F439320

General Info

Members Datasets Scaffolds Average Seq Length
418 238 836 323

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10161863|Ga0207662_101618631
Length 368
Sequence MADARVDMSVTLADVELPNPLMTASGCAANGKELHRFFDVSTLGAFVTKSVMAAPRSGRGTPRMAETPSGMLNSIGLQGPGIHAFVENDLAWLKSVGARVLVSIAGGSSGEFADVAAVLRQSPAFDCVVGVEVNISCPNVANRGLVFAIDPLASAKVVALVREQLPRDIPVFAKLSPDVTDIASIASACVKAGASGLTMINTLLGMVIDTDRMRPQLGGLTGGLSGPGIRPIAVRAIWQVRAAMAEGRFRTVPIIGVGGVRTGRDALELVAAGASAIQVGTATFNDPTAPVRVLRELENLLADKGFETFDNDPPVDPMVPWARRVADTQSGYGMLAMRGIEVGAAVVIIAFGVLLLTGYIVSERMVGL

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
228 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
229 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
230 2643221711 Terrabacter sp. Root85 Isolate Unclassified
231 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
232 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
233 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
234 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
235 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
236 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
237 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
238 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 0.72
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.81
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10161863 3300025918 Bacteria 1430
2 Ga0070658_10007702 3300005327 Bacteria 8680
3 Ga0070658_10017509 3300005327 Bacteria 5733
4 Ga0070658_10313802 3300005327 Bacteria 1338
5 Ga0068868_100044727 3300005338 Bacteria 3462
6 Ga0070668_100017603 3300005347 Bacteria 5359
7 Ga0070671_100211991 3300005355 Bacteria 1643
8 Ga0070674_100032838 3300005356 Bacteria 3450
9 Ga0070673_100101733 3300005364 Bacteria 2368
10 Ga0070659_100210952 3300005366 Bacteria 1600
11 Ga0070667_100005202 3300005367 Bacteria 10876
12 Ga0070667_100108028 3300005367 Bacteria 2410
13 Ga0070667_100223029 3300005367 Bacteria 1678
14 Ga0070709_10053481 3300005434 Bacteria 2542
15 Ga0070714_100003398 3300005435 Bacteria 11863
16 Ga0070714_100018298 3300005435 Bacteria 5689
17 Ga0070714_100030198 3300005435 Bacteria 4509
18 Ga0070714_100036116 3300005435 Bacteria 4143
19 Ga0070714_100057973 3300005435 Bacteria 3316
20 Ga0070714_100114795 3300005435 Bacteria 2389
21 Ga0070713_100013147 3300005436 Bacteria 6101
22 Ga0070713_100021312 3300005436 Bacteria 4981
23 Ga0070713_100032359 3300005436 Bacteria 4176
24 Ga0070713_100060298 3300005436 Bacteria 3171
25 Ga0070713_100089218 3300005436 Bacteria 2648
26 Ga0070710_10003585 3300005437 Bacteria 7359
27 Ga0070701_10169052 3300005438 Bacteria 1272
28 Ga0070700_100086279 3300005441 Bacteria 2038
29 Ga0070694_100105293 3300005444 Bacteria 2002
30 Ga0070708_100058139 3300005445 Bacteria 3445
31 Ga0070662_100011119 3300005457 Bacteria 5928
32 Ga0070685_10058338 3300005466 Bacteria 2250
33 Ga0070706_100057204 3300005467 Bacteria 3598
34 Ga0070706_100090092 3300005467 Bacteria 2844
35 Ga0070707_100000199 3300005468 Bacteria 60047
36 Ga0070707_100072796 3300005468 Bacteria 3313
37 Ga0070698_100025443 3300005471 Bacteria 6170
38 Ga0070679_100131959 3300005530 Bacteria 2479
39 Ga0070684_100318938 3300005535 Bacteria 1427
40 Ga0070697_100025271 3300005536 Bacteria 4737
41 Ga0070697_100075483 3300005536 Bacteria 2771
42 Ga0068853_100248781 3300005539 Bacteria 1630
43 Ga0070686_100055361 3300005544 Bacteria 2541
44 Ga0070695_100010587 3300005545 Bacteria 5511
45 Ga0070693_100088994 3300005547 Bacteria 1858
46 Ga0070693_100207369 3300005547 Bacteria 1277
47 Ga0070704_100140896 3300005549 Bacteria 1882
48 Ga0068855_100030711 3300005563 Bacteria 6423
49 Ga0068854_100045352 3300005578 Bacteria 3126
50 Ga0068856_100007792 3300005614 Bacteria 10459
51 Ga0068856_100009537 3300005614 Bacteria 9431
52 Ga0068856_100024084 3300005614 Bacteria 5923
53 Ga0068856_100025203 3300005614 Bacteria 5795
54 Ga0068856_100115056 3300005614 Bacteria 2689
55 Ga0070702_100002966 3300005615 Bacteria 7490
56 Ga0070702_100081930 3300005615 Bacteria 1935
