metagRoot

F439256

General Info

Members	Datasets	Scaffolds	Average Seq Length
418	222	401	229

Family's Representative Sequence

Representative Sequence	3300005616\|Ga0068852_100280147\|Ga0068852_1002801472
Length	246
Sequence	MTGAAASPPISLREDFREILRLVRPGARVLDVGCGEGELLELLTREKRIDGQGLEISQAGVAACLAKGLAVVQGDGDRDLDHFPTQSFDYAVLSKTLQQMREPAHVLSELLRIADQAVVSLPNFGHWRMRWALLTTGRMPETRALPDPWWSTPNIHLCTLRDFTELCRELDLRIDACAALSGGKAARPIDPEQPLENWRSETALFLLSRRDAGPRAAAPVDLFGQAAAEPPQAAMSKRRTRTKAKA

Samples

	Sample ID	Description	Type	Environment
1	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
2	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
3	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
4	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
5	2643221598	Phenylobacterium sp. Root700	Isolate	Unclassified
6	2643221614	Phenylobacterium sp. Root77	Isolate	Unclassified
7	2643221661	Phenylobacterium sp. Root1277	Isolate	Unclassified
8	2643221666	Phenylobacterium sp. Root1290	Isolate	Unclassified
9	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
10	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
11	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
12	2849560528	Caulobacter zeae 410	Isolate	Unclassified
13	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
14	2851153111	Caulobacter radicis 736	Isolate	Unclassified
15	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
16	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
17	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
18	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
19	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
20	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
21	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
22	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
23	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
24	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
25	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
26	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
27	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
28	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
29	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
30	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
31	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
32	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
33	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
34	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
35	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
36	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
37	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
38	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
43	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
44	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
45	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
46	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
47	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
48	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
49	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
50	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
51	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
54	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
55	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
56	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
57	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
58	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
59	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
60	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
61	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
62	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
64	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
65	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
66	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
67	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
68	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
69	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
70	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
71	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
72	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
73	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
74	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
75	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
76	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
77	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
78	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
79	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
80	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
81	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
82	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
83	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
84	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
85	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
86	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
117	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
118	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
119	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
120	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
121	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
122	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
123	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
124	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
125	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
126	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
127	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
128	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
129	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
130	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
131	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
132	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
133	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
134	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
135	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
136	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
137	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
138	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
