F439262

General Info

Members Datasets Scaffolds Average Seq Length
418 229 413 157

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_101028135|Ga0068858_1010281352
Length 173
Sequence MAGLDPAIHPSVFVIGMAKKKDDGFKIIADNRRARYAYAIDETLEAGIMLVGSEVKSLRSGKTTIGESYAHAKDGELWLVNCYIPEYTQASRFNHEPKRSRKLLVHKREAARLAAAIQREGMTLIPLKLYFNAKGTAKIEIGVAKGKKLHDKRETEKQRDWQRDKARLLRDKG

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2773857925 Microvirga vignae BR3299 Isolate Unclassified
3 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
4 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
5 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
226 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 0
Rhizoplane 1.2
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000300 3300003214 Bacteria 62270
2 Ga0070658_10066655 3300005327 Bacteria 2941
3 Ga0070683_100758381 3300005329 Bacteria 930
4 Ga0070690_100182452 3300005330 Bacteria 1451
5 Ga0068869_100038457 3300005334 Bacteria 3411
6 Ga0070666_10005773 3300005335 Bacteria 7604
7 Ga0070666_10056305 3300005335 Bacteria 2655
8 Ga0070666_10131994 3300005335 Bacteria 1736
9 Ga0070680_100116636 3300005336 Bacteria 2226
10 Ga0068868_100224817 3300005338 Bacteria 1572
11 Ga0070660_100025731 3300005339 Bacteria 4376
12 Ga0070689_100105411 3300005340 Bacteria 2236
13 Ga0070689_100737225 3300005340 Bacteria 863
14 Ga0070661_100096241 3300005344 Bacteria 2196
15 Ga0070661_101478421 3300005344 Bacteria 573
16 Ga0070675_100262450 3300005354 Bacteria 1514
17 Ga0070671_100685073 3300005355 Bacteria 888
18 Ga0070673_100120836 3300005364 Bacteria 2185
19 Ga0070688_101225071 3300005365 Bacteria 604
20 Ga0070659_100060339 3300005366 Bacteria 2995
21 Ga0070659_100456372 3300005366 Bacteria 1085
22 Ga0070667_100057074 3300005367 Bacteria 3298
23 Ga0070701_10144565 3300005438 Bacteria 1364
24 Ga0070701_10251633 3300005438 Bacteria 1067
25 Ga0070694_100947621 3300005444 Bacteria 712
26 Ga0070678_100007105 3300005456 Bacteria 6623
27 Ga0068867_100010739 3300005459 Bacteria 6458
28 Ga0068867_100197417 3300005459 Bacteria 1609
29 Ga0068867_100585637 3300005459 Bacteria 971
30 Ga0070679_100920672 3300005530 Bacteria 818
31 Ga0068853_100619484 3300005539 Bacteria 1029
32 Ga0068853_100720130 3300005539 Bacteria 953
33 Ga0068853_100921319 3300005539 Bacteria 840
34 Ga0070686_100335953 3300005544 Bacteria 1131
35 Ga0070695_100280420 3300005545 Bacteria 1224
36 Ga0070695_100631632 3300005545 Bacteria 844
37 Ga0070665_100041895 3300005548 Bacteria 4603
38 Ga0070665_100244994 3300005548 Bacteria 1793
39 Ga0070665_100289181 3300005548 Bacteria 1641
40 Ga0070665_100494978 3300005548 Bacteria 1234
41 Ga0070704_101253959 3300005549 Bacteria 677
42 Ga0068855_100026640 3300005563 Bacteria 6917
43 Ga0068855_100051875 3300005563 Bacteria 4831
44 Ga0068855_100362196 3300005563 Bacteria 1595
45 Ga0070664_100493782 3300005564 Bacteria 1128
46 Ga0068857_100400912 3300005577 Bacteria 1276
47 Ga0068857_100573135 3300005577 Bacteria 1065
48 Ga0070702_100341741 3300005615 Bacteria 1051
49 Ga0068859_100275816 3300005617 Bacteria 1774
50 Ga0068864_100146445 3300005618 Bacteria 2135
51 Ga0068864_100389499 3300005618 Bacteria 1322
52 Ga0068866_10129600 3300005718 Bacteria 1433
53 Ga0068870_10408129 3300005840 Bacteria 886
54 Ga0068863_100325966 3300005841 Bacteria 1492
55 Ga0068858_100027825 3300005842 Bacteria 5252
56 Ga0068858_100228885 3300005842 Bacteria 1762
57 Ga0068858_100315925 3300005842 Bacteria 1492
58 Ga0068858_100348900 3300005842 Bacteria 1417
59 Ga0068858_101028135 3300005842 Bacteria 808
60 Ga0068860_101261279 3300005843 Bacteria 760
61 Ga0068862_100116858 3300005844 Bacteria 2347
62 Ga0075363_100002152 3300006048 Bacteria 7923
63 Ga0075364_10014764 3300006051 Bacteria 4831
64 Ga0075366_10029796 3300006195 Bacteria 3206
65 Ga0097621_100001637 3300006237 Bacteria 15341
66 Ga0097621_100035828 3300006237 Bacteria 3966
67 Ga0097621_100057984 3300006237 Bacteria 3168
68 Ga0097621_100135124 3300006237 Bacteria 2103
69 Ga0097621_100140249 3300006237 Bacteria 2065
70 Ga0097621_100155111 3300006237 Bacteria 1965
71 Ga0075370_10181198 3300006353 Bacteria 1240
72 Ga0068871_100006532 3300006358 Bacteria 8260
73 Ga0068871_100034479 3300006358 Bacteria 4016
74 Ga0068871_100067692 3300006358 Bacteria 2931
75 Ga0068871_100092688 3300006358 Bacteria 2520
76 Ga0068871_100098128 3300006358 Bacteria 2451
77 Ga0068865_100130590 3300006881 Bacteria 1882
78 Ga0097620_100275801 3300006931 Bacteria 1774
79 Ga0105240_10007938 3300009093 Bacteria 15312
80 Ga0105240_10081849 3300009093 Bacteria 3965
81 Ga0105240_10159139 3300009093 Bacteria 2684
82 Ga0105240_10938198 3300009093 Bacteria 929
83 Ga0105240_10982333 3300009093 Bacteria 904
84 Ga0105245_10041140 3300009098 Bacteria 4120
85 Ga0105245_10352448 3300009098 Bacteria 1459
86 Ga0105247_10908153 3300009101 Bacteria 681
87 Ga0114129_10926055 3300009147 Bacteria 1103
88 Ga0105243_10006489 3300009148 Bacteria 9046
89 Ga0105243_10260134 3300009148 Bacteria 1553
90 Ga0105243_11483612 3300009148 Bacteria 701
91 Ga0105241_10009944 3300009174 Bacteria 6988
92 Ga0105241_10025069 3300009174 Bacteria 4432
93 Ga0105241_10040842 3300009174 Bacteria 3503
94 Ga0105241_10577949 3300009174 Bacteria 1012
95 Ga0105241_10894570 3300009174 Bacteria 824
96 Ga0105242_10023655 3300009176 Bacteria 4843
97 Ga0105242_10106345 3300009176 Bacteria 2384
98 Ga0105242_10146378 3300009176 Bacteria 2055
99 Ga0105242_10323372 3300009176 Bacteria 1415
100 Ga0105242_11047216 3300009176 Bacteria 827
101 Ga0105248_10130194 3300009177 Bacteria 2838
102 Ga0105248_10860549 3300009177 Bacteria 1023
103 Ga0105248_11140209 3300009177 Bacteria 881
104 Ga0105248_11414121 3300009177 Bacteria 787
105 Ga0105237_10077546 3300009545 Bacteria 3313
106 Ga0105237_10227055 3300009545 Bacteria 1867
107 Ga0105237_10279611 3300009545 Bacteria 1672
