889 3300026142 Bacteria 4280
316 Ga0268266_10007748 3300028379 Bacteria 9638
317 Ga0268266_10093954 3300028379 Bacteria 2632
318 Ga0268265_10004485 3300028380 Bacteria 9671
319 Ga0268265_10036085 3300028380 Bacteria 3619
320 Ga0268264_10023874 3300028381 Unclassified 4988
321 Ga0268264_10030634 3300028381 Unclassified 4410
322 Ga0268264_10060975 3300028381 Bacteria 3163
323 Ga0265337_1024305 3300028556 Bacteria 1855
324 Ga0265338_10132194 3300028800 Bacteria 1968
325 Ga0265313_10005222 3300031595 Bacteria 9625
326 Ga0265314_10000559 3300031711 Bacteria 47507
327 Ga0265314_10002472 3300031711 Bacteria 18870
328 Ga0373934_0000814 3300035086 Bacteria 11267
329 Ga0373934_0013970 3300035086 Bacteria 3039
330 Ga0373934_0031982 3300035086 Unclassified 2062
331 Ga0373954_0005999 3300035118 Bacteria 5285
332 Ga0373954_0079409 3300035118 Bacteria 1566
333 Ga0373956_0016295 3300035119 Bacteria 3120
334 Ga0373955_0031522 3300035172 Bacteria 2778
335 Ga0373931_0046998 3300035691 Bacteria 2284
336 Ga0373927_0014726 3300035695 Bacteria 5171
337 Ga0373927_0137275 3300035695 Bacteria 1599
338 Ga0373927_0207935 3300035695 Bacteria 1285
339 Ga0373933_0010513 3300035724 Bacteria 5076
340 Ga0373937_0002089 3300036401 Bacteria 16713
341 Ga0373937_0018674 3300036401 Bacteria 6196
342 Ga0373937_0114782 3300036401 Bacteria 2507
343 Ga0373937_0156762 3300036401 Unclassified 2134
344 Ga0373925_0027670 3300037068 Bacteria 4150
345 Ga0373925_0086826 3300037068 Bacteria 2387
346 Ga0373925_0144195 3300037068 Unclassified 1866
347 Ga0395900_0018209 3300037418 Bacteria 7165
348 Ga0395898_0050613 3300037466 Bacteria 4065
349 Ga0436364_0241575 3300037853 Bacteria 3389
350 Ga0436364_0384668 3300037853 Bacteria 7895
351 Ga0436364_0548901 3300037853 Bacteria 1523
352 Ga0436364_0975896 3300037853 Bacteria 11008
353 Ga0436364_1173990 3300037853 Bacteria 1565
354 Ga0395901_0010207 3300038443 Bacteria 9513
355 Ga0436365_1804521 3300039437 Bacteria 2439
356 Ga0436362_0817465 3300039453 Bacteria 1415
357 Ga0495592_0044208 3300046454 Bacteria 3329
358 Ga0495651_0050080 3300046462 Bacteria 3224
359 Ga0495580_0024300 3300046472 Bacteria 4440
360 Ga0495662_0068043 3300046476 Bacteria 1724
361 Ga0495584_0050533 3300046491 Bacteria 2094
362 Ga0495628_0149861 3300046516 Bacteria 1777
363 Ga0495652_0038579 3300046529 Bacteria 4137
364 Ga0495652_0051777 3300046529 Bacteria 3504
365 Ga0495665_0014389 3300046531 Bacteria 4268
366 Ga0495586_0003973 3300046535 Bacteria 7935
367 Ga0495587_0026030 3300046536 Bacteria 3570
368 Ga0495634_0127608 3300046642 Bacteria 1624
369 Ga0495599_0000984 3300046678 Bacteria 15958
370 Ga0495623_0072528 3300046679 Bacteria 2141
371 Ga0495669_0020288 3300046684 Bacteria 2875
372 Ga0495613_0083094 3300046689 Unclassified 2326
373 Ga0495613_0154877 3300046689 Bacteria 1633
374 Ga0495674_0168562 3300047319 Bacteria 1828
375 Ga0495680_0177739 3300047322 Bacteria 1538
376 Ga0495675_0104650 3300047444 Bacteria 1769
377 Ga0495684_0008352 3300047471 Bacteria 8023
378 Ga0495684_0015213 3300047471 Bacteria 5926
379 Ga0495602_0007078 3300048088 Bacteria 11775
380 Ga0495602_0048005 3300048088 Bacteria 3842
381 Ga0496102_0106656 3300048905 Bacteria 2608
382 Ga0496105_0146233 3300048908 Bacteria 1944
383 Ga0501034_0003954 3300049571 Bacteria 16651