139	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
140	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
141	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
142	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
143	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
144	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
145	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
146	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
147	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
148	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
149	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
150	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
151	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
152	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
153	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
154	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
155	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
156	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
157	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
158	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
159	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
160	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
161	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
162	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
163	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
164	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
165	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
166	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
167	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
168	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
169	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
170	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
171	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
172	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
173	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
174	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
175	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
176	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
177	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
178	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
179	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
180	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
181	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
182	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
183	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
184	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
185	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
186	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
188	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
189	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
190	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
191	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
192	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
193	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
194	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
195	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
196	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
197	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
198	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
199	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
200	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
201	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
202	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
203	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
204	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
205	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
206	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
207	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
208	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
209	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
210	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
211	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
212	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
213	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
214	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
215	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
216	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
217	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
218	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
219	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
220	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
221	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
222	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.93
Metatranscriptomes	0
Isolates	4.07

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	18.18
Nodule	0
Rhizoplane	3.35
Rhizosphere	70.57
Stem	0
Stem Tuber	0
Unclassified	7.89

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10024156	3300003215	Bacteria	2196
2	JGI25153J46596_10031996	3300003215	Bacteria	1761
3	Ga0055537_1002154	3300003773	Bacteria	6877
4	Ga0055524_1004327	3300003775	Bacteria	6582
5	Ga0055536_1000576	3300003781	Bacteria	25026
6	Ga0055536_1000606	3300003781	Bacteria	24402
7	Ga0055528_1029017	3300003790	Bacteria	1510
8	Ga0055530_10001308	3300003791	Bacteria	18734
9	Ga0055530_10016353	3300003791	Bacteria	2375
10	Ga0055531_10000294	3300003794	Bacteria	49839
11	Ga0065165_1001939	3300005262	Bacteria	19705
12	Ga0070658_10029604	3300005327	Bacteria	4399
13	Ga0070658_10068855	3300005327	Bacteria	2894
14	Ga0070658_10130515	3300005327	Bacteria	2094
15	Ga0070670_100000013	3300005331	Bacteria	250768
16	Ga0070670_100052230	3300005331	Bacteria	3510
17	Ga0070670_100266985	3300005331	Bacteria	1492
18	Ga0070670_100791635	3300005331	Bacteria	856
19	Ga0070666_10056235	3300005335	Bacteria	2657
20	Ga0070680_100003427	3300005336	Bacteria	11841
21	Ga0070680_100042468	3300005336	Bacteria	3690
22	Ga0070680_100442742	3300005336	Bacteria	1109
23	Ga0068868_100737221	3300005338	Bacteria	884
24	Ga0070660_100023294	3300005339	Bacteria	4587
25	Ga0070660_100090360	3300005339	Bacteria	2414
26	Ga0070691_10004606	3300005341	Bacteria	6265
27	Ga0070661_100212010	3300005344	Bacteria	1483
28	Ga0070668_100000042	3300005347	Bacteria	78694