108 Ga0105237_11455818 3300009545 Bacteria 691
109 Ga0105238_10124440 3300009551 Bacteria 2558
110 Ga0105238_10486806 3300009551 Bacteria 1233
111 Ga0105238_10633823 3300009551 Bacteria 1078
112 Ga0105238_10674835 3300009551 Bacteria 1044
113 Ga0105238_11563067 3300009551 Bacteria 689
114 Ga0105249_10418944 3300009553 Bacteria 1372
115 Ga0105239_10031804 3300010375 Bacteria 5798
116 Ga0105239_10095539 3300010375 Bacteria 3283
117 Ga0105239_10321194 3300010375 Bacteria 1746
118 Ga0105239_10343489 3300010375 Bacteria 1685
119 Ga0105239_10365323 3300010375 Bacteria 1630
120 Ga0105239_10770004 3300010375 Bacteria 1102
121 Ga0105239_10899675 3300010375 Bacteria 1016
122 Ga0105239_10923717 3300010375 Bacteria 1002
123 Ga0105239_11444931 3300010375 Bacteria 794
124 Ga0105246_10004442 3300011119 Bacteria 8536
125 Ga0105246_10487075 3300011119 Bacteria 1044
126 Ga0105246_10824410 3300011119 Bacteria 825
127 Ga0157373_10812471 3300013100 Bacteria 690
128 Ga0157370_10750652 3300013104 Bacteria 889
129 Ga0157369_10027642 3300013105 Bacteria 6285
130 Ga0157374_10452812 3300013296 Bacteria 1285
131 Ga0157374_11299865 3300013296 Bacteria 749
132 Ga0157374_12274806 3300013296 Bacteria 569
133 Ga0157378_10060405 3300013297 Bacteria 3383
134 Ga0157378_10160287 3300013297 Bacteria 2103
135 Ga0163162_10039794 3300013306 Bacteria 4698
136 Ga0163162_10130331 3300013306 Bacteria 2623
137 Ga0163162_11107797 3300013306 Bacteria 897
138 Ga0157372_10143139 3300013307 Bacteria 2757
139 Ga0157372_10261936 3300013307 Bacteria 2008
140 Ga0157372_10629999 3300013307 Bacteria 1249
141 Ga0157375_11282880 3300013308 Bacteria 861
142 Ga0163163_10339810 3300014325 Bacteria 1556
143 Ga0163163_10627240 3300014325 Bacteria 1138
144 Ga0157379_10178076 3300014968 Bacteria 1921
145 Ga0157376_10441607 3300014969 Bacteria 1267
146 Ga0157376_10605957 3300014969 Bacteria 1090
147 Ga0157376_10652137 3300014969 Bacteria 1053
148 Ga0163161_10693210 3300017792 Bacteria 847
149 Ga0209233_1000013 3300025261 Bacteria 1013785
150 Ga0209233_1030358 3300025261 Bacteria 1274
151 Ga0209758_1045348 3300025297 Bacteria 1597
152 Ga0207682_10173065 3300025893 Bacteria 983
153 Ga0207682_10278932 3300025893 Bacteria 781
154 Ga0207680_10044985 3300025903 Bacteria 2600
155 Ga0207680_10058587 3300025903 Bacteria 2335
156 Ga0207685_10130892 3300025905 Bacteria 1113
157 Ga0207645_10487448 3300025907 Bacteria 834
158 Ga0207643_10123180 3300025908 Bacteria 1537
159 Ga0207705_10389975 3300025909 Bacteria 1076
160 Ga0207705_10833887 3300025909 Bacteria 715
161 Ga0207654_10005899 3300025911 Bacteria 6168
162 Ga0207654_10038135 3300025911 Bacteria 2694
163 Ga0207654_10078732 3300025911 Bacteria 1978
164 Ga0207654_10288816 3300025911 Bacteria 1111
165 Ga0207707_10289973 3300025912 Bacteria 1416
166 Ga0207695_10006605 3300025913 Bacteria 14987
167 Ga0207695_10014294 3300025913 Bacteria 9414
168 Ga0207695_10106835 3300025913 Bacteria 2785
169 Ga0207695_10653026 3300025913 Bacteria 933
170 Ga0207671_10281349 3300025914 Bacteria 1312
171 Ga0207671_10326854 3300025914 Bacteria 1214
172 Ga0207671_10470960 3300025914 Bacteria 1001
173 Ga0207663_10187070 3300025916 Bacteria 1484
174 Ga0207657_10019479 3300025919 Bacteria 6442
175 Ga0207649_10570813 3300025920 Bacteria 867
176 Ga0207649_10900709 3300025920 Bacteria 693
177 Ga0207652_10302211 3300025921 Bacteria 1444
178 Ga0207681_10595201 3300025923 Bacteria 913
179 Ga0207681_10859783 3300025923 Bacteria 759
180 Ga0207694_10012988 3300025924 Bacteria 6271
181 Ga0207694_10074361 3300025924 Bacteria 2660
182 Ga0207694_10247225 3300025924 Bacteria 1459
183 Ga0207694_10291320 3300025924 Bacteria 1343
184 Ga0207694_10512084 3300025924 Bacteria 1005
185 Ga0207659_10234049 3300025926 Bacteria 1483
186 Ga0207687_10030022 3300025927 Bacteria 3661
187 Ga0207687_10067258 3300025927 Bacteria 2548
188 Ga0207687_10144342 3300025927 Bacteria 1809
189 Ga0207687_10253843 3300025927 Bacteria 1399
190 Ga0207644_10316875 3300025931 Bacteria 1260
191 Ga0207686_10145198 3300025934 Bacteria 1645
192 Ga0207686_10213623 3300025934 Bacteria 1388
193 Ga0207686_10508887 3300025934 Bacteria 935
194 Ga0207670_10463327 3300025936 Bacteria 1024
195 Ga0207704_10498838 3300025938 Bacteria 981
196 Ga0207691_10153167 3300025940 Bacteria 2026
197 Ga0207691_10470356 3300025940 Bacteria 1069
198 Ga0207691_10480446 3300025940 Bacteria 1056
199 Ga0207711_10098822 3300025941 Bacteria 2579
200 Ga0207711_10110315 3300025941 Bacteria 2446
201 Ga0207711_10245111 3300025941 Bacteria 1644
202 Ga0207689_10061464 3300025942 Bacteria 3089
203 Ga0207661_10162896 3300025944 Bacteria 1936
204 Ga0207667_10007941 3300025949 Bacteria 12666
205 Ga0207651_10384739 3300025960 Bacteria 1190
206 Ga0207712_10028394 3300025961 Bacteria 3742
207 Ga0207658_10190689 3300025986 Bacteria 1703
208 Ga0207677_10021131 3300026023 Bacteria 3971
209 Ga0207703_10031629 3300026035 Bacteria 4186
210 Ga0207703_10218331 3300026035 Bacteria 1703
211 Ga0207703_10245107 3300026035 Bacteria 1613
212 Ga0207703_10296324 3300026035 Bacteria 1474
213 Ga0207703_10304975 3300026035 Bacteria 1453
214 Ga0207703_10380887 3300026035 Bacteria 1305
215 Ga0207639_11004694 3300026041 Bacteria 781
216 Ga0207708_10845579 3300026075 Bacteria 790
217 Ga0207702_10171271 3300026078 Bacteria 1991
218 Ga0207648_10015012 3300026089 Bacteria 7134
219 Ga0207676_10253811 3300026095 Bacteria 1584
220 Ga0207674_10114849 3300026116 Bacteria 2664
221 Ga0207674_10397557 3300026116 Bacteria 1332
222 Ga0207674_11066623 3300026116 Bacteria 777
223 Ga0207675_100142954 3300026118 Bacteria 2274
224 Ga0207675_101478441 3300026118 Bacteria 700
225 Ga0207683_10014768 3300026121 Bacteria 6648
226 Ga0207683_10115533 3300026121 Bacteria 2406
227 Ga0209983_1030224 3300027665 Bacteria 1153
228 Ga0268266_10020164 3300028379 Bacteria 5683
229 Ga0268266_10096333 3300028379 Bacteria 2600