384 Ga0501039_0093222 3300049575 Bacteria 2347
385 Ga0501041_0080739 3300049577 Bacteria 2002
386 Ga0501047_0061228 3300049581 Bacteria 3632
387 Ga0501048_0164526 3300049582 Bacteria 1570
388 Ga0501068_0000034 3300049584 Bacteria 50744
389 Ga0501070_0018653 3300049586 Bacteria 5821
390 Ga0501072_0015818 3300049588 Bacteria 5784
391 Ga0501073_0011242 3300049589 Bacteria 6548
392 Ga0501074_0072351 3300049590 Bacteria 2477
393 Ga0501076_0109956 3300049592 Bacteria 2228
394 Ga0501077_0045055 3300049593 Bacteria 2802
395 Ga0501080_0000290 3300049742 Bacteria 38083
396 nmdc:mga06z11_94492_c1 3300050494 Bacteria 1629
397 nmdc:mga05p37_14053_c1 3300050507 Bacteria 9605
398 nmdc:mga05p37_267745_c1 3300050507 Bacteria 2043
399 nmdc:mga05p37_333199_c1 3300050507 Bacteria 1792
400 nmdc:mga05p37_70980_c1 3300050507 Unclassified 4284
401 nmdc:mga09592_549_c1 3300050508 Bacteria 28509
402 nmdc:mga0qj67_810_c1 3300050509 Bacteria 21277
403 nmdc:mga06r32_1854_c1 3300050510 Bacteria 18806
404 nmdc:mga06r32_247046_c1 3300050510 Bacteria 1772
405 nmdc:mga0n895_239276_c1 3300050512 Bacteria 1842
406 nmdc:mga0n895_49797_c1 3300050512 Bacteria 4106
407 nmdc:mga0n895_65110_c1 3300050512 Unclassified 3607
408 nmdc:mga0rr50_85397_c1 3300050513 Bacteria 2446
409 nmdc:mga08x19_23407_c1 3300050514 Bacteria 3831
410 nmdc:mga0a205_19064_c1 3300050515 Bacteria 6464
411 nmdc:mga0a205_21449_c1 3300050515 Bacteria 6110
412 nmdc:mga0a205_81383_c1 3300050515 Bacteria 3128
413 Ga0495601_0062827 3300053077 Unclassified 2359
414 Ga0495619_0170034 3300053085 Unclassified 1507
415 Ga0500643_003454 3300053087 Bacteria 7608
416 Ga0500595_006454 3300053119 Bacteria 4974
417 Ga0530510_0137729 3300061734 Bacteria 1797
418 2644340086 2643221660 Bacteria 4208257
419 Ga0207674_10332012
420 Ga0058863_10047659
421 Ga0058862_12630550
422 Ga0070658_10001759
423 Ga0070658_10025623
424 Ga0070683_100003327
425 Ga0070683_100009936
426 Ga0070683_100023143
427 Ga0070683_100035277
428 Ga0070683_100096144
429 Ga0070690_100005095
430 Ga0070677_10037853
431 Ga0068869_100000524
432 Ga0068869_100120926
433 Ga0070680_100067577
434 Ga0070682_100068227
435 Ga0068868_100007433
436 Ga0068868_100015384
437 Ga0068868_100126728
438 Ga0070689_100002939
439 Ga0070691_10000535
440 Ga0070668_100227895
441 Ga0070671_100045884
442 Ga0070674_100091223
443 Ga0070673_100069696
444 Ga0070673_100170638
445 Ga0070659_100039826
446 Ga0070667_100090867
447 Ga0070667_100255702
448 Ga0070714_100002237
449 Ga0070714_100027953
450 Ga0070713_100003610
451 Ga0070713_100004458
452 Ga0070713_100011924
453 Ga0070710_10163275
454 Ga0070701_10000275
455 Ga0070711_100024182
456 Ga0070711_100029390
457 Ga0070700_100000379
458 Ga0070700_100075811
459 Ga0070694_100020391
460 Ga0070708_100189014
461 Ga0070678_100307592
462 Ga0070681_10012532
463 Ga0070681_10031418
464 Ga0070681_10044698
465 Ga0070681_10055377
466 Ga0070681_10115207
467 Ga0070681_10156221
468 Ga0068867_100000191
469 Ga0070685_10001419
470 Ga0070707_100001319
471 Ga0070699_100161952
472 Ga0070679_100003510
473 Ga0070679_100056356
474 Ga0070684_100013490
475 Ga0070684_100017158
476 Ga0070684_100017410
477 Ga0070684_100137013
478 Ga0070697_100153833
479 Ga0070686_100000103
480 Ga0070695_100012347
481 Ga0070696_100065698
482 Ga0070693_100025515