57 Ga0068852_100117585 3300005616 Bacteria 2428
58 Ga0068864_100149661 3300005618 Bacteria 2113
59 Ga0068866_10027191 3300005718 Bacteria 2710
60 Ga0068861_100151739 3300005719 Bacteria 1902
61 Ga0068858_100032279 3300005842 Bacteria 4863
62 Ga0068860_100019619 3300005843 Bacteria 6556
63 Ga0068860_100436401 3300005843 Unclassified 1300
64 Ga0081455_10016983 3300005937 Bacteria 6996
65 Ga0081540_1020607 3300005983 Bacteria 3958
66 Ga0070717_10047828 3300006028 Bacteria 3506
67 Ga0070717_10062890 3300006028 Bacteria 3079
68 Ga0070717_10112967 3300006028 Bacteria 2319
69 Ga0070717_10114573 3300006028 Bacteria 2303
70 Ga0070715_10002983 3300006163 Bacteria 5295
71 Ga0070715_10023617 3300006163 Bacteria 2412
72 Ga0070716_100000541 3300006173 Bacteria 15811
73 Ga0070716_100012987 3300006173 Bacteria 4233
74 Ga0070712_100009879 3300006175 Bacteria 6016
75 Ga0070712_100067706 3300006175 Bacteria 2541
76 Ga0070712_100074126 3300006175 Bacteria 2444
77 Ga0097621_100026361 3300006237 Bacteria 4558
78 Ga0075433_10072909 3300006852 Bacteria 3020
79 Ga0075434_100110151 3300006871 Bacteria 2764
80 Ga0068865_100049225 3300006881 Bacteria 2904
81 Ga0068865_100071872 3300006881 Bacteria 2456
82 Ga0105251_10044954 3300009011 Bacteria 2131
83 Ga0105240_10055498 3300009093 Bacteria 4960
84 Ga0105245_10014543 3300009098 Bacteria 6852
85 Ga0105245_10301750 3300009098 Bacteria 1572
86 Ga0105247_10043510 3300009101 Bacteria 2751
87 Ga0105243_10006999 3300009148 Bacteria 8684
88 Ga0105243_10015567 3300009148 Bacteria 5749
89 Ga0105243_10332694 3300009148 Bacteria 1388
90 Ga0105241_10144632 3300009174 Bacteria 1939
91 Ga0105242_10048802 3300009176 Bacteria 3442
92 Ga0105237_10087922 3300009545 Bacteria 3097
93 Ga0105237_10744189 3300009545 Bacteria 987
94 Ga0105238_10167025 3300009551 Bacteria 2176
95 Ga0105249_10003377 3300009553 Bacteria 13822
96 Ga0105249_10071431 3300009553 Bacteria 3206
97 Ga0105249_10369589 3300009553 Bacteria 1457
98 Ga0105239_10011557 3300010375 Bacteria 9849
99 Ga0105246_10003374 3300011119 Bacteria 9671
100 Ga0157370_10097864 3300013104 Bacteria 2752
101 Ga0157369_10029006 3300013105 Bacteria 6119
102 Ga0157374_10091608 3300013296 Bacteria 2899
103 Ga0157378_10008977 3300013297 Bacteria 8703
104 Ga0163162_10029520 3300013306 Bacteria 5427
105 Ga0163162_10253097 3300013306 Bacteria 1893
106 Ga0157372_10019302 3300013307 Bacteria 7342
107 Ga0157375_10001756 3300013308 Bacteria 18597
108 Ga0163163_10521162 3300014325 Bacteria 1251
109 Ga0157380_10145670 3300014326 Bacteria 2041
110 Ga0157376_10093731 3300014969 Bacteria 2608
111 Ga0206353_10012160 3300020082 Bacteria 1188
112 Ga0206353_11672202 3300020082 Bacteria 1478
113 Ga0224712_10005332 3300022467 Bacteria 3570
114 Ga0207692_10002740 3300025898 Bacteria 6789
115 Ga0207642_10007183 3300025899 Bacteria 3749
116 Ga0207688_10002272 3300025901 Bacteria 10331
117 Ga0207688_10014259 3300025901 Bacteria 4324
118 Ga0207699_10001443 3300025906 Bacteria 11279
119 Ga0207699_10037589 3300025906 Bacteria 2769
120 Ga0207643_10071833 3300025908 Bacteria 1993
121 Ga0207705_10008515 3300025909 Bacteria 7481
122 Ga0207684_10009458 3300025910 Bacteria 8606
123 Ga0207654_10214589 3300025911 Bacteria 1273
124 Ga0207693_10003986 3300025915 Bacteria 12546
125 Ga0207693_10097898 3300025915 Bacteria 2300
126 Ga0207663_10015252 3300025916 Bacteria 4235
127 Ga0207657_10006887 3300025919 Bacteria 11728
128 Ga0207657_10076816 3300025919 Bacteria 2816
129 Ga0207652_10154976 3300025921 Bacteria 2052
130 Ga0207652_10182190 3300025921 Bacteria 1888
131 Ga0207646_10000278 3300025922 Bacteria 70066
132 Ga0207646_10008286 3300025922 Bacteria 10433
133 Ga0207659_10072165 3300025926 Bacteria 2523
134 Ga0207687_10024342 3300025927 Bacteria 4045
135 Ga0207700_10006062 3300025928 Bacteria 7281
136 Ga0207700_10042641 3300025928 Bacteria 3328
137 Ga0207700_10061667 3300025928 Bacteria 2845
138 Ga0207700_10132591 3300025928 Bacteria 2036
139 Ga0207664_10000958 3300025929 Bacteria 19466
140 Ga0207664_10005342 3300025929 Bacteria 8775