230 Ga0268266_10276916 3300028379 Bacteria 1559
231 Ga0268266_10573695 3300028379 Bacteria 1082
232 Ga0268264_10330724 3300028381 Bacteria 1444
233 Ga0265334_10239894 3300028573 Bacteria 625
234 Ga0265318_10002134 3300028577 Bacteria 10758
235 Ga0265318_10197233 3300028577 Bacteria 736
236 Ga0307517_10513479 3300028786 Bacteria 607
237 Ga0265338_10264403 3300028800 Bacteria 1263
238 Ga0265332_10162024 3300031238 Bacteria 934
239 Ga0265328_10161616 3300031239 Bacteria 845
240 Ga0265328_10342138 3300031239 Bacteria 582
241 Ga0265325_10001479 3300031241 Bacteria 16557
242 Ga0265325_10015026 3300031241 Bacteria 4364
243 Ga0265325_10048302 3300031241 Bacteria 2200
244 Ga0265325_10061392 3300031241 Bacteria 1906
245 Ga0265340_10002681 3300031247 Bacteria 10122
246 Ga0265339_10019941 3300031249 Bacteria 3925
247 Ga0265339_10052269 3300031249 Bacteria 2226
248 Ga0265339_10071852 3300031249 Bacteria 1842
249 Ga0265339_10105541 3300031249 Bacteria 1463
250 Ga0265331_10029123 3300031250 Bacteria 2758
251 Ga0265331_10029318 3300031250 Bacteria 2747
252 Ga0265331_10030595 3300031250 Bacteria 2680
253 Ga0265316_10322680 3300031344 Bacteria 1122
254 Ga0307513_10305859 3300031456 Bacteria 1354
255 Ga0265313_10004469 3300031595 Bacteria 10713
256 Ga0265313_10007428 3300031595 Bacteria 7496
257 Ga0265313_10008082 3300031595 Bacteria 7044
258 Ga0265313_10060523 3300031595 Bacteria 1776
259 Ga0265313_10116715 3300031595 Bacteria 1168
260 Ga0265313_10247172 3300031595 Bacteria 728
261 Ga0265314_10005395 3300031711 Bacteria 11550
262 Ga0265314_10006199 3300031711 Bacteria 10620
263 Ga0265314_10018336 3300031711 Bacteria 5458
264 Ga0265314_10495789 3300031711 Bacteria 643
265 Ga0265342_10022056 3300031712 Bacteria 4055
266 Ga0265342_10226635 3300031712 Bacteria 1005
267 Ga0265342_10283361 3300031712 Bacteria 876
268 Ga0265342_10466828 3300031712 Bacteria 646
269 Ga0307516_10045075 3300031730 Bacteria 4358
270 Ga0307516_10050100 3300031730 Bacteria 4099
271 Ga0307409_101564950 3300031995 Bacteria 687
272 Ga0373957_0051465 3300035120 Bacteria 1576
273 Ga0373955_0105674 3300035172 Bacteria 1622
274 Ga0373933_0082738 3300035724 Bacteria 1970
275 Ga0373947_0198678 3300035725 Bacteria 1311
276 Ga0373937_0071298 3300036401 Bacteria 3204
277 Ga0373937_1140455 3300036401 Bacteria 728
278 Ga0373937_1332222 3300036401 Bacteria 666
279 Ga0373925_0848459 3300037068 Bacteria 753
280 Ga0395899_0051742 3300037312 Bacteria 3047
281 Ga0395900_0321978 3300037418 Bacteria 1526
282 Ga0395898_0007832 3300037466 Bacteria 11341
283 Ga0395898_1825529 3300037466 Bacteria 529
284 Ga0395905_0078702 3300037471 Bacteria 3090
285 Ga0395901_0114517 3300038443 Bacteria 2832
286 Ga0436365_0756891 3300039437 Bacteria 948
287 Ga0436365_1015159 3300039437 Bacteria 559
288 Ga0436365_1924943 3300039437 Bacteria 1028
289 Ga0451793_1578305 3300041452 Bacteria 691
290 Ga0439448_0112666 3300042005 Bacteria 930
291 Ga0466966_0140365 3300044684 Bacteria 1477
292 Ga0466958_0494526 3300045836 Bacteria 793
293 Ga0495629_0594210 3300046459 Bacteria 741
294 Ga0495638_0364472 3300046460 Bacteria 759
295 Ga0495651_0519509 3300046462 Bacteria 760
296 Ga0495651_0545075 3300046462 Bacteria 738
297 Ga0495580_0068377 3300046472 Bacteria 2484
298 Ga0495582_0024726 3300046473 Bacteria 3287
299 Ga0495582_0454115 3300046473 Bacteria 740
300 Ga0495585_0273887 3300046492 Bacteria 836
301 Ga0495606_0156531 3300046507 Bacteria 1333
302 Ga0495616_0142794 3300046513 Bacteria 1088
303 Ga0495628_1206345 3300046516 Bacteria 513
304 Ga0495648_0426882 3300046524 Bacteria 586
305 Ga0495654_0104160 3300046530 Bacteria 1302
306 Ga0495587_0013611 3300046536 Bacteria 5112
307 Ga0495621_0240194 3300046539 Bacteria 738
308 Ga0495622_0001758 3300046557 Bacteria 10705
309 Ga0495611_0031308 3300046648 Bacteria 2341
310 Ga0495599_0566354 3300046678 Bacteria 664
311 Ga0495658_0006001 3300046683 Bacteria 5964
312 Ga0495613_0182250 3300046689 Bacteria 1487
313 Ga0495660_0337768 3300046810 Bacteria 673
314 Ga0495604_0787252 3300047317 Bacteria 600
315 Ga0495674_0401315 3300047319 Bacteria 1107
316 Ga0495672_0192154 3300047320 Bacteria 1026
317 Ga0495685_029220 3300047447 Bacteria 1896
318 Ga0495686_0450377 3300047472 Bacteria 684
319 Ga0495602_0076203 3300048088 Bacteria 2843
320 Ga0496105_0184703 3300048908 Bacteria 1706
321 Ga0496106_0775952 3300048909 Bacteria 761
322 Ga0496110_0709711 3300048913 Bacteria 908
323 Ga0496114_0452090 3300048917 Bacteria 1138
324 Ga0496121_0001676 3300048924 Bacteria 36412
325 Ga0501032_0122069 3300049569 Bacteria 1722
326 Ga0501033_0112225 3300049570 Bacteria 1983
327 Ga0501033_0139056 3300049570 Bacteria 1756
328 Ga0501033_0264269 3300049570 Bacteria 1217
329 Ga0501034_0147080 3300049571 Bacteria 2333
330 Ga0501036_0288891 3300049572 Bacteria 1372
331 Ga0501036_0603344 3300049572 Bacteria 910
332 Ga0501036_0638220 3300049572 Bacteria 882
333 Ga0501037_0458378 3300049573 Bacteria 869
334 Ga0501038_0196753 3300049574 Bacteria 1620
335 Ga0501038_0486069 3300049574 Bacteria 946
336 Ga0501039_0183032 3300049575 Bacteria 1648
337 Ga0501040_0186779 3300049576 Bacteria 1470
338 Ga0501046_0260407 3300049580 Bacteria 1274
339 Ga0501047_0003459 3300049581 Bacteria 14920
340 Ga0501047_0093667 3300049581 Bacteria 2883
341 Ga0501047_0733676 3300049581 Bacteria 804
342 Ga0501067_0097034 3300049583 Bacteria 1637
343 Ga0501067_0149945 3300049583 Bacteria 1299
344 Ga0501067_0562670 3300049583 Bacteria 639
345 Ga0501068_0166106 3300049584 Bacteria 1392
346 Ga0501068_0192505 3300049584 Bacteria 1292
347 Ga0501069_0047049 3300049585 Bacteria 2394
348 Ga0501069_0415000 3300049585 Bacteria 797
349 Ga0501070_0068985 3300049586 Bacteria 2927
350 Ga0501070_0187831 3300049586 Bacteria 1699
351 Ga0501070_0201070 3300049586 Bacteria 1636
352 Ga0501070_1019680 3300049586 Bacteria 641
353 Ga0501071_0133890 3300049587 Bacteria 1843