29	Ga0070668_100000445	3300005347	Bacteria	27359
30	Ga0070668_100001526	3300005347	Bacteria	16698
31	Ga0070668_100001741	3300005347	Bacteria	15835
32	Ga0070668_100020137	3300005347	Bacteria	5030
33	Ga0070668_100034371	3300005347	Bacteria	3862
34	Ga0070669_100018780	3300005353	Bacteria	4942
35	Ga0070669_100048139	3300005353	Bacteria	3111
36	Ga0070671_100003043	3300005355	Bacteria	13045
37	Ga0070671_100348572	3300005355	Bacteria	1264
38	Ga0070659_100001728	3300005366	Bacteria	15682
39	Ga0070659_100003148	3300005366	Bacteria	11755
40	Ga0070659_100006630	3300005366	Bacteria	8365
41	Ga0070667_100000168	3300005367	Bacteria	81935
42	Ga0070667_100060263	3300005367	Bacteria	3211
43	Ga0070667_100191814	3300005367	Bacteria	1810
44	Ga0070667_100260000	3300005367	Bacteria	1554
45	Ga0070663_100115969	3300005455	Bacteria	2018
46	Ga0070681_10005916	3300005458	Bacteria	11836
47	Ga0070681_10094612	3300005458	Bacteria	2936
48	Ga0070679_100007487	3300005530	Bacteria	10209
49	Ga0070679_100015567	3300005530	Bacteria	7308
50	Ga0070679_100380197	3300005530	Bacteria	1359
51	Ga0068853_100034565	3300005539	Bacteria	4291
52	Ga0068853_100094154	3300005539	Bacteria	2639
53	Ga0068853_100204706	3300005539	Bacteria	1797
54	Ga0070665_100000058	3300005548	Bacteria	225040
55	Ga0070665_100000363	3300005548	Bacteria	67699
56	Ga0070665_100000638	3300005548	Bacteria	47589
57	Ga0070665_100042907	3300005548	Bacteria	4547
58	Ga0070665_100144147	3300005548	Bacteria	2385
59	Ga0068855_100015559	3300005563	Bacteria	9158
60	Ga0068855_100029515	3300005563	Bacteria	6554
61	Ga0070664_100114142	3300005564	Bacteria	2360
62	Ga0068857_100522397	3300005577	Bacteria	1116
63	Ga0068854_100215713	3300005578	Bacteria	1516
64	Ga0068856_100262497	3300005614	Bacteria	1742
65	Ga0068856_101011068	3300005614	Bacteria	850
66	Ga0068852_100280147	3300005616	Bacteria	1607
67	Ga0068859_100001153	3300005617	Bacteria	26984
68	Ga0068859_100014592	3300005617	Bacteria	7891
69	Ga0068859_100171493	3300005617	Bacteria	2251
70	Ga0068864_100000067	3300005618	Bacteria	115834
71	Ga0068864_100000135	3300005618	Bacteria	71759
72	Ga0068864_100060726	3300005618	Bacteria	3273
73	Ga0068864_100066853	3300005618	Bacteria	3121
74	Ga0068864_100303018	3300005618	Bacteria	1496
75	Ga0068861_100076127	3300005719	Bacteria	2614
76	Ga0068861_100209311	3300005719	Bacteria	1642
77	Ga0068863_100000735	3300005841	Bacteria	32827
78	Ga0068863_100838664	3300005841	Bacteria	918
79	Ga0068858_100000020	3300005842	Bacteria	175896
80	Ga0068858_100001260	3300005842	Bacteria	26205
81	Ga0068858_100003007	3300005842	Bacteria	16907
82	Ga0068858_100046403	3300005842	Bacteria	4027
83	Ga0068860_100000133	3300005843	Bacteria	120382
84	Ga0068860_100000382	3300005843	Bacteria	58081
85	Ga0068860_100067464	3300005843	Bacteria	3399
86	Ga0068860_100211903	3300005843	Bacteria	1879
87	Ga0068862_100000167	3300005844	Bacteria	72865
88	Ga0068862_100000463	3300005844	Bacteria	43942
89	Ga0068862_100114267	3300005844	Bacteria	2373
90	Ga0068862_100252862	3300005844	Bacteria	1607
91	Ga0068862_100593477	3300005844	Bacteria	1062
92	Ga0075368_10004105	3300006042	Bacteria	4901
93	Ga0075363_100072499	3300006048	Bacteria	1873
94	Ga0075364_10010559	3300006051	Bacteria	5583
95	Ga0075367_10102445	3300006178	Bacteria	1751
96	Ga0075369_10194897	3300006186	Bacteria	934
97	Ga0097620_100001153	3300006931	Bacteria	26984
98	Ga0097620_100014592	3300006931	Bacteria	7891
99	Ga0097620_100171496	3300006931	Bacteria	2251
100	Ga0105240_10023517	3300009093	Bacteria	8145
101	Ga0105240_10033200	3300009093	Bacteria	6671
102	Ga0105240_10099619	3300009093	Bacteria	3537
103	Ga0105240_10151338	3300009093	Bacteria	2763
104	Ga0105240_10308066	3300009093	Bacteria	1809
105	Ga0105242_10855499	3300009176	Bacteria	905
106	Ga0105248_10003656	3300009177	Bacteria	17065
107	Ga0105248_10059679	3300009177	Bacteria	4285
108	Ga0105248_10086324	3300009177	Bacteria	3531
109	Ga0105248_10217226	3300009177	Bacteria	2153
110	Ga0105248_11022878	3300009177	Bacteria	933
111	Ga0105249_10000610	3300009553	Bacteria	32602
112	Ga0105249_10256678	3300009553	Bacteria	1735
113	Ga0105249_10321817	3300009553	Bacteria	1558
114	Ga0105249_11183326	3300009553	Bacteria	835
115	Ga0105239_10269501	3300010375	Bacteria	1915
116	Ga0105239_10450440	3300010375	Bacteria	1460
117	Ga0157370_10169041	3300013104	Bacteria	2033
118	Ga0163162_10033632	3300013306	Bacteria	5096
119	Ga0163162_10045463	3300013306	Bacteria	4398
120	Ga0157375_10073232	3300013308	Bacteria	3444
121	Ga0163163_10005735	3300014325	Bacteria	10771
122	Ga0157379_10006372	3300014968	Bacteria	10164
123	Ga0157379_10009076	3300014968	Bacteria	8665
124	Ga0163161_10122449	3300017792	Bacteria	1956
125	Ga0213872_10103097	3300021361	Bacteria	1270
126	Ga0213876_10040874	3300021384	Bacteria	2450
127	Ga0213875_10153602	3300021388	Bacteria	1079
128	Ga0209565_1000324	3300025263	Bacteria	42921
129	Ga0209673_1003485	3300025273	Bacteria	9234
130	Ga0209676_1000295	3300025292	Bacteria	100711
131	Ga0209676_1000392	3300025292	Bacteria	79950
132	Ga0209564_1022970	3300025295	Bacteria	2183
133	Ga0209564_1044168	3300025295	Bacteria	1160
134	Ga0209758_1000779	3300025297	Bacteria	45780
135	Ga0209758_1003218	3300025297	Bacteria	15211
136	Ga0209050_1000362	3300025298	Bacteria	87030
137	Ga0209050_1000411	3300025298	Bacteria	79805
138	Ga0209050_1003869	3300025298	Bacteria	10634
139	Ga0209256_1001012	3300025299	Bacteria	33185
140	Ga0209256_1005802	3300025299	Bacteria	6883
141	Ga0209256_1009806	3300025299	Bacteria	4123
142	Ga0209051_1004334	3300025303	Bacteria	8801
143	Ga0209257_1000513	3300025304	Bacteria	67348
144	Ga0209257_1002416	3300025304	Bacteria	18671
145	Ga0209257_1006529	3300025304	Bacteria	7456
146	Ga0207705_10002914	3300025909	Bacteria	13075
147	Ga0207705_10134399	3300025909	Bacteria	1843
148	Ga0207707_10010982	3300025912	Bacteria	7879
149	Ga0207707_10048404	3300025912	Bacteria	3703
150	Ga0207707_10118004	3300025912	Bacteria	2319
151	Ga0207695_10001207	3300025913	Bacteria	44318
152	Ga0207695_10001235	3300025913	Bacteria	43771
153	Ga0207695_10016152	3300025913	Bacteria	8755
154	Ga0207695_10071118	3300025913	Bacteria	3553
155	Ga0207660_10001064	3300025917	Bacteria	18216
156	Ga0207660_10045389	3300025917	Bacteria	3096
157	Ga0207657_10005103	3300025919	Bacteria	13756
158	Ga0207657_10030675	3300025919	Bacteria	4878
159	Ga0207649_10133394	3300025920	Bacteria	1690