141 Ga0207664_10010082 3300025929 Bacteria 6660
142 Ga0207664_10024728 3300025929 Bacteria 4516
143 Ga0207664_10033831 3300025929 Bacteria 3932
144 Ga0207644_10051733 3300025931 Bacteria 2950
145 Ga0207706_10016276 3300025933 Bacteria 6718
146 Ga0207686_10075957 3300025934 Bacteria 2176
147 Ga0207709_10027533 3300025935 Bacteria 3276
148 Ga0207669_10058784 3300025937 Bacteria 2348
149 Ga0207669_10190774 3300025937 Bacteria 1478
150 Ga0207665_10000215 3300025939 Bacteria 38950
151 Ga0207665_10004263 3300025939 Bacteria 9503
152 Ga0207691_10029733 3300025940 Bacteria 5109
153 Ga0207691_10166975 3300025940 Bacteria 1928
154 Ga0207689_10055394 3300025942 Bacteria 3264
155 Ga0207679_10273789 3300025945 Bacteria 1445
156 Ga0207667_10080871 3300025949 Bacteria 3366
157 Ga0207651_10061605 3300025960 Bacteria 2611
158 Ga0207712_10006273 3300025961 Bacteria 7500
159 Ga0207712_10025450 3300025961 Bacteria 3932
160 Ga0207668_10080948 3300025972 Bacteria 2354
161 Ga0207658_10011424 3300025986 Bacteria 6045
162 Ga0207639_10037582 3300026041 Bacteria 3597
163 Ga0207678_10004176 3300026067 Bacteria 12967
164 Ga0207678_10141418 3300026067 Bacteria 2054
165 Ga0207708_10006431 3300026075 Bacteria 8707
166 Ga0207702_10013181 3300026078 Bacteria 6874
167 Ga0207702_10018426 3300026078 Bacteria 5775
168 Ga0207702_10067856 3300026078 Bacteria 3062
169 Ga0207641_10180887 3300026088 Bacteria 1931
170 Ga0207675_100137054 3300026118 Bacteria 2323
171 Ga0207675_100182052 3300026118 Bacteria 2012
172 Ga0207683_10003143 3300026121 Bacteria 14427
173 Ga0207683_10018758 3300026121 Bacteria 5902
174 Ga0207683_10090480 3300026121 Bacteria 2725
175 Ga0207683_10322142 3300026121 Bacteria 1416
176 Ga0207698_10032742 3300026142 Bacteria 3769
177 Ga0207428_10200450 3300027907 Bacteria 1502
178 Ga0268265_10044510 3300028380 Bacteria 3306
179 Ga0268264_10376515 3300028381 Unclassified 1358
180 Ga0307408_100286558 3300031548 Bacteria 1374
181 Ga0316579_10002105 3300031691 Bacteria 7458
182 Ga0316576_10014311 3300031727 Bacteria 5300
183 Ga0316578_10004093 3300031728 Bacteria 6817
184 Ga0307405_10066085 3300031731 Bacteria 2305
185 Ga0307405_10108874 3300031731 Bacteria 1873
186 Ga0316577_10000534 3300031733 Bacteria 15333
187 Ga0307410_10002268 3300031852 Bacteria 9208
188 Ga0307410_10008037 3300031852 Bacteria 5822
189 Ga0307410_10080928 3300031852 Bacteria 2280
190 Ga0307410_10330120 3300031852 Bacteria 1213
191 Ga0307406_10044302 3300031901 Bacteria 2788
192 Ga0307406_10206401 3300031901 Bacteria 1450
193 Ga0307406_10277893 3300031901 Bacteria 1276
194 Ga0307407_10002701 3300031903 Bacteria 7038
195 Ga0307407_10127014 3300031903 Bacteria 1625
196 Ga0307407_10166474 3300031903 Bacteria 1448
197 Ga0307409_100012256 3300031995 Bacteria 5454
198 Ga0307409_100042237 3300031995 Bacteria 3413
199 Ga0307409_100054490 3300031995 Bacteria 3080
200 Ga0307409_100087481 3300031995 Bacteria 2539
201 Ga0307409_100226662 3300031995 Bacteria 1691
202 Ga0307409_100274125 3300031995 Bacteria 1555
203 Ga0307416_100009785 3300032002 Bacteria 6299
204 Ga0307416_100027477 3300032002 Bacteria 4215
205 Ga0307416_100170997 3300032002 Bacteria 2023
206 Ga0307416_100208607 3300032002 Bacteria 1861
207 Ga0307416_100613050 3300032002 Bacteria 1169
208 Ga0307414_10154520 3300032004 Bacteria 1814
209 Ga0307414_10188781 3300032004 Bacteria 1665
210 Ga0307411_10166104 3300032005 Bacteria 1659
211 Ga0307415_100061863 3300032126 Bacteria 2594
212 Ga0307415_100106922 3300032126 Bacteria 2066
213 Ga0307415_100193144 3300032126 Bacteria 1608
214 Ga0316585_10003357 3300032137 Bacteria 4404
215 Ga0373950_0005515 3300034818 Bacteria 1894
216 Ga0373949_0018428 3300035090 Bacteria 1582
217 Ga0373952_0014640 3300035092 Bacteria 1573
218 Ga0373941_0009550 3300035115 Bacteria 2447
219 Ga0373961_0012041 3300035241 Bacteria 2159
220 Ga0373962_0006226 3300035242 Bacteria 2887
221 Ga0316574_0003035 3300035398 Bacteria 8558
222 Ga0316574_0009163 3300035398 Bacteria 5532
223 Ga0373937_0138349 3300036401 Bacteria 2277