354 Ga0501072_0219388 3300049588 Bacteria 1516
355 Ga0501073_0025346 3300049589 Bacteria 4254
356 Ga0501073_0045780 3300049589 Bacteria 3081
357 Ga0501073_0197428 3300049589 Bacteria 1392
358 Ga0501073_0207617 3300049589 Bacteria 1353
359 Ga0501073_0227526 3300049589 Bacteria 1288
360 Ga0501076_0351843 3300049592 Bacteria 1210
361 Ga0501079_0500164 3300049741 Bacteria 956
362 Ga0501079_0823198 3300049741 Bacteria 731
363 Ga0501080_0010288 3300049742 Bacteria 8553
364 Ga0501080_0180719 3300049742 Bacteria 1941
365 Ga0501080_0606920 3300049742 Bacteria 971
366 Ga0501080_0784648 3300049742 Bacteria 836
367 Ga0501081_0619329 3300049743 Bacteria 811
368 Ga0501081_0639190 3300049743 Bacteria 797
369 Ga0501083_0008926 3300049744 Bacteria 7076
370 Ga0501083_0016832 3300049744 Bacteria 5107
371 Ga0501083_0064872 3300049744 Bacteria 2433
372 Ga0501035_0014644 3300049822 Bacteria 7241
373 Ga0501035_0020430 3300049822 Bacteria 6081
374 Ga0501035_0024455 3300049822 Bacteria 5539
375 Ga0501035_0110756 3300049822 Bacteria 2406
376 Ga0501035_0193899 3300049822 Bacteria 1746
377 Ga0501035_0514432 3300049822 Bacteria 984
378 Ga0501035_0812340 3300049822 Bacteria 746
379 Ga0501044_0020665 3300049823 Bacteria 7029
380 Ga0501044_0037145 3300049823 Bacteria 5092
381 Ga0501044_0159757 3300049823 Bacteria 2231
382 Ga0501044_0184116 3300049823 Bacteria 2054
383 Ga0501044_0273230 3300049823 Bacteria 1625
384 Ga0501044_1012033 3300049823 Bacteria 702
385 nmdc:mga03683_2271_c1 3300050489 Bacteria 5932
386 nmdc:mga00v17_66226_c1 3300050491 Bacteria 2230
387 nmdc:mga0k408_48370_c1 3300050493 Bacteria 2460
388 nmdc:mga07m45_285885_c1 3300050496 Bacteria 959
389 nmdc:mga08y16_83975_c1 3300050511 Bacteria 3319
390 Ga0500643_000021 3300053087 Bacteria 284326
391 Ga0500643_024629 3300053087 Bacteria 1908
392 Ga0500641_0128535 3300053096 Bacteria 1093
393 Ga0500555_029370 3300053103 Bacteria 1564
394 Ga0500595_004768 3300053119 Bacteria 6007
395 Ga0500595_008735 3300053119 Bacteria 4123
396 Ga0500595_014106 3300053119 Bacteria 3041
397 Ga0500614_265678 3300053123 Bacteria 536
398 Ga0500559_0027378 3300053136 Bacteria 2433
399 Ga0500577_0068756 3300053142 Bacteria 1384
400 Ga0500588_0179419 3300053146 Bacteria 778
401 Ga0500590_062633 3300053148 Bacteria 1866
402 Ga0500604_0142876 3300053151 Bacteria 810
403 Ga0500639_217267 3300053163 Bacteria 802
404 Ga0500576_245740 3300053725 Bacteria 562
405 Ga0500645_014851 3300053730 Bacteria 2476
406 Ga0500645_067309 3300053730 Bacteria 1031
407 Ga0501084_0028894 3300054114 Bacteria 4636
408 Ga0501084_0238947 3300054114 Bacteria 1533
409 Ga0501084_0267813 3300054114 Bacteria 1442
410 Ga0501082_0008533 3300060353 Bacteria 8837
411 Ga0501082_0202024 3300060353 Bacteria 1729
412 Ga0501082_0496480 3300060353 Bacteria 1067
413 Ga0501082_1102308 3300060353 Bacteria 694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_101564950 Ga0307409_1015649502 140
2 3300042005 Ga0439448_0112666 Ga0439448_0112666_227_703 143
3 3300005438 Ga0070701_10144565 Ga0070701_101445654 146
4 3300005444 Ga0070694_100947621 Ga0070694_1009476212 146
5 3300025905 Ga0207685_10130892 Ga0207685_101308922 146
6 3300049741 Ga0501079_0500164 Ga0501079_0500164_232_675 146
7 3300009147 Ga0114129_10926055 Ga0114129_109260551 147
8 3300013296 Ga0157374_11299865 Ga0157374_112998652 147
9 3300027665 Ga0209983_1030224 Ga0209983_10302242 147
10 3300048909 Ga0496106_0775952 Ga0496106_0775952_29_478 147
11 3300031239 Ga0265328_10161616 Ga0265328_101616162 148
12 3300049571 Ga0501034_0147080 Ga0501034_0147080_1401_1877 149
13 3300006237 Ga0097621_100155111 Ga0097621_1001551112 150
14 3300013307 Ga0157372_10143139 Ga0157372_101431392 150
15 3300013307 Ga0157372_10261936 Ga0157372_102619362 150
16 3300025907 Ga0207645_10487448 Ga0207645_104874482 150
17 iso_pu_bacteria 2883291878 2883293899 152
18 iso_pu_bacteria 2883354860 2883357575 152
19 iso_pu_bacteria 2643221547 2643756068 153
20 iso_pu_bacteria 2773857925 2774873955 153
21 iso_pu_bacteria 2882456835 2882459144 153
22 3300049583 Ga0501067_0097034 Ga0501067_0097034_619_1083 154
23 3300049585 Ga0501069_0415000 Ga0501069_0415000_94_558 154
24 3300049586 Ga0501070_0068985 Ga0501070_0068985_1630_2094 154
25 3300049589 Ga0501073_0227526 Ga0501073_0227526_478_942 154
26 3300049742 Ga0501080_0180719 Ga0501080_0180719_989_1453 154
27 3300049744 Ga0501083_0064872 Ga0501083_0064872_515_979 154
28 3300054114 Ga0501084_0267813 Ga0501084_0267813_532_996 154
29 3300060353 Ga0501082_0008533 Ga0501082_0008533_6773_7237 154
30 3300009093 Ga0105240_10938198 Ga0105240_109381982 155
31 3300041452 Ga0451793_1578305 Ga0451793_1578305_109_591 155
32 3300049742 Ga0501080_0606920 Ga0501080_0606920_154_621 155
33 3300005615 Ga0070702_100341741 Ga0070702_1003417411 156
34 3300005618 Ga0068864_100389499 Ga0068864_1003894993 156
35 3300037471 Ga0395905_0078702 Ga0395905_0078702_2414_2932 156
36 3300049572 Ga0501036_0603344 Ga0501036_0603344_189_659 156
37 3300049583 Ga0501067_0149945 Ga0501067_0149945_173_646 156
38 3300049585 Ga0501069_0047049 Ga0501069_0047049_724_1206 156
39 3300049586 Ga0501070_0187831 Ga0501070_0187831_762_1316 156
40 3300049586 Ga0501070_0201070 Ga0501070_0201070_119_601 156
41 3300049589 Ga0501073_0207617 Ga0501073_0207617_443_916 156
42 3300049741 Ga0501079_0823198 Ga0501079_0823198_144_635 156
43 3300049742 Ga0501080_0784648 Ga0501080_0784648_253_726 156
44 3300049744 Ga0501083_0008926 Ga0501083_0008926_5798_6271 156
45 3300049823 Ga0501044_1012033 Ga0501044_1012033_59_532 156
46 3300053087 Ga0500643_024629 Ga0500643_024629_250_723 156
47 3300053730 Ga0500645_014851 Ga0500645_014851_1048_1527 156
48 3300054114 Ga0501084_0028894 Ga0501084_0028894_1851_2324 156
49 3300060353 Ga0501082_1102308 Ga0501082_1102308_199_669 156
50 3300003214 JGI25165J46597_1000300 JGI25165J46597_100030020 157
51 3300005327 Ga0070658_10066655 Ga0070658_100666553 157