160	Ga0207652_10004084	3300025921	Bacteria	11911
161	Ga0207652_10084545	3300025921	Bacteria	2780
162	Ga0207681_10077138	3300025923	Bacteria	2342
163	Ga0207681_10104480	3300025923	Bacteria	2049
164	Ga0207650_10000016	3300025925	Bacteria	361958
165	Ga0207650_10084191	3300025925	Bacteria	2417
166	Ga0207644_10002697	3300025931	Bacteria	11439
167	Ga0207644_10207355	3300025931	Bacteria	1548
168	Ga0207690_10000077	3300025932	Bacteria	85018
169	Ga0207690_10002585	3300025932	Bacteria	10931
170	Ga0207690_10041687	3300025932	Bacteria	3010
171	Ga0207711_10025718	3300025941	Bacteria	4936
172	Ga0207711_10030112	3300025941	Bacteria	4578
173	Ga0207711_10250226	3300025941	Bacteria	1627
174	Ga0207711_10457235	3300025941	Bacteria	1189
175	Ga0207711_10598658	3300025941	Bacteria	1029
176	Ga0207679_10212588	3300025945	Bacteria	1623
177	Ga0207667_10006652	3300025949	Bacteria	13971
178	Ga0207667_10053584	3300025949	Bacteria	4244
179	Ga0207667_10292672	3300025949	Bacteria	1664
180	Ga0207712_10000641	3300025961	Bacteria	27375
181	Ga0207712_10126699	3300025961	Bacteria	1939
182	Ga0207712_10228016	3300025961	Bacteria	1493
183	Ga0207712_10268656	3300025961	Bacteria	1386
184	Ga0207668_10000002	3300025972	Bacteria	209163
185	Ga0207668_10000401	3300025972	Bacteria	27305
186	Ga0207668_10000936	3300025972	Bacteria	17552
187	Ga0207668_10002504	3300025972	Bacteria	10728
188	Ga0207668_10011205	3300025972	Bacteria	5442
189	Ga0207640_10157770	3300025981	Bacteria	1675
190	Ga0207658_10000399	3300025986	Bacteria	41904
191	Ga0207658_10006383	3300025986	Bacteria	8051
192	Ga0207658_10016082	3300025986	Bacteria	5139
193	Ga0207658_10298830	3300025986	Bacteria	1386
194	Ga0207658_10492221	3300025986	Bacteria	1091
195	Ga0207703_10000082	3300026035	Bacteria	110579
196	Ga0207703_10004006	3300026035	Bacteria	12195
197	Ga0207703_10010904	3300026035	Bacteria	7084
198	Ga0207703_10038738	3300026035	Bacteria	3807
199	Ga0207703_10357971	3300026035	Bacteria	1345
200	Ga0207678_10123128	3300026067	Bacteria	2213
201	Ga0207702_10234986	3300026078	Bacteria	1715
202	Ga0207702_10597421	3300026078	Bacteria	1083
203	Ga0207702_10993508	3300026078	Bacteria	832
204	Ga0207641_10000007	3300026088	Bacteria	441443
205	Ga0207641_10001614	3300026088	Bacteria	21995
206	Ga0207641_10004115	3300026088	Bacteria	12681
207	Ga0207641_10042480	3300026088	Bacteria	3814
208	Ga0207641_10119842	3300026088	Bacteria	2346
209	Ga0207676_10000191	3300026095	Bacteria	53466
210	Ga0207676_10019470	3300026095	Bacteria	4952
211	Ga0207676_10040773	3300026095	Bacteria	3560
212	Ga0207676_10051019	3300026095	Bacteria	3228
213	Ga0207674_10652085	3300026116	Bacteria	1017
214	Ga0207675_100012562	3300026118	Bacteria	7911
215	Ga0207675_100793121	3300026118	Bacteria	960
216	Ga0207675_100829736	3300026118	Bacteria	939
217	Ga0207683_10074908	3300026121	Bacteria	2995
218	Ga0207698_10169587	3300026142	Bacteria	1920
219	Ga0207698_10381132	3300026142	Bacteria	1342
220	Ga0268266_10000005	3300028379	Bacteria	1448194
221	Ga0268266_10004298	3300028379	Bacteria	13714
222	Ga0268266_10009515	3300028379	Bacteria	8552
223	Ga0268266_10678865	3300028379	Bacteria	992
224	Ga0268265_10000178	3300028380	Bacteria	76275
225	Ga0268265_10035886	3300028380	Bacteria	3627
226	Ga0268265_10071511	3300028380	Bacteria	2702
227	Ga0268265_10228808	3300028380	Bacteria	1632
228	Ga0268265_10705021	3300028380	Bacteria	975
229	Ga0268264_10000008	3300028381	Bacteria	773387
230	Ga0268264_10001205	3300028381	Bacteria	24897
231	Ga0268264_10018464	3300028381	Bacteria	5703
232	Ga0268264_10034431	3300028381	Bacteria	4166
233	Ga0268264_10717429	3300028381	Bacteria	994
234	Ga0307517_10045118	3300028786	Bacteria	4641
235	Ga0307515_10139640	3300028794	Bacteria	2608
236	Ga0265327_10001677	3300031251	Bacteria	26559
237	Ga0307513_10000077	3300031456	Bacteria	134167
238	Ga0307513_10002125	3300031456	Bacteria	27813
239	Ga0307513_10005206	3300031456	Bacteria	17241
240	Ga0307508_10207656	3300031616	Bacteria	1559
241	Ga0307516_10000001	3300031730	Bacteria	510338
242	Ga0307411_10177564	3300032005	Bacteria	1613
243	Ga0307510_10106131	3300033180	Bacteria	2574
244	Ga0307510_10196046	3300033180	Bacteria	1561
245	Ga0373936_0003022	3300035113	Bacteria	6287
246	Ga0395899_0104979	3300037312	Bacteria	2036
247	Ga0395900_0464224	3300037418	Bacteria	1220
248	Ga0395898_0570010	3300037466	Bacteria	1074
249	Ga0395905_0252116	3300037471	Bacteria	1649
250	Ga0395905_0323369	3300037471	Bacteria	1432
251	Ga0395905_0366661	3300037471	Bacteria	1333
252	Ga0395905_0406639	3300037471	Bacteria	1256
253	Ga0395901_0012954	3300038443	Bacteria	8460
254	Ga0395901_0228345	3300038443	Bacteria	1944
255	Ga0436365_0248244	3300039437	Bacteria	2461
256	Ga0436361_0799712	3300039447	Bacteria	22208
257	Ga0439465_0013590	3300041413	Bacteria	2536
258	Ga0451853_2849604	3300041512	Bacteria	1290
259	Ga0466961_0219300	3300044693	Bacteria	1173
260	Ga0495629_0009552	3300046459	Bacteria	7088
261	Ga0495638_0000884	3300046460	Bacteria	30806
262	Ga0495638_0001082	3300046460	Bacteria	26547
263	Ga0495638_0011795	3300046460	Bacteria	6016
264	Ga0495638_0076433	3300046460	Bacteria	2040
265	Ga0495650_0000046	3300046471	Bacteria	342987
266	Ga0495585_0089436	3300046492	Bacteria	1660
267	Ga0495583_0000003	3300046506	Bacteria	709273
268	Ga0495610_0000779	3300046512	Bacteria	29994
269	Ga0495610_0003404	3300046512	Bacteria	12414
270	Ga0495616_0000473	3300046513	Bacteria	30543
271	Ga0495616_0017364	3300046513	Bacteria	3970
272	Ga0495620_0013580	3300046515	Bacteria	4166
273	Ga0495620_0031039	3300046515	Bacteria	2452
274	Ga0495632_0003085	3300046519	Bacteria	12087
275	Ga0495632_0093430	3300046519	Bacteria	1423
276	Ga0495637_0001422	3300046520	Bacteria	14112
277	Ga0495643_0029286	3300046522	Bacteria	3082
278	Ga0495643_0101183	3300046522	Bacteria	1477
279	Ga0495643_0133777	3300046522	Bacteria	1243
280	Ga0495644_0134832	3300046523	Bacteria	942
281	Ga0495648_0000066	3300046524	Bacteria	140767
282	Ga0495648_0040202	3300046524	Bacteria	2968
283	Ga0495648_0063498	3300046524	Bacteria	2180
284	Ga0495642_0011894	3300046528	Bacteria	3352
285	Ga0495642_0024411	3300046528	Bacteria	2391
286	Ga0495654_0000023	3300046530	Bacteria	243798
287	Ga0495654_0049666	3300046530	Bacteria	2054
288	Ga0495609_0038043	3300046538	Bacteria	2170
289	Ga0495597_0060985	3300046542	Bacteria	1644
290	Ga0495597_0263557	3300046542	Bacteria	674
291	Ga0495668_0005347	3300046616	Bacteria	8756