224 Ga0316582_0059481 3300036647 Bacteria 2447
225 Ga0316584_0024417 3300036712 Bacteria 4423
226 Ga0395899_0116615 3300037312 Bacteria 1916
227 Ga0395900_0040382 3300037418 Bacteria 4809
228 Ga0395900_0045164 3300037418 Bacteria 4538
229 Ga0395898_0008716 3300037466 Bacteria 10700
230 Ga0395898_0259625 3300037466 Bacteria 1657
231 Ga0436364_0946367 3300037853 Bacteria 4126
232 Ga0395901_0014992 3300038443 Bacteria 7877
233 Ga0395901_0034105 3300038443 Bacteria 5256
234 Ga0436365_0002213 3300039437 Bacteria 1134
235 Ga0436363_0202882 3300039450 Bacteria 1536
236 Ga0451853_2435691 3300041512 Bacteria 1429
237 Ga0466972_0009328 3300044658 Bacteria 4933
238 Ga0466972_0104184 3300044658 Bacteria 1342
239 Ga0466965_0080463 3300044683 Bacteria 1646
240 Ga0466966_0002616 3300044684 Bacteria 11793
241 Ga0466966_0039527 3300044684 Bacteria 3038
242 Ga0466966_0062044 3300044684 Bacteria 2357
243 Ga0466966_0106574 3300044684 Bacteria 1730
244 Ga0466961_0040178 3300044693 Bacteria 2999
245 Ga0466961_0044354 3300044693 Bacteria 2845
246 Ga0466961_0048538 3300044693 Bacteria 2713
247 Ga0466961_0091456 3300044693 Bacteria 1921
248 Ga0466961_0126587 3300044693 Bacteria 1602
249 Ga0466961_0158198 3300044693 Bacteria 1413
250 Ga0466961_0246575 3300044693 Bacteria 1097
251 Ga0466961_0296511 3300044693 Bacteria 988
252 Ga0466963_0023518 3300044694 Bacteria 3914
253 Ga0466963_0023914 3300044694 Bacteria 3885
254 Ga0466963_0026634 3300044694 Bacteria 3698
255 Ga0466963_0088253 3300044694 Bacteria 2110
256 Ga0466963_0164034 3300044694 Bacteria 1547
257 Ga0466963_0188322 3300044694 Bacteria 1441
258 Ga0466963_0511972 3300044694 Bacteria 847
259 Ga0466971_0092521 3300044719 Bacteria 1385
260 Ga0466971_0122241 3300044719 Bacteria 1205
261 Ga0466968_0048943 3300044735 Bacteria 1800
262 Ga0466970_0034571 3300044765 Bacteria 2676
263 Ga0466970_0148971 3300044765 Bacteria 1292
264 Ga0466957_0076046 3300044842 Bacteria 2084
265 Ga0466957_0231120 3300044842 Bacteria 1224
266 Ga0466960_0014196 3300044901 Bacteria 3403
267 Ga0466960_0059876 3300044901 Bacteria 1864
268 Ga0466959_0008950 3300045049 Bacteria 7103
269 Ga0466959_0059672 3300045049 Bacteria 2778
270 Ga0466959_0073877 3300045049 Bacteria 2466
271 Ga0466959_0115293 3300045049 Bacteria 1914
272 Ga0466959_0163148 3300045049 Bacteria 1566
273 Ga0466958_0000753 3300045836 Bacteria 14219
274 Ga0466958_0031442 3300045836 Bacteria 3155
275 Ga0466958_0048318 3300045836 Bacteria 2571
276 Ga0466958_0105261 3300045836 Bacteria 1758
277 Ga0466958_0260250 3300045836 Bacteria 1110
278 Ga0466958_0332290 3300045836 Bacteria 977
279 Ga0466967_0009167 3300045976 Bacteria 7323
280 Ga0466967_0014310 3300045976 Bacteria 6174
281 Ga0466967_0020762 3300045976 Bacteria 5318
282 Ga0466967_0032964 3300045976 Bacteria 4380
283 Ga0466967_0042716 3300045976 Bacteria 3919
284 Ga0466967_0059297 3300045976 Bacteria 3387
285 Ga0466967_0064625 3300045976 Bacteria 3254
286 Ga0466967_0095030 3300045976 Bacteria 2716
287 Ga0466967_0129591 3300045976 Bacteria 2340
288 Ga0466967_0258992 3300045976 Bacteria 1664
289 Ga0466967_0307985 3300045976 Bacteria 1525
290 Ga0466967_0374626 3300045976 Bacteria 1381
291 Ga0495592_0071551 3300046454 Bacteria 2524
292 Ga0495641_0080205 3300046461 Bacteria 1462
293 Ga0495653_0021801 3300046463 Bacteria 5186
294 Ga0495664_0051382 3300046477 Bacteria 2447
295 Ga0495664_0147420 3300046477 Bacteria 1427
296 Ga0495596_0074872 3300046500 Bacteria 1315
297 Ga0495618_0093626 3300046514 Bacteria 1921
298 Ga0495663_0037166 3300046525 Bacteria 1468
299 Ga0495640_0169539 3300046533 Bacteria 1395
300 Ga0495623_0098262 3300046679 Bacteria 1787
301 Ga0495674_0037250 3300047319 Bacteria 4370
302 Ga0495685_042075 3300047447 Bacteria 1560
303 Ga0495593_0147858 3300047673 Bacteria 1189
304 Ga0496100_0015022 3300048903 Bacteria 4514
305 Ga0496100_0027318 3300048903 Bacteria 3509
306 Ga0496100_0070582 3300048903 Bacteria 2330
307 Ga0496101_0002141 3300048904 Bacteria 12051
308 Ga0496101_0090157 3300048904 Bacteria 2280