52 3300005329 Ga0070683_100758381 Ga0070683_1007583812 157
53 3300005330 Ga0070690_100182452 Ga0070690_1001824522 157
54 3300005334 Ga0068869_100038457 Ga0068869_1000384572 157
55 3300005335 Ga0070666_10005773 Ga0070666_100057735 157
56 3300005335 Ga0070666_10056305 Ga0070666_100563054 157
57 3300005335 Ga0070666_10131994 Ga0070666_101319942 157
58 3300005336 Ga0070680_100116636 Ga0070680_1001166364 157
59 3300005338 Ga0068868_100224817 Ga0068868_1002248173 157
60 3300005339 Ga0070660_100025731 Ga0070660_1000257313 157
61 3300005340 Ga0070689_100105411 Ga0070689_1001054112 157
62 3300005340 Ga0070689_100737225 Ga0070689_1007372252 157
63 3300005344 Ga0070661_100096241 Ga0070661_1000962413 157
64 3300005344 Ga0070661_101478421 Ga0070661_1014784211 157
65 3300005354 Ga0070675_100262450 Ga0070675_1002624502 157
66 3300005355 Ga0070671_100685073 Ga0070671_1006850732 157
67 3300005364 Ga0070673_100120836 Ga0070673_1001208362 157
68 3300005365 Ga0070688_101225071 Ga0070688_1012250711 157
69 3300005366 Ga0070659_100060339 Ga0070659_1000603392 157
70 3300005366 Ga0070659_100456372 Ga0070659_1004563721 157
71 3300005367 Ga0070667_100057074 Ga0070667_1000570743 157
72 3300005438 Ga0070701_10251633 Ga0070701_102516332 157
73 3300005456 Ga0070678_100007105 Ga0070678_1000071054 157
74 3300005459 Ga0068867_100010739 Ga0068867_1000107392 157
75 3300005459 Ga0068867_100197417 Ga0068867_1001974172 157
76 3300005459 Ga0068867_100585637 Ga0068867_1005856372 157
77 3300005530 Ga0070679_100920672 Ga0070679_1009206721 157
78 3300005539 Ga0068853_100619484 Ga0068853_1006194842 157
79 3300005539 Ga0068853_100720130 Ga0068853_1007201302 157
80 3300005539 Ga0068853_100921319 Ga0068853_1009213191 157
81 3300005544 Ga0070686_100335953 Ga0070686_1003359531 157
82 3300005545 Ga0070695_100280420 Ga0070695_1002804202 157
83 3300005545 Ga0070695_100631632 Ga0070695_1006316321 157
84 3300005548 Ga0070665_100041895 Ga0070665_1000418955 157
85 3300005548 Ga0070665_100244994 Ga0070665_1002449942 157
86 3300005548 Ga0070665_100289181 Ga0070665_1002891813 157
87 3300005548 Ga0070665_100494978 Ga0070665_1004949782 157
88 3300005549 Ga0070704_101253959 Ga0070704_1012539591 157
89 3300005563 Ga0068855_100026640 Ga0068855_1000266406 157
90 3300005563 Ga0068855_100051875 Ga0068855_1000518752 157
91 3300005563 Ga0068855_100362196 Ga0068855_1003621962 157
92 3300005564 Ga0070664_100493782 Ga0070664_1004937822 157
93 3300005577 Ga0068857_100400912 Ga0068857_1004009121 157
94 3300005577 Ga0068857_100573135 Ga0068857_1005731352 157
95 3300005617 Ga0068859_100275816 Ga0068859_1002758163 157
96 3300005618 Ga0068864_100146445 Ga0068864_1001464453 157
97 3300005718 Ga0068866_10129600 Ga0068866_101296002 157
98 3300005840 Ga0068870_10408129 Ga0068870_104081291 157
99 3300005841 Ga0068863_100325966 Ga0068863_1003259662 157
100 3300005842 Ga0068858_100027825 Ga0068858_1000278253 157
101 3300005842 Ga0068858_100228885 Ga0068858_1002288852 157
102 3300005842 Ga0068858_100315925 Ga0068858_1003159252 157
103 3300005842 Ga0068858_100348900 Ga0068858_1003489002 157
104 3300005842 Ga0068858_101028135 Ga0068858_1010281352 157
105 3300005843 Ga0068860_101261279 Ga0068860_1012612792 157
106 3300005844 Ga0068862_100116858 Ga0068862_1001168582 157
107 3300006048 Ga0075363_100002152 Ga0075363_10000215210 157
108 3300006051 Ga0075364_10014764 Ga0075364_100147646 157
109 3300006195 Ga0075366_10029796 Ga0075366_100297964 157
110 3300006237 Ga0097621_100001637 Ga0097621_10000163716 157
111 3300006237 Ga0097621_100035828 Ga0097621_1000358285 157
112 3300006237 Ga0097621_100057984 Ga0097621_1000579842 157
113 3300006237 Ga0097621_100135124 Ga0097621_1001351241 157
114 3300006237 Ga0097621_100140249 Ga0097621_1001402492 157
115 3300006353 Ga0075370_10181198 Ga0075370_101811982 157
116 3300006358 Ga0068871_100006532 Ga0068871_1000065326 157
117 3300006358 Ga0068871_100034479 Ga0068871_1000344793 157
118 3300006358 Ga0068871_100067692 Ga0068871_1000676923 157
119 3300006358 Ga0068871_100092688 Ga0068871_1000926882 157
120 3300006358 Ga0068871_100098128 Ga0068871_1000981283 157
121 3300006881 Ga0068865_100130590 Ga0068865_1001305903 157
122 3300006931 Ga0097620_100275801 Ga0097620_1002758013 157
123 3300009093 Ga0105240_10007938 Ga0105240_100079386 157
124 3300009093 Ga0105240_10081849 Ga0105240_100818496 157
125 3300009093 Ga0105240_10159139 Ga0105240_101591392 157
126 3300009093 Ga0105240_10982333 Ga0105240_109823332 157
127 3300009098 Ga0105245_10041140 Ga0105245_100411403 157
128 3300009098 Ga0105245_10352448 Ga0105245_103524483 157
129 3300009101 Ga0105247_10908153 Ga0105247_109081532 157
130 3300009148 Ga0105243_10006489 Ga0105243_100064893 157
131 3300009148 Ga0105243_10260134 Ga0105243_102601342 157
132 3300009148 Ga0105243_11483612 Ga0105243_114836122 157
133 3300009174 Ga0105241_10009944 Ga0105241_100099443 157
134 3300009174 Ga0105241_10025069 Ga0105241_100250693 157
135 3300009174 Ga0105241_10040842 Ga0105241_100408422 157
136 3300009174 Ga0105241_10577949 Ga0105241_105779492 157
137 3300009174 Ga0105241_10894570 Ga0105241_108945702 157
138 3300009176 Ga0105242_10023655 Ga0105242_100236555 157
139 3300009176 Ga0105242_10106345 Ga0105242_101063452 157
140 3300009176 Ga0105242_10146378 Ga0105242_101463782 157
141 3300009176 Ga0105242_10323372 Ga0105242_103233722 157
142 3300009176 Ga0105242_11047216 Ga0105242_110472162 157
143 3300009177 Ga0105248_10130194 Ga0105248_101301942 157
144 3300009177 Ga0105248_10860549 Ga0105248_108605492 157
145 3300009177 Ga0105248_11140209 Ga0105248_111402092 157
146 3300009177 Ga0105248_11414121 Ga0105248_114141212 157
147 3300009545 Ga0105237_10077546 Ga0105237_100775462 157
148 3300009545 Ga0105237_10227055 Ga0105237_102270551 157
149 3300009545 Ga0105237_10279611 Ga0105237_102796113 157
150 3300009545 Ga0105237_11455818 Ga0105237_114558181 157