483 Ga0070665_100027729
484 Ga0070704_100020669
485 Ga0068855_100032641
486 Ga0068855_100034685
487 Ga0068855_100130641
488 Ga0068855_100181115
489 Ga0068857_100001079
490 Ga0068857_100173202
491 Ga0068854_100084079
492 Ga0068856_100001598
493 Ga0068856_100054850
494 Ga0068856_100101902
495 Ga0068856_100117279
496 Ga0068856_100163799
497 Ga0070702_100000081
498 Ga0068852_100003646
499 Ga0068852_100098606
500 Ga0068859_100006333
501 Ga0068859_100184463
502 Ga0068859_100233233
503 Ga0068866_10000201
504 Ga0068861_100000679
505 Ga0068870_10011007
506 Ga0068863_100028748
507 Ga0068858_100000455
508 Ga0068858_100039723
509 Ga0068858_100057582
510 Ga0068858_100065683
511 Ga0068858_100159854
512 Ga0068860_100001308
513 Ga0068860_100037954
514 Ga0068860_100045578
515 Ga0068860_100257313
516 Ga0068862_100001753
517 Ga0081455_10022885
518 Ga0081538_10036385
519 Ga0081539_10012634
520 Ga0097621_100007567
521 Ga0097621_100095392
522 Ga0068871_100133234
523 Ga0068871_100166423
524 Ga0075428_100001343
525 Ga0075428_100214906
526 Ga0075430_100000825
527 Ga0075431_100001040
528 Ga0075431_100093429
529 Ga0075433_10015583
530 Ga0075433_10063583
531 Ga0075434_100103587
532 Ga0075434_100119457
533 Ga0075434_100130669
534 Ga0075429_100000030
535 Ga0068865_100000113
536 Ga0068865_100088468
537 Ga0075436_100144399
538 Ga0097620_100006333
539 Ga0097620_100184472
540 Ga0097620_100233218
541 Ga0075435_100032956
542 Ga0075435_100196654
543 Ga0099794_10011083
544 Ga0099795_10003064
545 Ga0099795_10019463
546 Ga0105240_10003162
547 Ga0105240_10095334
548 Ga0105240_10164073
549 Ga0105240_10370582
550 Ga0111539_10116720
551 Ga0111539_10190427
552 Ga0105245_10000299
553 Ga0105245_10000681
554 Ga0105245_10003313
555 Ga0105245_10009759
556 Ga0105245_10247392
557 Ga0105245_10257302
558 Ga0105247_10015426
559 Ga0114129_10000330
560 Ga0114129_10025130
561 Ga0114129_10050667
562 Ga0114129_10231871
563 Ga0114129_10337304
564 Ga0105243_10004244
565 Ga0105243_10008669
566 Ga0105241_10019619
567 Ga0105241_10028944
568 Ga0105241_10039798
569 Ga0105241_10079206
570 Ga0105241_10097357
571 Ga0105241_10182510
572 Ga0105241_10185375
573 Ga0105242_10000201
574 Ga0105242_10006814
575 Ga0105242_10013538
576 Ga0105242_10077590
577 Ga0105248_10003682
578 Ga0105248_10006339
579 Ga0105248_10063361
580 Ga0105248_10117815
581 Ga0105248_10203444
582 Ga0105237_10002468
583 Ga0105237_10009968
584 Ga0105237_10089573
585 Ga0105238_10010078
586 Ga0105238_10072573
587 Ga0105238_10084138
588 Ga0105238_10124609
589 Ga0105249_10258250
590 Ga0099796_10000784
591 Ga0099796_10007393
592 Ga0105239_10005790
593 Ga0105239_10006477
594 Ga0105239_10011861
595 Ga0105239_10015537
596 Ga0105239_10018773
597 Ga0105239_10028735
598 Ga0105239_10112333
599 Ga0157371_10044582
600 Ga0157370_10001241
601 Ga0157370_10009354
602 Ga0157370_10147429
603 Ga0157370_10311817
604 Ga0157369_10013120
605 Ga0157369_10090963
606 Ga0157374_10016540
607 Ga0157374_10030200
608 Ga0157374_10337023
609 Ga0157378_10000357
610 Ga0157378_10007054
611 Ga0157378_10063340
612 Ga0157378_10099683
613 Ga0163162_10013210
614 Ga0163162_10144438
615 Ga0163162_10234657
616 Ga0157372_10003860
617 Ga0157372_10042493
618 Ga0157372_10079831
619 Ga0157372_10107478
620 Ga0157375_10002215
621 Ga0157375_10011284