309 Ga0496102_0006189 3300048905 Bacteria 10201
310 Ga0496102_0008001 3300048905 Bacteria 9035
311 Ga0496103_0023872 3300048906 Bacteria 3689
312 Ga0496103_0083560 3300048906 Bacteria 2010
313 Ga0496104_0014306 3300048907 Bacteria 7164
314 Ga0496104_0023562 3300048907 Bacteria 5660
315 Ga0496104_0084681 3300048907 Bacteria 3026
316 Ga0496104_0106245 3300048907 Bacteria 2690
317 Ga0496105_0010672 3300048908 Bacteria 7226
318 Ga0496105_0053671 3300048908 Bacteria 3328
319 Ga0496105_0117405 3300048908 Bacteria 2194
320 Ga0496105_0120015 3300048908 Bacteria 2169
321 Ga0496105_0270469 3300048908 Bacteria 1372
322 Ga0496106_0295067 3300048909 Bacteria 1300
323 Ga0496108_0033867 3300048911 Bacteria 4244
324 Ga0496109_0010209 3300048912 Bacteria 8016
325 Ga0496109_0183886 3300048912 Bacteria 1964
326 Ga0496110_0030976 3300048913 Bacteria 4613
327 Ga0496110_0103606 3300048913 Bacteria 2552
328 Ga0496111_0030414 3300048914 Bacteria 3839
329 Ga0496111_0102582 3300048914 Bacteria 2103
330 Ga0496111_0130118 3300048914 Bacteria 1862
331 Ga0496112_0013577 3300048915 Bacteria 7526
332 Ga0496113_0111885 3300048916 Bacteria 2126
333 Ga0496113_0118200 3300048916 Bacteria 2070
334 Ga0496113_0202202 3300048916 Bacteria 1579
335 Ga0496114_0012175 3300048917 Bacteria 6884
336 Ga0496114_0013868 3300048917 Bacteria 6462
337 Ga0496114_0017507 3300048917 Bacteria 5784
338 Ga0496114_0019008 3300048917 Bacteria 5566
339 Ga0496114_0087063 3300048917 Bacteria 2648
340 Ga0496114_0197358 3300048917 Bacteria 1762
341 Ga0496114_0198345 3300048917 Bacteria 1757
342 Ga0496114_0218443 3300048917 Bacteria 1673
343 Ga0496115_0041737 3300048918 Bacteria 3653
344 Ga0496115_0165916 3300048918 Bacteria 1826
345 Ga0501031_0010293 3300049568 Bacteria 6090
346 Ga0501031_0073334 3300049568 Bacteria 2229
347 Ga0501031_0217302 3300049568 Bacteria 1245
348 Ga0501032_0000515 3300049569 Bacteria 31388
349 Ga0501033_0003603 3300049570 Bacteria 12641
350 Ga0501033_0071656 3300049570 Bacteria 2545
351 Ga0501033_0152154 3300049570 Bacteria 1669
352 Ga0501036_0002084 3300049572 Bacteria 15586
353 Ga0501036_0349273 3300049572 Bacteria 1235
354 Ga0501037_0005591 3300049573 Bacteria 9163
355 Ga0501037_0048840 3300049573 Bacteria 3099
356 Ga0501038_0002461 3300049574 Bacteria 17243
357 Ga0501038_0120987 3300049574 Bacteria 2159
358 Ga0501038_0368768 3300049574 Bacteria 1116
359 Ga0501039_0006416 3300049575 Bacteria 8934
360 Ga0501039_0176503 3300049575 Bacteria 1680
361 Ga0501039_0202238 3300049575 Bacteria 1562
362 Ga0501040_0010307 3300049576 Bacteria 6113
363 Ga0501041_0001086 3300049577 Bacteria 14885
364 Ga0501042_0004336 3300049578 Bacteria 9045
365 Ga0501043_0009470 3300049579 Bacteria 7641
366 Ga0501043_0036526 3300049579 Bacteria 3865
367 Ga0501046_0035704 3300049580 Bacteria 4005
368 Ga0501047_0002022 3300049581 Bacteria 19408
369 Ga0501048_0000162 3300049582 Bacteria 41735
370 Ga0501048_0010627 3300049582 Bacteria 6867
371 Ga0501068_0079376 3300049584 Bacteria 2012
372 Ga0501069_0084065 3300049585 Bacteria 1795
373 Ga0501070_0107334 3300049586 Bacteria 2307
374 Ga0501071_0013865 3300049587 Bacteria 5502
375 Ga0501071_0245265 3300049587 Bacteria 1351
376 Ga0501072_0002215 3300049588 Bacteria 14521
377 Ga0501074_0040241 3300049590 Bacteria 3386
378 Ga0501075_0001906 3300049591 Bacteria 13758
379 Ga0501075_0142191 3300049591 Bacteria 1829
380 Ga0501076_0000795 3300049592 Bacteria 20413
381 Ga0501076_0310994 3300049592 Bacteria 1292
382 Ga0501077_0044508 3300049593 Bacteria 2819
383 Ga0501079_0035604 3300049741 Bacteria 3832
384 Ga0501080_0011874 3300049742 Bacteria 7979
385 Ga0501080_0463535 3300049742 Bacteria 1135
386 Ga0501081_0008022 3300049743 Bacteria 6850
387 Ga0501035_0015827 3300049822 Bacteria 6961
388 Ga0501035_0132891 3300049822 Bacteria 2168
389 Ga0501035_0187441 3300049822 Bacteria 1780
390 Ga0501044_0167307 3300049823 Bacteria 2172
391 Ga0501044_0194045 3300049823 Bacteria 1992
392 Ga0501044_0196250 3300049823 Bacteria 1978
393 Ga0501045_0001579 3300049824 Bacteria 15190
394 Ga0501045_0138903 3300049824 Bacteria 1807