292	Ga0495668_0008691	3300046616	Bacteria	6312
293	Ga0495668_0014733	3300046616	Bacteria	4578
294	Ga0495668_0091782	3300046616	Bacteria	1664
295	Ga0495668_0277269	3300046616	Bacteria	918
296	Ga0495611_0008182	3300046648	Bacteria	4436
297	Ga0495625_0001472	3300046660	Bacteria	28466
298	Ga0495625_0011015	3300046660	Bacteria	7418
299	Ga0495625_0107598	3300046660	Bacteria	1908
300	Ga0495625_0354530	3300046660	Bacteria	926
301	Ga0495659_0058848	3300046664	Bacteria	1415
302	Ga0495669_0000002	3300046684	Bacteria	282777
303	Ga0495669_0009146	3300046684	Bacteria	4174
304	Ga0495669_0046846	3300046684	Bacteria	1930
305	Ga0495669_0073573	3300046684	Bacteria	1561
306	Ga0495670_0087361	3300046691	Bacteria	1593
307	Ga0495671_0028071	3300046692	Bacteria	2902
308	Ga0495671_0317118	3300046692	Bacteria	749
309	Ga0495660_0012126	3300046810	Bacteria	5001
310	Ga0495581_0109239	3300047315	Bacteria	1608
311	Ga0495672_0000311	3300047320	Bacteria	65012
312	Ga0495683_0086311	3300047323	Bacteria	1525
313	Ga0495677_0013716	3300047445	Bacteria	2949
314	Ga0495679_013323	3300047446	Bacteria	3094
315	Ga0495673_0000710	3300047469	Bacteria	32297
316	Ga0495673_0001008	3300047469	Bacteria	24918
317	Ga0495681_0043583	3300047470	Bacteria	2162
318	Ga0495681_0057281	3300047470	Bacteria	1810
319	Ga0495686_0011532	3300047472	Bacteria	6225
320	Ga0495686_0028160	3300047472	Bacteria	3660
321	Ga0495686_0067895	3300047472	Bacteria	2200
322	Ga0495686_0078038	3300047472	Bacteria	2027
323	Ga0495686_0251514	3300047472	Bacteria	993
324	Ga0496100_0342364	3300048903	Bacteria	1128
325	Ga0496102_0019937	3300048905	Bacteria	5915
326	Ga0496103_0210981	3300048906	Bacteria	1249
327	Ga0496104_0141812	3300048907	Bacteria	2309
328	Ga0496106_0015925	3300048909	Bacteria	5561
329	Ga0496107_0000112	3300048910	Bacteria	39450
330	Ga0496108_0686688	3300048911	Bacteria	888
331	Ga0496109_0039706	3300048912	Bacteria	4261
332	Ga0496112_0097281	3300048915	Bacteria	2914
333	Ga0496112_0181416	3300048915	Bacteria	2069
334	Ga0496113_0533679	3300048916	Bacteria	942
335	Ga0496115_0004474	3300048918	Bacteria	10116
336	Ga0496115_0009878	3300048918	Bacteria	7105
337	Ga0496115_0036586	3300048918	Bacteria	3888
338	Ga0496117_0011384	3300048920	Bacteria	7970
339	Ga0496118_0004288	3300048921	Bacteria	17062
340	Ga0496121_0000035	3300048924	Bacteria	374316
341	Ga0496121_0001796	3300048924	Bacteria	34668
342	Ga0496121_0292447	3300048924	Bacteria	1109
343	Ga0496124_0014384	3300048927	Bacteria	7651
344	Ga0496126_0004925	3300048929	Bacteria	15584
345	Ga0496126_0375305	3300048929	Bacteria	1159
346	Ga0501033_0002814	3300049570	Bacteria	14559
347	Ga0501033_0009084	3300049570	Bacteria	7669
348	Ga0501034_0007932	3300049571	Bacteria	11278
349	Ga0501037_0287530	3300049573	Bacteria	1144
350	Ga0501043_0041181	3300049579	Bacteria	3630
351	Ga0501047_0002235	3300049581	Bacteria	18535
352	Ga0501047_0111569	3300049581	Bacteria	2617
353	Ga0501047_0246918	3300049581	Bacteria	1634
354	Ga0501047_0669518	3300049581	Bacteria	856
355	Ga0501044_0008351	3300049823	Bacteria	11351
356	Ga0501044_0011677	3300049823	Bacteria	9519
357	Ga0501044_0239206	3300049823	Bacteria	1760
358	Ga0501044_0467870	3300049823	Bacteria	1165
359	Ga0501044_0811370	3300049823	Bacteria	814
360	nmdc:mga00v17_1616_c1	3300050491	Bacteria	11777
361	nmdc:mga06z11_141924_c1	3300050494	Bacteria	1359
362	nmdc:mga07m45_6207_c1	3300050496	Bacteria	6031
363	nmdc:mga0sz30_107581_c1	3300050516	Bacteria	1220
364	Ga0500635_0000133	3300053080	Bacteria	42884
365	Ga0500644_0000084	3300053088	Bacteria	57829
366	Ga0500583_0151188	3300053092	Bacteria	1155
367	Ga0500651_0237573	3300053093	Bacteria	1064
368	Ga0500566_0116957	3300053094	Bacteria	1442
369	Ga0500554_001287	3300053102	Bacteria	4864
370	Ga0500555_001169	3300053103	Bacteria	8613
371	Ga0500556_0000314	3300053104	Bacteria	36676
372	Ga0500562_000327	3300053108	Bacteria	11496
373	Ga0500562_043711	3300053108	Bacteria	1193
374	Ga0500569_009406	3300053109	Bacteria	2270
375	Ga0500595_005961	3300053119	Bacteria	5246
376	Ga0500608_000831	3300053122	Bacteria	11161
377	Ga0500618_000092	3300053125	Bacteria	73216
378	Ga0500642_0025648	3300053130	Bacteria	2396
379	Ga0500658_0002597	3300053134	Bacteria	6976
380	Ga0500559_0000046	3300053136	Bacteria	98853
381	Ga0500559_0001854	3300053136	Bacteria	11523
382	Ga0500559_0002680	3300053136	Bacteria	9060
383	Ga0500559_0011386	3300053136	Bacteria	3800
384	Ga0500564_000080	3300053138	Bacteria	24788
385	Ga0500590_010870	3300053148	Bacteria	4603
386	Ga0500616_0068741	3300053153	Bacteria	1813
387	Ga0500616_0120808	3300053153	Bacteria	1252
388	Ga0500619_044307	3300053154	Bacteria	1418
389	Ga0500622_0005190	3300053156	Bacteria	7889
390	Ga0500622_0010791	3300053156	Bacteria	4997
391	Ga0500622_0018551	3300053156	Bacteria	3699
392	Ga0500624_004743	3300053157	Bacteria	1796
393	Ga0500627_0051129	3300053158	Bacteria	1801
394	Ga0500638_063286	3300053162	Bacteria	1775
395	Ga0500637_0001963	3300053178	Bacteria	8938
396	Ga0500637_0043423	3300053178	Bacteria	2544
397	Ga0500611_001212	3300053727	Bacteria	2765
398	Ga0500645_001187	3300053730	Bacteria	13857
399	Ga0500645_004400	3300053730	Bacteria	5415
400	Ga0500609_009655	3300053731	Bacteria	1300
401	Ga0500661_041813	3300055283	Bacteria	812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005530	Ga0070679_100380197	Ga0070679_1003801972	199
2	3300021361	Ga0213872_10103097	Ga0213872_101030972	199
3	3300026116	Ga0207674_10652085	Ga0207674_106520852	199
4	3300037312	Ga0395899_0104979	Ga0395899_0104979_466_1077	199
5	3300037418	Ga0395900_0464224	Ga0395900_0464224_454_1065	199
6	3300037466	Ga0395898_0570010	Ga0395898_0570010_356_967	199
7	3300037471	Ga0395905_0323369	Ga0395905_0323369_711_1322	199
8	3300037471	Ga0395905_0366661	Ga0395905_0366661_373_984	199
9	3300037471	Ga0395905_0406639	Ga0395905_0406639_457_1068	199
10	3300038443	Ga0395901_0012954	Ga0395901_0012954_1277_1888	199
11	3300039447	Ga0436361_0799712	Ga0436361_0799712_5441_6055	199
12	3300044693	Ga0466961_0219300	Ga0466961_0219300_523_1134	199
13	3300046692	Ga0495671_0317118	Ga0495671_0317118_11_610	199
14	3300049581	Ga0501047_0111569	Ga0501047_0111569_1790_2401	199
15	3300046542	Ga0495597_0263557	Ga0495597_0263557_46_663	200
16	3300005336	Ga0070680_100442742	Ga0070680_1004427422	201
17	3300005578	Ga0068854_100215713	Ga0068854_1002157132	201
18	3300005614	Ga0068856_100262497	Ga0068856_1002624972	201