151 3300009551 Ga0105238_10124440 Ga0105238_101244402 157
152 3300009551 Ga0105238_10486806 Ga0105238_104868062 157
153 3300009551 Ga0105238_10633823 Ga0105238_106338232 157
154 3300009551 Ga0105238_10674835 Ga0105238_106748352 157
155 3300009551 Ga0105238_11563067 Ga0105238_115630672 157
156 3300009553 Ga0105249_10418944 Ga0105249_104189442 157
157 3300010375 Ga0105239_10031804 Ga0105239_100318043 157
158 3300010375 Ga0105239_10095539 Ga0105239_100955393 157
159 3300010375 Ga0105239_10321194 Ga0105239_103211943 157
160 3300010375 Ga0105239_10343489 Ga0105239_103434892 157
161 3300010375 Ga0105239_10365323 Ga0105239_103653232 157
162 3300010375 Ga0105239_10770004 Ga0105239_107700042 157
163 3300010375 Ga0105239_10899675 Ga0105239_108996752 157
164 3300010375 Ga0105239_10923717 Ga0105239_109237172 157
165 3300010375 Ga0105239_11444931 Ga0105239_114449311 157
166 3300011119 Ga0105246_10004442 Ga0105246_100044427 157
167 3300011119 Ga0105246_10487075 Ga0105246_104870752 157
168 3300011119 Ga0105246_10824410 Ga0105246_108244102 157
169 3300013100 Ga0157373_10812471 Ga0157373_108124711 157
170 3300013104 Ga0157370_10750652 Ga0157370_107506521 157
171 3300013105 Ga0157369_10027642 Ga0157369_100276425 157
172 3300013296 Ga0157374_10452812 Ga0157374_104528121 157
173 3300013296 Ga0157374_12274806 Ga0157374_122748061 157
174 3300013297 Ga0157378_10060405 Ga0157378_100604054 157
175 3300013297 Ga0157378_10160287 Ga0157378_101602873 157
176 3300013306 Ga0163162_10039794 Ga0163162_100397942 157
177 3300013306 Ga0163162_10130331 Ga0163162_101303314 157
178 3300013306 Ga0163162_11107797 Ga0163162_111077972 157
179 3300013307 Ga0157372_10629999 Ga0157372_106299992 157
180 3300013308 Ga0157375_11282880 Ga0157375_112828802 157
181 3300014325 Ga0163163_10339810 Ga0163163_103398102 157
182 3300014325 Ga0163163_10627240 Ga0163163_106272402 157
183 3300014968 Ga0157379_10178076 Ga0157379_101780763 157
184 3300014969 Ga0157376_10441607 Ga0157376_104416072 157
185 3300014969 Ga0157376_10605957 Ga0157376_106059572 157
186 3300014969 Ga0157376_10652137 Ga0157376_106521372 157
187 3300017792 Ga0163161_10693210 Ga0163161_106932102 157
188 3300025261 Ga0209233_1000013 Ga0209233_1000013687 157
189 3300025261 Ga0209233_1030358 Ga0209233_10303582 157
190 3300025297 Ga0209758_1045348 Ga0209758_10453483 157
191 3300025893 Ga0207682_10173065 Ga0207682_101730652 157
192 3300025893 Ga0207682_10278932 Ga0207682_102789322 157
193 3300025903 Ga0207680_10044985 Ga0207680_100449852 157
194 3300025903 Ga0207680_10058587 Ga0207680_100585872 157
195 3300025908 Ga0207643_10123180 Ga0207643_101231803 157
196 3300025909 Ga0207705_10389975 Ga0207705_103899751 157
197 3300025909 Ga0207705_10833887 Ga0207705_108338872 157
198 3300025911 Ga0207654_10005899 Ga0207654_100058996 157
199 3300025911 Ga0207654_10038135 Ga0207654_100381354 157
200 3300025911 Ga0207654_10078732 Ga0207654_100787322 157
201 3300025911 Ga0207654_10288816 Ga0207654_102888162 157
202 3300025912 Ga0207707_10289973 Ga0207707_102899732 157
203 3300025913 Ga0207695_10006605 Ga0207695_1000660517 157
204 3300025913 Ga0207695_10014294 Ga0207695_1001429411 157
205 3300025913 Ga0207695_10106835 Ga0207695_101068354 157
206 3300025913 Ga0207695_10653026 Ga0207695_106530262 157
207 3300025914 Ga0207671_10281349 Ga0207671_102813492 157
208 3300025914 Ga0207671_10326854 Ga0207671_103268541 157
209 3300025914 Ga0207671_10470960 Ga0207671_104709602 157
210 3300025916 Ga0207663_10187070 Ga0207663_101870702 157
211 3300025919 Ga0207657_10019479 Ga0207657_100194793 157
212 3300025920 Ga0207649_10570813 Ga0207649_105708131 157
213 3300025920 Ga0207649_10900709 Ga0207649_109007092 157
214 3300025921 Ga0207652_10302211 Ga0207652_103022111 157
215 3300025923 Ga0207681_10595201 Ga0207681_105952011 157
216 3300025923 Ga0207681_10859783 Ga0207681_108597832 157
217 3300025924 Ga0207694_10012988 Ga0207694_100129885 157
218 3300025924 Ga0207694_10074361 Ga0207694_100743612 157
219 3300025924 Ga0207694_10247225 Ga0207694_102472252 157
220 3300025924 Ga0207694_10291320 Ga0207694_102913204 157
221 3300025924 Ga0207694_10512084 Ga0207694_105120842 157
222 3300025926 Ga0207659_10234049 Ga0207659_102340492 157
223 3300025927 Ga0207687_10030022 Ga0207687_100300225 157
224 3300025927 Ga0207687_10067258 Ga0207687_100672583 157
225 3300025927 Ga0207687_10144342 Ga0207687_101443422 157
226 3300025927 Ga0207687_10253843 Ga0207687_102538432 157
227 3300025931 Ga0207644_10316875 Ga0207644_103168752 157
228 3300025934 Ga0207686_10145198 Ga0207686_101451982 157
229 3300025934 Ga0207686_10213623 Ga0207686_102136231 157
230 3300025934 Ga0207686_10508887 Ga0207686_105088871 157
231 3300025936 Ga0207670_10463327 Ga0207670_104633272 157
232 3300025938 Ga0207704_10498838 Ga0207704_104988382 157
233 3300025940 Ga0207691_10153167 Ga0207691_101531672 157
234 3300025940 Ga0207691_10470356 Ga0207691_104703561 157
235 3300025940 Ga0207691_10480446 Ga0207691_104804462 157
236 3300025941 Ga0207711_10098822 Ga0207711_100988222 157
237 3300025941 Ga0207711_10110315 Ga0207711_101103152 157
238 3300025941 Ga0207711_10245111 Ga0207711_102451112 157
239 3300025942 Ga0207689_10061464 Ga0207689_100614645 157
240 3300025944 Ga0207661_10162896 Ga0207661_101628962 157
241 3300025949 Ga0207667_10007941 Ga0207667_100079418 157
242 3300025960 Ga0207651_10384739 Ga0207651_103847392 157
243 3300025961 Ga0207712_10028394 Ga0207712_100283946 157
244 3300025986 Ga0207658_10190689 Ga0207658_101906892 157
245 3300026023 Ga0207677_10021131 Ga0207677_100211313 157
246 3300026035 Ga0207703_10031629 Ga0207703_100316293 157
247 3300026035 Ga0207703_10218331 Ga0207703_102183312 157
248 3300026035 Ga0207703_10245107 Ga0207703_102451072 157
249 3300026035 Ga0207703_10296324 Ga0207703_102963242 157
250 3300026035 Ga0207703_10304975 Ga0207703_103049752 157
251 3300026035 Ga0207703_10380887 Ga0207703_103808871 157