395 nmdc:mga0n895_27290_c1 3300050512 Bacteria 5422
396 nmdc:mga0rr50_33569_c1 3300050513 Bacteria 3667
397 nmdc:mga0a205_4900_c1 3300050515 Bacteria 12033
398 Ga0495619_0169005 3300053085 Bacteria 1512
399 Ga0501084_0002071 3300054114 Bacteria 16010
400 Ga0501082_0048942 3300060353 Bacteria 3644
401 Ga0466962_0007921 3300061719 Bacteria 5095
402 Ga0466962_0026502 3300061719 Bacteria 2783
403 Ga0466962_0059416 3300061719 Bacteria 1825
404 Ga0466962_0066548 3300061719 Bacteria 1720
405 Ga0466962_0170768 3300061719 Bacteria 1059
406 Ga0530510_0239791 3300061734 Bacteria 1350
407 2623500196 2622736605 Bacteria 4992138
408 2643849666 2643221567 Bacteria 4163945
409 2644135667 2643221624 Bacteria 4384879
410 2644611021 2643221711 Bacteria 4865335
411 2808874489 2808606365 Bacteria 4301966
412 2812375158 2811994882 Bacteria 4688362
413 2819427899 2818991318 Bacteria 5266538
414 2819666779 2818991458 Bacteria 4794049
415 2819691906 2818991462 Bacteria 4320267
416 2819729310 2818991469 Bacteria 4644110
417 2919450622 2919446982 Bacteria 3994487
418 3001891604 3001889506 Bacteria 2975194
419 Ga0207662_10161863
420 Ga0070658_10007702
421 Ga0070658_10017509
422 Ga0070658_10313802
423 Ga0068868_100044727
424 Ga0070668_100017603
425 Ga0070671_100211991
426 Ga0070674_100032838
427 Ga0070673_100101733
428 Ga0070659_100210952
429 Ga0070667_100005202
430 Ga0070667_100108028
431 Ga0070667_100223029
432 Ga0070709_10053481
433 Ga0070714_100003398
434 Ga0070714_100018298
435 Ga0070714_100030198
436 Ga0070714_100036116
437 Ga0070714_100057973
438 Ga0070714_100114795
439 Ga0070713_100013147
440 Ga0070713_100021312
441 Ga0070713_100032359
442 Ga0070713_100060298
443 Ga0070713_100089218
444 Ga0070710_10003585
445 Ga0070701_10169052
446 Ga0070700_100086279
447 Ga0070694_100105293
448 Ga0070708_100058139
449 Ga0070662_100011119
450 Ga0070685_10058338
451 Ga0070706_100057204
452 Ga0070706_100090092
453 Ga0070707_100000199
454 Ga0070707_100072796
455 Ga0070698_100025443
456 Ga0070679_100131959
457 Ga0070684_100318938
458 Ga0070697_100025271
459 Ga0070697_100075483
460 Ga0068853_100248781
461 Ga0070686_100055361
462 Ga0070695_100010587
463 Ga0070693_100088994
464 Ga0070693_100207369
465 Ga0070704_100140896
466 Ga0068855_100030711
467 Ga0068854_100045352
468 Ga0068856_100007792
469 Ga0068856_100009537
470 Ga0068856_100024084
471 Ga0068856_100025203
472 Ga0068856_100115056
473 Ga0070702_100002966
474 Ga0070702_100081930
475 Ga0068852_100117585
476 Ga0068864_100149661
477 Ga0068866_10027191
478 Ga0068861_100151739
479 Ga0068858_100032279
480 Ga0068860_100019619
481 Ga0068860_100436401
482 Ga0081455_10016983
483 Ga0081540_1020607
484 Ga0070717_10047828
485 Ga0070717_10062890
486 Ga0070717_10112967
487 Ga0070717_10114573
488 Ga0070715_10002983
489 Ga0070715_10023617
490 Ga0070716_100000541
491 Ga0070716_100012987
492 Ga0070712_100009879
493 Ga0070712_100067706
494 Ga0070712_100074126
495 Ga0097621_100026361
496 Ga0075433_10072909
497 Ga0075434_100110151
498 Ga0068865_100049225
499 Ga0068865_100071872
500 Ga0105251_10044954
501 Ga0105240_10055498
502 Ga0105245_10014543
503 Ga0105245_10301750
504 Ga0105247_10043510
505 Ga0105243_10006999
506 Ga0105243_10015567
507 Ga0105243_10332694
508 Ga0105241_10144632
509 Ga0105242_10048802
510 Ga0105237_10087922
511 Ga0105237_10744189
512 Ga0105238_10167025
513 Ga0105249_10003377
514 Ga0105249_10071431
515 Ga0105249_10369589
516 Ga0105239_10011557
517 Ga0105246_10003374
518 Ga0157370_10097864
519 Ga0157369_10029006
520 Ga0157374_10091608
521 Ga0157378_10008977
522 Ga0163162_10029520
523 Ga0163162_10253097
524 Ga0157372_10019302
525 Ga0157375_10001756
526 Ga0163163_10521162
527 Ga0157380_10145670
528 Ga0157376_10093731
529 Ga0206353_10012160
530 Ga0206353_11672202
531 Ga0224712_10005332
532 Ga0207692_10002740
533 Ga0207642_10007183
534 Ga0207688_10002272
535 Ga0207688_10014259
536 Ga0207699_10001443
537 Ga0207699_10037589
538 Ga0207643_10071833
539 Ga0207705_10008515
540 Ga0207684_10009458
541 Ga0207654_10214589
542 Ga0207693_10003986