622 Ga0157375_10013776
623 Ga0157375_10029045
624 Ga0157375_10135935
625 Ga0157375_10219050
626 Ga0163163_10000755
627 Ga0163163_10042231
628 Ga0163163_10124926
629 Ga0163163_10199065
630 Ga0163163_10339452
631 Ga0163163_10413616
632 Ga0157380_10005079
633 Ga0157379_10102115
634 Ga0157376_10051177
635 Ga0157376_10131221
636 Ga0213875_10033500
637 Ga0213875_10058149
638 Ga0224572_1009627
639 Ga0207642_10001006
640 Ga0207642_10076808
641 Ga0207645_10056661
642 Ga0207643_10005687
643 Ga0207705_10011651
644 Ga0207705_10028659
645 Ga0207654_10005763
646 Ga0207707_10000698
647 Ga0207707_10113945
648 Ga0207695_10001613
649 Ga0207695_10014537
650 Ga0207695_10211321
651 Ga0207695_10254840
652 Ga0207695_10292070
653 Ga0207671_10010471
654 Ga0207671_10095353
655 Ga0207671_10101040
656 Ga0207663_10011195
657 Ga0207663_10088255
658 Ga0207660_10053129
659 Ga0207657_10000879
660 Ga0207652_10029103
661 Ga0207652_10046140
662 Ga0207646_10002407
663 Ga0207694_10005717
664 Ga0207694_10048959
665 Ga0207694_10056971
666 Ga0207694_10128974
667 Ga0207650_10081741
668 Ga0207687_10000430
669 Ga0207687_10004346
670 Ga0207687_10007599
671 Ga0207687_10028897
672 Ga0207700_10025034
673 Ga0207664_10052563
674 Ga0207664_10288758
675 Ga0207644_10030909
676 Ga0207644_10122583
677 Ga0207690_10067272
678 Ga0207706_10027223
679 Ga0207686_10000084
680 Ga0207686_10002038
681 Ga0207686_10005318
682 Ga0207686_10170215
683 Ga0207709_10001426
684 Ga0207709_10076119
685 Ga0207670_10005149
686 Ga0207704_10000166
687 Ga0207704_10168468
688 Ga0207711_10001210
689 Ga0207711_10010536
690 Ga0207711_10029065
691 Ga0207711_10141017
692 Ga0207689_10000272
693 Ga0207689_10016317
694 Ga0207661_10017731
695 Ga0207661_10018230
696 Ga0207661_10019054
697 Ga0207661_10242281
698 Ga0207667_10000253
699 Ga0207667_10001205
700 Ga0207667_10043055
701 Ga0207667_10054240
702 Ga0207667_10183245
703 Ga0207712_10045642
704 Ga0207712_10054652
705 Ga0207668_10243328
706 Ga0207668_10274833
707 Ga0207658_10073459
708 Ga0207658_10136751
709 Ga0207677_10018813
710 Ga0207677_10025363
711 Ga0207703_10003702
712 Ga0207703_10036888
713 Ga0207703_10038869
714 Ga0207639_10210774
715 Ga0207708_10000134
716 Ga0207708_10104534
717 Ga0207702_10007579
718 Ga0207702_10028506
719 Ga0207648_10000433
720 Ga0207648_10028476
721 Ga0207648_10054207
722 Ga0207648_10060489
723 Ga0207674_10000097
724 Ga0207674_10001188
725 Ga0207674_10009807
726 Ga0207674_10047075
727 Ga0207674_10154603
728 Ga0207675_100000490
729 Ga0207675_100105659
730 Ga0207683_10006797
731 Ga0207683_10023033
732 Ga0207683_10076653
733 Ga0207698_10023889
734 Ga0268266_10007748
735 Ga0268266_10093954
736 Ga0268265_10004485
737 Ga0268265_10036085
738 Ga0268264_10023874
739 Ga0268264_10030634
740 Ga0268264_10060975
741 Ga0265337_1024305
742 Ga0265338_10132194
743 Ga0265313_10005222
744 Ga0265314_10000559
745 Ga0265314_10002472
746 Ga0373934_0000814
747 Ga0373934_0013970
748 Ga0373934_0031982
749 Ga0373954_0005999
750 Ga0373954_0079409
751 Ga0373956_0016295
752 Ga0373955_0031522
753 Ga0373931_0046998
754 Ga0373927_0014726
755 Ga0373927_0137275
756 Ga0373927_0207935
757 Ga0373933_0010513
758 Ga0373937_0002089
759 Ga0373937_0018674
760 Ga0373937_0114782
761 Ga0373937_0156762
762 Ga0373925_0027670
763 Ga0373925_0086826
764 Ga0373925_0144195