252 3300026041 Ga0207639_11004694 Ga0207639_110046942 157
253 3300026075 Ga0207708_10845579 Ga0207708_108455792 157
254 3300026078 Ga0207702_10171271 Ga0207702_101712714 157
255 3300026089 Ga0207648_10015012 Ga0207648_100150127 157
256 3300026095 Ga0207676_10253811 Ga0207676_102538112 157
257 3300026116 Ga0207674_10114849 Ga0207674_101148493 157
258 3300026116 Ga0207674_10397557 Ga0207674_103975572 157
259 3300026116 Ga0207674_11066623 Ga0207674_110666232 157
260 3300026118 Ga0207675_100142954 Ga0207675_1001429543 157
261 3300026118 Ga0207675_101478441 Ga0207675_1014784412 157
262 3300026121 Ga0207683_10014768 Ga0207683_100147685 157
263 3300026121 Ga0207683_10115533 Ga0207683_101155333 157
264 3300028379 Ga0268266_10020164 Ga0268266_100201642 157
265 3300028379 Ga0268266_10096333 Ga0268266_100963332 157
266 3300028379 Ga0268266_10276916 Ga0268266_102769162 157
267 3300028379 Ga0268266_10573695 Ga0268266_105736952 157
268 3300028381 Ga0268264_10330724 Ga0268264_103307242 157
269 3300028573 Ga0265334_10239894 Ga0265334_102398942 157
270 3300028577 Ga0265318_10002134 Ga0265318_100021345 157
271 3300028577 Ga0265318_10197233 Ga0265318_101972331 157
272 3300028786 Ga0307517_10513479 Ga0307517_105134791 157
273 3300028800 Ga0265338_10264403 Ga0265338_102644032 157
274 3300031238 Ga0265332_10162024 Ga0265332_101620241 157
275 3300031239 Ga0265328_10342138 Ga0265328_103421381 157
276 3300031241 Ga0265325_10001479 Ga0265325_1000147915 157
277 3300031241 Ga0265325_10015026 Ga0265325_100150263 157
278 3300031241 Ga0265325_10048302 Ga0265325_100483022 157
279 3300031241 Ga0265325_10061392 Ga0265325_100613922 157
280 3300031247 Ga0265340_10002681 Ga0265340_100026819 157
281 3300031249 Ga0265339_10019941 Ga0265339_100199414 157
282 3300031249 Ga0265339_10052269 Ga0265339_100522692 157
283 3300031249 Ga0265339_10071852 Ga0265339_100718523 157
284 3300031249 Ga0265339_10105541 Ga0265339_101055411 157
285 3300031250 Ga0265331_10029123 Ga0265331_100291232 157
286 3300031250 Ga0265331_10029318 Ga0265331_100293183 157
287 3300031250 Ga0265331_10030595 Ga0265331_100305952 157
288 3300031344 Ga0265316_10322680 Ga0265316_103226802 157
289 3300031456 Ga0307513_10305859 Ga0307513_103058592 157
290 3300031595 Ga0265313_10004469 Ga0265313_100044695 157
291 3300031595 Ga0265313_10007428 Ga0265313_100074287 157
292 3300031595 Ga0265313_10008082 Ga0265313_100080824 157
293 3300031595 Ga0265313_10060523 Ga0265313_100605232 157
294 3300031595 Ga0265313_10116715 Ga0265313_101167151 157
295 3300031595 Ga0265313_10247172 Ga0265313_102471721 157
296 3300031711 Ga0265314_10005395 Ga0265314_1000539517 157
297 3300031711 Ga0265314_10006199 Ga0265314_100061999 157
298 3300031711 Ga0265314_10018336 Ga0265314_100183363 157
299 3300031711 Ga0265314_10495789 Ga0265314_104957891 157
300 3300031712 Ga0265342_10022056 Ga0265342_100220567 157
301 3300031712 Ga0265342_10226635 Ga0265342_102266351 157
302 3300031712 Ga0265342_10283361 Ga0265342_102833612 157
303 3300031712 Ga0265342_10466828 Ga0265342_104668282 157
304 3300031730 Ga0307516_10045075 Ga0307516_100450753 157
305 3300031730 Ga0307516_10050100 Ga0307516_100501003 157
306 3300035120 Ga0373957_0051465 Ga0373957_0051465_341_814 157
307 3300035172 Ga0373955_0105674 Ga0373955_0105674_708_1181 157
308 3300035724 Ga0373933_0082738 Ga0373933_0082738_926_1399 157
309 3300035725 Ga0373947_0198678 Ga0373947_0198678_365_841 157
310 3300036401 Ga0373937_0071298 Ga0373937_0071298_687_1160 157
311 3300036401 Ga0373937_1140455 Ga0373937_1140455_128_601 157
312 3300036401 Ga0373937_1332222 Ga0373937_1332222_166_639 157
313 3300037068 Ga0373925_0848459 Ga0373925_0848459_247_723 157
314 3300037312 Ga0395899_0051742 Ga0395899_0051742_230_703 157
315 3300037418 Ga0395900_0321978 Ga0395900_0321978_770_1243 157
316 3300037466 Ga0395898_0007832 Ga0395898_0007832_4526_4999 157
317 3300037466 Ga0395898_1825529 Ga0395898_1825529_30_506 157
318 3300038443 Ga0395901_0114517 Ga0395901_0114517_2331_2804 157
319 3300039437 Ga0436365_0756891 Ga0436365_0756891_16_489 157
320 3300039437 Ga0436365_1015159 Ga0436365_1015159_30_503 157
321 3300039437 Ga0436365_1924943 Ga0436365_1924943_519_992 157
322 3300044684 Ga0466966_0140365 Ga0466966_0140365_900_1376 157
323 3300045836 Ga0466958_0494526 Ga0466958_0494526_273_749 157
324 3300046459 Ga0495629_0594210 Ga0495629_0594210_142_615 157
325 3300046460 Ga0495638_0364472 Ga0495638_0364472_220_693 157
326 3300046462 Ga0495651_0519509 Ga0495651_0519509_18_491 157
327 3300046462 Ga0495651_0545075 Ga0495651_0545075_37_510 157
328 3300046472 Ga0495580_0068377 Ga0495580_0068377_226_702 157
329 3300046473 Ga0495582_0024726 Ga0495582_0024726_1159_1635 157
330 3300046473 Ga0495582_0454115 Ga0495582_0454115_76_552 157
331 3300046492 Ga0495585_0273887 Ga0495585_0273887_152_628 157
332 3300046507 Ga0495606_0156531 Ga0495606_0156531_418_894 157
333 3300046513 Ga0495616_0142794 Ga0495616_0142794_13_486 157
334 3300046516 Ga0495628_1206345 Ga0495628_1206345_29_502 157
335 3300046524 Ga0495648_0426882 Ga0495648_0426882_71_544 157
336 3300046530 Ga0495654_0104160 Ga0495654_0104160_463_936 157
337 3300046536 Ga0495587_0013611 Ga0495587_0013611_2337_2810 157
338 3300046539 Ga0495621_0240194 Ga0495621_0240194_193_666 157
339 3300046557 Ga0495622_0001758 Ga0495622_0001758_6476_6949 157
340 3300046648 Ga0495611_0031308 Ga0495611_0031308_1461_1934 157
341 3300046678 Ga0495599_0566354 Ga0495599_0566354_152_625 157
342 3300046683 Ga0495658_0006001 Ga0495658_0006001_1065_1541 157
343 3300046689 Ga0495613_0182250 Ga0495613_0182250_498_974 157
344 3300046810 Ga0495660_0337768 Ga0495660_0337768_80_553 157
345 3300047317 Ga0495604_0787252 Ga0495604_0787252_22_495 157
346 3300047319 Ga0495674_0401315 Ga0495674_0401315_382_855 157
347 3300047320 Ga0495672_0192154 Ga0495672_0192154_323_796 157