543 Ga0207693_10097898
544 Ga0207663_10015252
545 Ga0207657_10006887
546 Ga0207657_10076816
547 Ga0207652_10154976
548 Ga0207652_10182190
549 Ga0207646_10000278
550 Ga0207646_10008286
551 Ga0207659_10072165
552 Ga0207687_10024342
553 Ga0207700_10006062
554 Ga0207700_10042641
555 Ga0207700_10061667
556 Ga0207700_10132591
557 Ga0207664_10000958
558 Ga0207664_10005342
559 Ga0207664_10010082
560 Ga0207664_10024728
561 Ga0207664_10033831
562 Ga0207644_10051733
563 Ga0207706_10016276
564 Ga0207686_10075957
565 Ga0207709_10027533
566 Ga0207669_10058784
567 Ga0207669_10190774
568 Ga0207665_10000215
569 Ga0207665_10004263
570 Ga0207691_10029733
571 Ga0207691_10166975
572 Ga0207689_10055394
573 Ga0207679_10273789
574 Ga0207667_10080871
575 Ga0207651_10061605
576 Ga0207712_10006273
577 Ga0207712_10025450
578 Ga0207668_10080948
579 Ga0207658_10011424
580 Ga0207639_10037582
581 Ga0207678_10004176
582 Ga0207678_10141418
583 Ga0207708_10006431
584 Ga0207702_10013181
585 Ga0207702_10018426
586 Ga0207702_10067856
587 Ga0207641_10180887
588 Ga0207675_100137054
589 Ga0207675_100182052
590 Ga0207683_10003143
591 Ga0207683_10018758
592 Ga0207683_10090480
593 Ga0207683_10322142
594 Ga0207698_10032742
595 Ga0207428_10200450
596 Ga0268265_10044510
597 Ga0268264_10376515
598 Ga0307408_100286558
599 Ga0316579_10002105
600 Ga0316576_10014311
601 Ga0316578_10004093
602 Ga0307405_10066085
603 Ga0307405_10108874
604 Ga0316577_10000534
605 Ga0307410_10002268
606 Ga0307410_10008037
607 Ga0307410_10080928
608 Ga0307410_10330120
609 Ga0307406_10044302
610 Ga0307406_10206401
611 Ga0307406_10277893
612 Ga0307407_10002701
613 Ga0307407_10127014
614 Ga0307407_10166474
615 Ga0307409_100012256
616 Ga0307409_100042237
617 Ga0307409_100054490
618 Ga0307409_100087481
619 Ga0307409_100226662
620 Ga0307409_100274125
621 Ga0307416_100009785
622 Ga0307416_100027477
623 Ga0307416_100170997
624 Ga0307416_100208607
625 Ga0307416_100613050
626 Ga0307414_10154520
627 Ga0307414_10188781
628 Ga0307411_10166104
629 Ga0307415_100061863
630 Ga0307415_100106922
631 Ga0307415_100193144
632 Ga0316585_10003357
633 Ga0373950_0005515
634 Ga0373949_0018428
635 Ga0373952_0014640
636 Ga0373941_0009550
637 Ga0373961_0012041
638 Ga0373962_0006226
639 Ga0316574_0003035
640 Ga0316574_0009163
641 Ga0373937_0138349
642 Ga0316582_0059481
643 Ga0316584_0024417
644 Ga0395899_0116615
645 Ga0395900_0040382
646 Ga0395900_0045164
647 Ga0395898_0008716
648 Ga0395898_0259625
649 Ga0436364_0946367
650 Ga0395901_0014992
651 Ga0395901_0034105
652 Ga0436365_0002213
653 Ga0436363_0202882
654 Ga0451853_2435691
655 Ga0466972_0009328
656 Ga0466972_0104184
657 Ga0466965_0080463
658 Ga0466966_0002616
659 Ga0466966_0039527
660 Ga0466966_0062044
661 Ga0466966_0106574
662 Ga0466961_0040178
663 Ga0466961_0044354
664 Ga0466961_0048538
665 Ga0466961_0091456
666 Ga0466961_0126587
667 Ga0466961_0158198
668 Ga0466961_0246575
669 Ga0466961_0296511
670 Ga0466963_0023518
671 Ga0466963_0023914
672 Ga0466963_0026634
673 Ga0466963_0088253
674 Ga0466963_0164034
675 Ga0466963_0188322
676 Ga0466963_0511972
677 Ga0466971_0092521
678 Ga0466971_0122241
679 Ga0466968_0048943
680 Ga0466970_0034571
681 Ga0466970_0148971
682 Ga0466957_0076046
683 Ga0466957_0231120
684 Ga0466960_0014196
685 Ga0466960_0059876
686 Ga0466959_0008950
687 Ga0466959_0059672
688 Ga0466959_0073877
689 Ga0466959_0115293
690 Ga0466959_0163148
691 Ga0466958_0000753
692 Ga0466958_0031442
693 Ga0466958_0048318
694 Ga0466958_0105261
695 Ga0466958_0260250
696 Ga0466958_0332290
697 Ga0466967_0009167
698 Ga0466967_0014310
699 Ga0466967_0020762
700 Ga0466967_0032964
701 Ga0466967_0042716
702 Ga0466967_0059297
703 Ga0466967_0064625
704 Ga0466967_0095030
705 Ga0466967_0129591
706 Ga0466967_0258992
707 Ga0466967_0307985
708 Ga0466967_0374626
709 Ga0495592_0071551
710 Ga0495641_0080205
711 Ga0495653_0021801
712 Ga0495664_0051382
713 Ga0495664_0147420
714 Ga0495596_0074872
715 Ga0495618_0093626
716 Ga0495663_0037166
717 Ga0495640_0169539
718 Ga0495623_0098262
719 Ga0495674_0037250