19	3300025912	Ga0207707_10048404	Ga0207707_100484042	201
20	3300025981	Ga0207640_10157770	Ga0207640_101577702	201
21	3300026142	Ga0207698_10169587	Ga0207698_101695872	201
22	3300046528	Ga0495642_0024411	Ga0495642_0024411_1597_2229	204
23	3300046684	Ga0495669_0000002	Ga0495669_0000002_245883_246515	204
24	3300021388	Ga0213875_10153602	Ga0213875_101536022	205
25	3300032005	Ga0307411_10177564	Ga0307411_101775642	205
26	3300005539	Ga0068853_100204706	Ga0068853_1002047062	206
27	3300046660	Ga0495625_0011015	Ga0495625_0011015_3831_4466	207
28	iso_pu_bacteria	2643221598	2644000550	207
29	3300025909	Ga0207705_10134399	Ga0207705_101343992	208
30	3300005327	Ga0070658_10029604	Ga0070658_100296044	210
31	3300005327	Ga0070658_10068855	Ga0070658_100688554	210
32	3300005327	Ga0070658_10130515	Ga0070658_101305154	210
33	3300005331	Ga0070670_100000013	Ga0070670_10000001323	210
34	3300005331	Ga0070670_100052230	Ga0070670_1000522302	210
35	3300005331	Ga0070670_100266985	Ga0070670_1002669852	210
36	3300005335	Ga0070666_10056235	Ga0070666_100562352	210
37	3300005336	Ga0070680_100003427	Ga0070680_1000034273	210
38	3300005338	Ga0068868_100737221	Ga0068868_1007372211	210
39	3300005339	Ga0070660_100023294	Ga0070660_1000232944	210
40	3300005339	Ga0070660_100090360	Ga0070660_1000903603	210
41	3300005347	Ga0070668_100000042	Ga0070668_10000004279	210
42	3300005347	Ga0070668_100000445	Ga0070668_10000044523	210
43	3300005347	Ga0070668_100001526	Ga0070668_10000152614	210
44	3300005347	Ga0070668_100001741	Ga0070668_10000174110	210
45	3300005347	Ga0070668_100020137	Ga0070668_1000201372	210
46	3300005347	Ga0070668_100034371	Ga0070668_1000343714	210
47	3300005353	Ga0070669_100018780	Ga0070669_1000187806	210
48	3300005353	Ga0070669_100048139	Ga0070669_1000481393	210
49	3300005355	Ga0070671_100003043	Ga0070671_1000030438	210
50	3300005355	Ga0070671_100348572	Ga0070671_1003485722	210
51	3300005366	Ga0070659_100001728	Ga0070659_1000017285	210
52	3300005366	Ga0070659_100003148	Ga0070659_1000031485	210
53	3300005367	Ga0070667_100000168	Ga0070667_10000016837	210
54	3300005367	Ga0070667_100060263	Ga0070667_1000602632	210
55	3300005367	Ga0070667_100191814	Ga0070667_1001918143	210
56	3300005455	Ga0070663_100115969	Ga0070663_1001159692	210
57	3300005458	Ga0070681_10005916	Ga0070681_100059169	210
58	3300005530	Ga0070679_100015567	Ga0070679_1000155672	210
59	3300005539	Ga0068853_100034565	Ga0068853_1000345651	210
60	3300005548	Ga0070665_100000058	Ga0070665_10000005841	210
61	3300005548	Ga0070665_100000363	Ga0070665_10000036335	210
62	3300005548	Ga0070665_100000638	Ga0070665_10000063837	210
63	3300005548	Ga0070665_100144147	Ga0070665_1001441472	210
64	3300005563	Ga0068855_100015559	Ga0068855_1000155599	210
65	3300005614	Ga0068856_101011068	Ga0068856_1010110681	210
66	3300005617	Ga0068859_100001153	Ga0068859_1000011539	210
67	3300005617	Ga0068859_100014592	Ga0068859_1000145926	210
68	3300005617	Ga0068859_100171493	Ga0068859_1001714933	210
69	3300005618	Ga0068864_100000067	Ga0068864_10000006726	210
70	3300005618	Ga0068864_100000135	Ga0068864_10000013553	210
71	3300005618	Ga0068864_100060726	Ga0068864_1000607262	210
72	3300005618	Ga0068864_100066853	Ga0068864_1000668531	210
73	3300005618	Ga0068864_100303018	Ga0068864_1003030182	210
74	3300005719	Ga0068861_100076127	Ga0068861_1000761272	210
75	3300005719	Ga0068861_100209311	Ga0068861_1002093112	210
76	3300005841	Ga0068863_100000735	Ga0068863_1000007355	210
77	3300005841	Ga0068863_100838664	Ga0068863_1008386642	210
78	3300005842	Ga0068858_100000020	Ga0068858_10000002077	210
79	3300005842	Ga0068858_100001260	Ga0068858_10000126023	210
80	3300005842	Ga0068858_100003007	Ga0068858_1000030075	210
81	3300005842	Ga0068858_100046403	Ga0068858_1000464034	210
82	3300005843	Ga0068860_100000133	Ga0068860_10000013340	210
83	3300005843	Ga0068860_100000382	Ga0068860_10000038224	210
84	3300005843	Ga0068860_100067464	Ga0068860_1000674642	210
85	3300005843	Ga0068860_100211903	Ga0068860_1002119032	210
86	3300005844	Ga0068862_100000167	Ga0068862_1000001677	210
87	3300005844	Ga0068862_100000463	Ga0068862_10000046323	210
88	3300005844	Ga0068862_100114267	Ga0068862_1001142673	210
89	3300005844	Ga0068862_100252862	Ga0068862_1002528622	210
90	3300006042	Ga0075368_10004105	Ga0075368_100041058	210
91	3300006048	Ga0075363_100072499	Ga0075363_1000724992	210
92	3300006051	Ga0075364_10010559	Ga0075364_100105595	210
93	3300006178	Ga0075367_10102445	Ga0075367_101024451	210
94	3300006186	Ga0075369_10194897	Ga0075369_101948971	210
95	3300006931	Ga0097620_100001153	Ga0097620_1000011539	210
96	3300006931	Ga0097620_100014592	Ga0097620_1000145926	210
97	3300006931	Ga0097620_100171496	Ga0097620_1001714963	210
98	3300009093	Ga0105240_10033200	Ga0105240_100332005	210
99	3300009093	Ga0105240_10099619	Ga0105240_100996195	210
100	3300009093	Ga0105240_10151338	Ga0105240_101513382	210
101	3300009093	Ga0105240_10308066	Ga0105240_103080663	210
102	3300009176	Ga0105242_10855499	Ga0105242_108554992	210
103	3300009177	Ga0105248_10003656	Ga0105248_100036562	210
104	3300009177	Ga0105248_10059679	Ga0105248_100596796	210
105	3300009177	Ga0105248_10086324	Ga0105248_100863242	210
106	3300009177	Ga0105248_10217226	Ga0105248_102172262	210
107	3300009177	Ga0105248_11022878	Ga0105248_110228782	210
108	3300009553	Ga0105249_10000610	Ga0105249_1000061013	210
109	3300009553	Ga0105249_10256678	Ga0105249_102566782	210
110	3300009553	Ga0105249_10321817	Ga0105249_103218171	210
111	3300009553	Ga0105249_11183326	Ga0105249_111833261	210
112	3300010375	Ga0105239_10269501	Ga0105239_102695012	210
113	3300013306	Ga0163162_10033632	Ga0163162_100336322	210
114	3300013306	Ga0163162_10045463	Ga0163162_100454633	210
115	3300013308	Ga0157375_10073232	Ga0157375_100732323	210
116	3300014325	Ga0163163_10005735	Ga0163163_100057359	210
117	3300014968	Ga0157379_10006372	Ga0157379_100063722	210
118	3300014968	Ga0157379_10009076	Ga0157379_100090768	210
119	3300017792	Ga0163161_10122449	Ga0163161_101224492	210
120	3300021384	Ga0213876_10040874	Ga0213876_100408742	210
121	3300025909	Ga0207705_10002914	Ga0207705_100029146	210
122	3300025912	Ga0207707_10118004	Ga0207707_101180042	210
123	3300025913	Ga0207695_10001207	Ga0207695_1000120744	210
124	3300025913	Ga0207695_10016152	Ga0207695_100161528	210
125	3300025913	Ga0207695_10071118	Ga0207695_100711182	210
126	3300025917	Ga0207660_10001064	Ga0207660_100010645	210