348 3300047447 Ga0495685_029220 Ga0495685_029220_1030_1503 157
349 3300047472 Ga0495686_0450377 Ga0495686_0450377_117_590 157
350 3300048088 Ga0495602_0076203 Ga0495602_0076203_1565_2038 157
351 3300048908 Ga0496105_0184703 Ga0496105_0184703_500_988 157
352 3300048913 Ga0496110_0709711 Ga0496110_0709711_425_898 157
353 3300048917 Ga0496114_0452090 Ga0496114_0452090_74_547 157
354 3300048924 Ga0496121_0001676 Ga0496121_0001676_30052_30525 157
355 3300049569 Ga0501032_0122069 Ga0501032_0122069_640_1113 157
356 3300049570 Ga0501033_0112225 Ga0501033_0112225_1055_1528 157
357 3300049570 Ga0501033_0139056 Ga0501033_0139056_403_876 157
358 3300049570 Ga0501033_0264269 Ga0501033_0264269_443_916 157
359 3300049572 Ga0501036_0288891 Ga0501036_0288891_26_499 157
360 3300049572 Ga0501036_0638220 Ga0501036_0638220_82_558 157
361 3300049573 Ga0501037_0458378 Ga0501037_0458378_285_758 157
362 3300049574 Ga0501038_0196753 Ga0501038_0196753_889_1362 157
363 3300049574 Ga0501038_0486069 Ga0501038_0486069_23_496 157
364 3300049575 Ga0501039_0183032 Ga0501039_0183032_859_1332 157
365 3300049576 Ga0501040_0186779 Ga0501040_0186779_731_1204 157
366 3300049580 Ga0501046_0260407 Ga0501046_0260407_763_1236 157
367 3300049581 Ga0501047_0003459 Ga0501047_0003459_3654_4130 157
368 3300049581 Ga0501047_0093667 Ga0501047_0093667_1207_1680 157
369 3300049581 Ga0501047_0733676 Ga0501047_0733676_270_743 157
370 3300049583 Ga0501067_0562670 Ga0501067_0562670_52_525 157
371 3300049584 Ga0501068_0166106 Ga0501068_0166106_635_1108 157
372 3300049584 Ga0501068_0192505 Ga0501068_0192505_726_1199 157
373 3300049586 Ga0501070_1019680 Ga0501070_1019680_114_587 157
374 3300049587 Ga0501071_0133890 Ga0501071_0133890_599_1072 157
375 3300049588 Ga0501072_0219388 Ga0501072_0219388_381_854 157
376 3300049589 Ga0501073_0025346 Ga0501073_0025346_1543_2016 157
377 3300049589 Ga0501073_0045780 Ga0501073_0045780_1922_2398 157
378 3300049589 Ga0501073_0197428 Ga0501073_0197428_241_714 157
379 3300049592 Ga0501076_0351843 Ga0501076_0351843_26_499 157
380 3300049742 Ga0501080_0010288 Ga0501080_0010288_3957_4433 157
381 3300049743 Ga0501081_0619329 Ga0501081_0619329_146_619 157
382 3300049743 Ga0501081_0639190 Ga0501081_0639190_113_586 157
383 3300049744 Ga0501083_0016832 Ga0501083_0016832_3835_4308 157
384 3300049822 Ga0501035_0014644 Ga0501035_0014644_5950_6426 157
385 3300049822 Ga0501035_0020430 Ga0501035_0020430_517_990 157
386 3300049822 Ga0501035_0024455 Ga0501035_0024455_2796_3296 157
387 3300049822 Ga0501035_0110756 Ga0501035_0110756_926_1399 157
388 3300049822 Ga0501035_0193899 Ga0501035_0193899_396_869 157
389 3300049822 Ga0501035_0514432 Ga0501035_0514432_193_666 157
390 3300049822 Ga0501035_0812340 Ga0501035_0812340_177_650 157
391 3300049823 Ga0501044_0020665 Ga0501044_0020665_477_950 157
392 3300049823 Ga0501044_0037145 Ga0501044_0037145_2200_2676 157
393 3300049823 Ga0501044_0159757 Ga0501044_0159757_40_516 157
394 3300049823 Ga0501044_0184116 Ga0501044_0184116_1009_1482 157
395 3300049823 Ga0501044_0273230 Ga0501044_0273230_1032_1505 157
396 3300050489 nmdc:mga03683_2271_c1 nmdc:mga03683_2271_c1_272_748 157
397 3300050491 nmdc:mga00v17_66226_c1 nmdc:mga00v17_66226_c1_356_832 157
398 3300050493 nmdc:mga0k408_48370_c1 nmdc:mga0k408_48370_c1_1887_2363 157
399 3300050496 nmdc:mga07m45_285885_c1 nmdc:mga07m45_285885_c1_186_662 157
400 3300050511 nmdc:mga08y16_83975_c1 nmdc:mga08y16_83975_c1_1223_1696 157
401 3300053087 Ga0500643_000021 Ga0500643_000021_15497_15970 157
402 3300053096 Ga0500641_0128535 Ga0500641_0128535_142_615 157
403 3300053103 Ga0500555_029370 Ga0500555_029370_301_774 157
404 3300053119 Ga0500595_004768 Ga0500595_004768_4677_5153 157
405 3300053119 Ga0500595_008735 Ga0500595_008735_1238_1711 157
406 3300053119 Ga0500595_014106 Ga0500595_014106_2146_2619 157
407 3300053123 Ga0500614_265678 Ga0500614_265678_46_519 157
408 3300053136 Ga0500559_0027378 Ga0500559_0027378_518_991 157
409 3300053142 Ga0500577_0068756 Ga0500577_0068756_171_644 157
410 3300053146 Ga0500588_0179419 Ga0500588_0179419_70_543 157
411 3300053148 Ga0500590_062633 Ga0500590_062633_960_1433 157
412 3300053151 Ga0500604_0142876 Ga0500604_0142876_168_641 157
413 3300053163 Ga0500639_217267 Ga0500639_217267_214_687 157
414 3300053725 Ga0500576_245740 Ga0500576_245740_54_527 157
415 3300053730 Ga0500645_067309 Ga0500645_067309_46_519 157
416 3300054114 Ga0501084_0238947 Ga0501084_0238947_451_924 157
417 3300060353 Ga0501082_0202024 Ga0501082_0202024_1017_1490 157
418 3300060353 Ga0501082_0496480 Ga0501082_0496480_37_510 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

28

171

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.9503 9 132
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9368 9 133
6q95-assembly1.cif.gz_5 structure of tmrna smpb bound in a site of t. thermophilus 70s ribosome 0.9363 13 134
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.936 9 133
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9359 9 126
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9344 8 133 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9146 14 130 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9067 8 133 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8711 14 130 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.701 11 130 2.40.280.10
ID Description Score Start End GO Terms
AF-A0A3D0WDM0-F1-model_v4 SsrA-binding protein (Small protein B) 0.9868 9 130 GO:0003723
GO:0005829
GO:0070929
AF-A0A519KLB3-F1-model_v4 SsrA-binding protein SmpB 0.9829 9 128 GO:0003723
GO:0005829
AF-A0A1F9ZNS0-F1-model_v4 deleted 0.9818 9 116
AF-A0A3C2C3N6-F1-model_v4 SsrA-binding protein 0.9792 9 123 GO:0003723
GO:0005829
AF-A0A0Q7RIC3-F1-model_v4 SsrA-binding protein 0.9767 10 112 GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
85.29 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map