720 Ga0495685_042075
721 Ga0495593_0147858
722 Ga0496100_0015022
723 Ga0496100_0027318
724 Ga0496100_0070582
725 Ga0496101_0002141
726 Ga0496101_0090157
727 Ga0496102_0006189
728 Ga0496102_0008001
729 Ga0496103_0023872
730 Ga0496103_0083560
731 Ga0496104_0014306
732 Ga0496104_0023562
733 Ga0496104_0084681
734 Ga0496104_0106245
735 Ga0496105_0010672
736 Ga0496105_0053671
737 Ga0496105_0117405
738 Ga0496105_0120015
739 Ga0496105_0270469
740 Ga0496106_0295067
741 Ga0496108_0033867
742 Ga0496109_0010209
743 Ga0496109_0183886
744 Ga0496110_0030976
745 Ga0496110_0103606
746 Ga0496111_0030414
747 Ga0496111_0102582
748 Ga0496111_0130118
749 Ga0496112_0013577
750 Ga0496113_0111885
751 Ga0496113_0118200
752 Ga0496113_0202202
753 Ga0496114_0012175
754 Ga0496114_0013868
755 Ga0496114_0017507
756 Ga0496114_0019008
757 Ga0496114_0087063
758 Ga0496114_0197358
759 Ga0496114_0198345
760 Ga0496114_0218443
761 Ga0496115_0041737
762 Ga0496115_0165916
763 Ga0501031_0010293
764 Ga0501031_0073334
765 Ga0501031_0217302
766 Ga0501032_0000515
767 Ga0501033_0003603
768 Ga0501033_0071656
769 Ga0501033_0152154
770 Ga0501036_0002084
771 Ga0501036_0349273
772 Ga0501037_0005591
773 Ga0501037_0048840
774 Ga0501038_0002461
775 Ga0501038_0120987
776 Ga0501038_0368768
777 Ga0501039_0006416
778 Ga0501039_0176503
779 Ga0501039_0202238
780 Ga0501040_0010307
781 Ga0501041_0001086
782 Ga0501042_0004336
783 Ga0501043_0009470
784 Ga0501043_0036526
785 Ga0501046_0035704
786 Ga0501047_0002022
787 Ga0501048_0000162
788 Ga0501048_0010627
789 Ga0501068_0079376
790 Ga0501069_0084065
791 Ga0501070_0107334
792 Ga0501071_0013865
793 Ga0501071_0245265
794 Ga0501072_0002215
795 Ga0501074_0040241
796 Ga0501075_0001906
797 Ga0501075_0142191
798 Ga0501076_0000795
799 Ga0501076_0310994
800 Ga0501077_0044508
801 Ga0501079_0035604
802 Ga0501080_0011874
803 Ga0501080_0463535
804 Ga0501081_0008022
805 Ga0501035_0015827
806 Ga0501035_0132891
807 Ga0501035_0187441
808 Ga0501044_0167307
809 Ga0501044_0194045
810 Ga0501044_0196250
811 Ga0501045_0001579
812 Ga0501045_0138903
813 nmdc:mga0n895_27290_c1
814 nmdc:mga0rr50_33569_c1
815 nmdc:mga0a205_4900_c1
816 Ga0495619_0169005
817 Ga0501084_0002071
818 Ga0501082_0048942
819 Ga0466962_0007921
820 Ga0466962_0026502
821 Ga0466962_0059416
822 Ga0466962_0066548
823 Ga0466962_0170768
824 Ga0530510_0239791
825 2623500196
826 2643849666
827 2644135667
828 2644611021
829 2808874489
830 2812375158
831 2819427899
832 2819666779
833 2819691906
834 2819729310
835 2919450622
836 3001891604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

7

301

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.9404 26 323
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.9399 26 323
1ep3-assembly1.cif.gz_A crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 0.9239 21 329
1ep2-assembly1.cif.gz_A-2 crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 0.9212 23 323
1ep3-assembly1.cif.gz_A crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 0.9154 21 329
ID Description Score Start End Superfamily
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9361 23 323 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9068 23 323 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9025 27 328 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8968 27 328 3.20.20.70
af_Q12882_533_844_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8466 28 316 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Y5TBB0-F1-model_v4 Dihydroorotate dehydrogenase 0.9723 240 335 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A2W4ME67-F1-model_v4 Dihydroorotate dehydrogenase 0.9663 239 329 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A354CZ61-F1-model_v4 Dihydroorotate dehydrogenase 0.9626 238 325 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A132MSB2-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.9616 24 330 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A7V5N4V6-F1-model_v4 Dihydroorotate dehydrogenase 0.9601 26 216 GO:0004152
GO:0005737
GO:0006207
GO:0044205

Map