127	3300025919	Ga0207657_10005103	Ga0207657_100051035	210
128	3300025919	Ga0207657_10030675	Ga0207657_100306755	210
129	3300025921	Ga0207652_10004084	Ga0207652_100040845	210
130	3300025923	Ga0207681_10104480	Ga0207681_101044802	210
131	3300025925	Ga0207650_10000016	Ga0207650_10000016210	210
132	3300025925	Ga0207650_10084191	Ga0207650_100841912	210
133	3300025931	Ga0207644_10002697	Ga0207644_100026977	210
134	3300025931	Ga0207644_10207355	Ga0207644_102073553	210
135	3300025932	Ga0207690_10000077	Ga0207690_1000007710	210
136	3300025932	Ga0207690_10002585	Ga0207690_100025858	210
137	3300025941	Ga0207711_10025718	Ga0207711_100257182	210
138	3300025941	Ga0207711_10030112	Ga0207711_100301122	210
139	3300025941	Ga0207711_10250226	Ga0207711_102502261	210
140	3300025941	Ga0207711_10457235	Ga0207711_104572351	210
141	3300025941	Ga0207711_10598658	Ga0207711_105986582	210
142	3300025949	Ga0207667_10053584	Ga0207667_100535842	210
143	3300025961	Ga0207712_10000641	Ga0207712_100006418	210
144	3300025961	Ga0207712_10126699	Ga0207712_101266992	210
145	3300025961	Ga0207712_10228016	Ga0207712_102280162	210
146	3300025972	Ga0207668_10000002	Ga0207668_10000002149	210
147	3300025972	Ga0207668_10000401	Ga0207668_100004012	210
148	3300025972	Ga0207668_10000936	Ga0207668_1000093611	210
149	3300025972	Ga0207668_10002504	Ga0207668_100025045	210
150	3300025972	Ga0207668_10011205	Ga0207668_100112056	210
151	3300025986	Ga0207658_10000399	Ga0207658_1000039930	210
152	3300025986	Ga0207658_10006383	Ga0207658_100063832	210
153	3300025986	Ga0207658_10016082	Ga0207658_100160826	210
154	3300025986	Ga0207658_10492221	Ga0207658_104922212	210
155	3300026035	Ga0207703_10000082	Ga0207703_1000008217	210
156	3300026035	Ga0207703_10004006	Ga0207703_100040063	210
157	3300026035	Ga0207703_10010904	Ga0207703_100109045	210
158	3300026035	Ga0207703_10038738	Ga0207703_100387382	210
159	3300026035	Ga0207703_10357971	Ga0207703_103579712	210
160	3300026067	Ga0207678_10123128	Ga0207678_101231282	210
161	3300026078	Ga0207702_10597421	Ga0207702_105974212	210
162	3300026078	Ga0207702_10993508	Ga0207702_109935081	210
163	3300026088	Ga0207641_10000007	Ga0207641_1000000788	210
164	3300026088	Ga0207641_10001614	Ga0207641_100016144	210
165	3300026088	Ga0207641_10004115	Ga0207641_100041159	210
166	3300026088	Ga0207641_10042480	Ga0207641_100424802	210
167	3300026095	Ga0207676_10000191	Ga0207676_1000019122	210
168	3300026095	Ga0207676_10019470	Ga0207676_100194703	210
169	3300026095	Ga0207676_10040773	Ga0207676_100407735	210
170	3300026095	Ga0207676_10051019	Ga0207676_100510191	210
171	3300026118	Ga0207675_100012562	Ga0207675_1000125623	210
172	3300026118	Ga0207675_100793121	Ga0207675_1007931212	210
173	3300026121	Ga0207683_10074908	Ga0207683_100749083	210
174	3300028379	Ga0268266_10000005	Ga0268266_10000005138	210
175	3300028379	Ga0268266_10004298	Ga0268266_100042981	210
176	3300028379	Ga0268266_10009515	Ga0268266_100095152	210
177	3300028379	Ga0268266_10678865	Ga0268266_106788652	210
178	3300028380	Ga0268265_10000178	Ga0268265_1000017860	210
179	3300028380	Ga0268265_10035886	Ga0268265_100358863	210
180	3300028380	Ga0268265_10228808	Ga0268265_102288082	210
181	3300028380	Ga0268265_10705021	Ga0268265_107050212	210
182	3300028381	Ga0268264_10000008	Ga0268264_10000008282	210
183	3300028381	Ga0268264_10001205	Ga0268264_1000120523	210
184	3300028381	Ga0268264_10018464	Ga0268264_100184644	210
185	3300028381	Ga0268264_10034431	Ga0268264_100344314	210
186	3300028786	Ga0307517_10045118	Ga0307517_100451185	210
187	3300031456	Ga0307513_10002125	Ga0307513_1000212510	210
188	3300031456	Ga0307513_10005206	Ga0307513_1000520612	210
189	3300031616	Ga0307508_10207656	Ga0307508_102076563	210
190	3300031730	Ga0307516_10000001	Ga0307516_10000001259	210
191	3300035113	Ga0373936_0003022	Ga0373936_0003022_5087_5803	210
192	3300038443	Ga0395901_0228345	Ga0395901_0228345_1211_1930	210
193	3300039437	Ga0436365_0248244	Ga0436365_0248244_1271_1978	210
194	3300046459	Ga0495629_0009552	Ga0495629_0009552_483_1193	210
195	3300046492	Ga0495585_0089436	Ga0495585_0089436_908_1618	210
196	3300046515	Ga0495620_0031039	Ga0495620_0031039_1379_2089	210
197	3300046522	Ga0495643_0029286	Ga0495643_0029286_994_1704	210
198	3300046523	Ga0495644_0134832	Ga0495644_0134832_131_841	210
199	3300046528	Ga0495642_0011894	Ga0495642_0011894_896_1606	210
200	3300046530	Ga0495654_0049666	Ga0495654_0049666_995_1705	210
201	3300046538	Ga0495609_0038043	Ga0495609_0038043_1267_1977	210
202	3300046616	Ga0495668_0008691	Ga0495668_0008691_3626_4336	210
203	3300046616	Ga0495668_0091782	Ga0495668_0091782_260_970	210
204	3300046664	Ga0495659_0058848	Ga0495659_0058848_195_905	210
205	3300046684	Ga0495669_0046846	Ga0495669_0046846_15_728	210
206	3300046684	Ga0495669_0073573	Ga0495669_0073573_571_1272	210
207	3300047315	Ga0495581_0109239	Ga0495581_0109239_97_813	210
208	3300047472	Ga0495686_0251514	Ga0495686_0251514_79_804	210
209	3300048903	Ga0496100_0342364	Ga0496100_0342364_37_741	210
210	3300048905	Ga0496102_0019937	Ga0496102_0019937_2048_2758	210
211	3300048906	Ga0496103_0210981	Ga0496103_0210981_132_842	210
212	3300048907	Ga0496104_0141812	Ga0496104_0141812_206_916	210
213	3300048911	Ga0496108_0686688	Ga0496108_0686688_71_781	210
214	3300048912	Ga0496109_0039706	Ga0496109_0039706_235_945	210
215	3300048915	Ga0496112_0097281	Ga0496112_0097281_338_1048	210
216	3300048915	Ga0496112_0181416	Ga0496112_0181416_1114_1824	210
217	3300048916	Ga0496113_0533679	Ga0496113_0533679_93_803	210
218	3300048918	Ga0496115_0004474	Ga0496115_0004474_4958_5659	210
219	3300048918	Ga0496115_0036586	Ga0496115_0036586_1748_2458	210
220	3300048920	Ga0496117_0011384	Ga0496117_0011384_2793_3503	210
221	3300048921	Ga0496118_0004288	Ga0496118_0004288_11151_11861	210
222	3300048924	Ga0496121_0000035	Ga0496121_0000035_33257_33967	210
223	3300048929	Ga0496126_0375305	Ga0496126_0375305_75_803	210
224	3300049570	Ga0501033_0009084	Ga0501033_0009084_4004_4702	210
225	3300049573	Ga0501037_0287530	Ga0501037_0287530_19_717	210
226	3300049579	Ga0501043_0041181	Ga0501043_0041181_2545_3261	210
227	3300049581	Ga0501047_0002235	Ga0501047_0002235_12613_13308	210
228	3300049581	Ga0501047_0246918	Ga0501047_0246918_543_1241	210
229	3300049581	Ga0501047_0669518	Ga0501047_0669518_70_783	210
230	3300049823	Ga0501044_0011677	Ga0501044_0011677_7234_7932	210
231	3300049823	Ga0501044_0239206	Ga0501044_0239206_173_883	210