765 Ga0395900_0018209
766 Ga0395898_0050613
767 Ga0436364_0241575
768 Ga0436364_0384668
769 Ga0436364_0548901
770 Ga0436364_0975896
771 Ga0436364_1173990
772 Ga0395901_0010207
773 Ga0436365_1804521
774 Ga0436362_0817465
775 Ga0495592_0044208
776 Ga0495651_0050080
777 Ga0495580_0024300
778 Ga0495662_0068043
779 Ga0495584_0050533
780 Ga0495628_0149861
781 Ga0495652_0038579
782 Ga0495652_0051777
783 Ga0495665_0014389
784 Ga0495586_0003973
785 Ga0495587_0026030
786 Ga0495634_0127608
787 Ga0495599_0000984
788 Ga0495623_0072528
789 Ga0495669_0020288
790 Ga0495613_0083094
791 Ga0495613_0154877
792 Ga0495674_0168562
793 Ga0495680_0177739
794 Ga0495675_0104650
795 Ga0495684_0008352
796 Ga0495684_0015213
797 Ga0495602_0007078
798 Ga0495602_0048005
799 Ga0496102_0106656
800 Ga0496105_0146233
801 Ga0501034_0003954
802 Ga0501039_0093222
803 Ga0501041_0080739
804 Ga0501047_0061228
805 Ga0501048_0164526
806 Ga0501068_0000034
807 Ga0501070_0018653
808 Ga0501072_0015818
809 Ga0501073_0011242
810 Ga0501074_0072351
811 Ga0501076_0109956
812 Ga0501077_0045055
813 Ga0501080_0000290
814 nmdc:mga06z11_94492_c1
815 nmdc:mga05p37_14053_c1
816 nmdc:mga05p37_267745_c1
817 nmdc:mga05p37_333199_c1
818 nmdc:mga05p37_70980_c1
819 nmdc:mga09592_549_c1
820 nmdc:mga0qj67_810_c1
821 nmdc:mga06r32_1854_c1
822 nmdc:mga06r32_247046_c1
823 nmdc:mga0n895_239276_c1
824 nmdc:mga0n895_49797_c1
825 nmdc:mga0n895_65110_c1
826 nmdc:mga0rr50_85397_c1
827 nmdc:mga08x19_23407_c1
828 nmdc:mga0a205_19064_c1
829 nmdc:mga0a205_21449_c1
830 nmdc:mga0a205_81383_c1
831 Ga0495601_0062827
832 Ga0495619_0170034
833 Ga0500643_003454
834 Ga0500595_006454
835 Ga0530510_0137729
836 2644340086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

67

417

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vem-assembly3.cif.gz_C human ectonucleotide pyrophosphatase / phosphodiesterase 5 (enpp5, npp5) 0.6585 247 334
5veo-assembly1.cif.gz_A murine ectonucleotide pyrophosphatase / phosphodiesterase 5 (enpp5, npp5), inactive (t72a), in complex with amp 0.643 245 334
5ven-assembly2.cif.gz_B murine ectonucleotide pyrophosphatase / phosphodiesterase 5 (enpp5, npp5) 0.6423 245 334
1ani-assembly1.cif.gz_B alkaline phosphatase (d153h, k328h) 0.5845 254 352
5kgm-assembly1.cif.gz_A 2.95a resolution structure of apo independent phosphoglycerate mutase from c. elegans (monoclinic form) 0.5774 250 414
ID Description Score Start End Superfamily
af_E7FE54_66_340_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5568 52 353 3.40.720.10
af_O13663_68_356_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5412 51 411 3.40.720.10
af_A1ZB84_62_350_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5373 46 354 3.40.720.10
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.531 52 363 3.40.720.10
af_Q19976_181_450_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.528 53 350 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A2V6WT51-F1-model_v4 DUF1501 domain-containing protein 0.9045 242 413
AF-A0A2V6WT51-F1-model_v4 DUF1501 domain-containing protein 0.8945 242 413
AF-A0A3D0EVX5-F1-model_v4 DUF1501 domain-containing protein 0.8709 250 413
AF-A0A3D0EVX5-F1-model_v4 DUF1501 domain-containing protein 0.8658 250 413
AF-A0A354VZJ8-F1-model_v4 deleted 0.8613 214 318

Map