232	3300049823	Ga0501044_0467870	Ga0501044_0467870_373_1086	210
233	3300049823	Ga0501044_0811370	Ga0501044_0811370_120_776	210
234	3300050491	nmdc:mga00v17_1616_c1	nmdc:mga00v17_1616_c1_8312_9019	210
235	3300050494	nmdc:mga06z11_141924_c1	nmdc:mga06z11_141924_c1_412_1119	210
236	3300050496	nmdc:mga07m45_6207_c1	nmdc:mga07m45_6207_c1_4663_5370	210
237	3300050516	nmdc:mga0sz30_107581_c1	nmdc:mga0sz30_107581_c1_138_845	210
238	3300053080	Ga0500635_0000133	Ga0500635_0000133_15795_16502	210
239	3300053092	Ga0500583_0151188	Ga0500583_0151188_315_1025	210
240	3300053094	Ga0500566_0116957	Ga0500566_0116957_644_1354	210
241	3300053103	Ga0500555_001169	Ga0500555_001169_2765_3475	210
242	3300053108	Ga0500562_043711	Ga0500562_043711_15_752	210
243	3300053109	Ga0500569_009406	Ga0500569_009406_1472_2182	210
244	3300053119	Ga0500595_005961	Ga0500595_005961_1245_1955	210
245	3300053122	Ga0500608_000831	Ga0500608_000831_6895_7605	210
246	3300053130	Ga0500642_0025648	Ga0500642_0025648_155_865	210
247	3300053136	Ga0500559_0011386	Ga0500559_0011386_2619_3329	210
248	3300053148	Ga0500590_010870	Ga0500590_010870_339_1049	210
249	3300053153	Ga0500616_0120808	Ga0500616_0120808_373_1029	210
250	3300053154	Ga0500619_044307	Ga0500619_044307_175_885	210
251	3300053157	Ga0500624_004743	Ga0500624_004743_1063_1770	210
252	3300053162	Ga0500638_063286	Ga0500638_063286_765_1472	210
253	3300053178	Ga0500637_0001963	Ga0500637_0001963_4598_5305	210
254	3300053178	Ga0500637_0043423	Ga0500637_0043423_1180_1890	210
255	iso_pu_bacteria	2643221614	2644088684	210
256	iso_pu_bacteria	2643221661	2644343919	210
257	iso_pu_bacteria	2643221666	2644368602	210
258	3300005331	Ga0070670_100791635	Ga0070670_1007916351	211
259	3300005336	Ga0070680_100042468	Ga0070680_1000424683	211
260	3300005341	Ga0070691_10004606	Ga0070691_100046062	211
261	3300005367	Ga0070667_100260000	Ga0070667_1002600001	211
262	3300005458	Ga0070681_10094612	Ga0070681_100946123	211
263	3300005530	Ga0070679_100007487	Ga0070679_1000074876	211
264	3300005548	Ga0070665_100042907	Ga0070665_1000429075	211
265	3300005563	Ga0068855_100029515	Ga0068855_1000295158	211
266	3300005616	Ga0068852_100280147	Ga0068852_1002801472	211
267	3300005844	Ga0068862_100593477	Ga0068862_1005934771	211
268	3300009093	Ga0105240_10023517	Ga0105240_100235172	211
269	3300010375	Ga0105239_10450440	Ga0105239_104504402	211
270	3300013104	Ga0157370_10169041	Ga0157370_101690412	211
271	3300025304	Ga0209257_1002416	Ga0209257_100241617	211
272	3300025912	Ga0207707_10010982	Ga0207707_100109822	211
273	3300025913	Ga0207695_10001235	Ga0207695_100012357	211
274	3300025917	Ga0207660_10045389	Ga0207660_100453894	211
275	3300025921	Ga0207652_10084545	Ga0207652_100845452	211
276	3300025923	Ga0207681_10077138	Ga0207681_100771382	211
277	3300025945	Ga0207679_10212588	Ga0207679_102125883	211
278	3300025949	Ga0207667_10006652	Ga0207667_1000665216	211
279	3300025949	Ga0207667_10292672	Ga0207667_102926722	211
280	3300025961	Ga0207712_10268656	Ga0207712_102686562	211
281	3300025986	Ga0207658_10298830	Ga0207658_102988302	211
282	3300026078	Ga0207702_10234986	Ga0207702_102349862	211
283	3300026088	Ga0207641_10119842	Ga0207641_101198423	211
284	3300026118	Ga0207675_100829736	Ga0207675_1008297361	211
285	3300026142	Ga0207698_10381132	Ga0207698_103811322	211
286	3300028380	Ga0268265_10071511	Ga0268265_100715111	211
287	3300028381	Ga0268264_10717429	Ga0268264_107174292	211
288	3300031456	Ga0307513_10000077	Ga0307513_1000007796	211
289	3300037471	Ga0395905_0252116	Ga0395905_0252116_308_1012	211
290	3300046648	Ga0495611_0008182	Ga0495611_0008182_1502_2239	211
291	3300053730	Ga0500645_004400	Ga0500645_004400_566_1279	211
292	iso_pu_bacteria	2791355048	2792460446	211
293	iso_pu_bacteria	2843744320	2843745134	211
294	iso_pu_bacteria	2849573788	2849577376	211
295	iso_pu_bacteria	2851153111	2851155208	211
296	3300005344	Ga0070661_100212010	Ga0070661_1002120102	212
297	3300005366	Ga0070659_100006630	Ga0070659_1000066303	212
298	3300005539	Ga0068853_100094154	Ga0068853_1000941543	212
299	3300005564	Ga0070664_100114142	Ga0070664_1001141422	212
300	3300025920	Ga0207649_10133394	Ga0207649_101333942	212
301	3300025932	Ga0207690_10041687	Ga0207690_100416873	212
302	3300033180	Ga0307510_10106131	Ga0307510_101061312	212
303	3300033180	Ga0307510_10196046	Ga0307510_101960462	212
304	3300041512	Ga0451853_2849604	Ga0451853_2849604_284_934	212
305	3300046684	Ga0495669_0009146	Ga0495669_0009146_1999_2661	212
306	3300047445	Ga0495677_0013716	Ga0495677_0013716_609_1271	212
307	3300049570	Ga0501033_0002814	Ga0501033_0002814_4940_5599	212
308	3300049571	Ga0501034_0007932	Ga0501034_0007932_3868_4527	212
309	3300049823	Ga0501044_0008351	Ga0501044_0008351_532_1191	212
310	3300053156	Ga0500622_0018551	Ga0500622_0018551_961_1626	212
311	iso_pu_bacteria	2849560528	2849564075	212
312	3300031251	Ga0265327_10001677	Ga0265327_1000167713	213
313	3300046616	Ga0495668_0277269	Ga0495668_0277269_87_806	213
314	iso_pu_bacteria	2898329390	2898331183	213
315	iso_pu_bacteria	2510917020	2511122619	214
316	iso_pu_bacteria	2643221545	2643749142	214
317	iso_pu_bacteria	2643221584	2643930918	214
318	iso_pu_bacteria	2643221691	2644509083	214
319	3300005577	Ga0068857_100522397	Ga0068857_1005223972	215
320	3300025299	Ga0209256_1005802	Ga0209256_10058027	215
321	3300047472	Ga0495686_0028160	Ga0495686_0028160_1119_1835	215
322	3300048929	Ga0496126_0004925	Ga0496126_0004925_8684_9352	215
323	3300053108	Ga0500562_000327	Ga0500562_000327_2210_2905	215
324	iso_pu_bacteria	2582581279	2585148012	215
325	iso_pu_bacteria	2857504554	2857508649	215
326	3300053088	Ga0500644_0000084	Ga0500644_0000084_38773_39423	216
327	3300055283	Ga0500661_041813	Ga0500661_041813_99_749	216
328	3300003781	Ga0055536_1000606	Ga0055536_100060628	217
329	3300003791	Ga0055530_10016353	Ga0055530_100163532	217
330	3300003794	Ga0055531_10000294	Ga0055531_1000029450	217
331	3300025292	Ga0209676_1000392	Ga0209676_100039216	217
332	3300025298	Ga0209050_1000411	Ga0209050_100041150	217
333	3300025304	Ga0209257_1000513	Ga0209257_100051331	217
334	3300046522	Ga0495643_0133777	Ga0495643_0133777_152_820	217
335	3300046524	Ga0495648_0000066	Ga0495648_0000066_86578_87237	217
336	3300046616	Ga0495668_0014733	Ga0495668_0014733_1119_1778	217
337	3300047469	Ga0495673_0000710	Ga0495673_0000710_26215_26874	217
338	3300047472	Ga0495686_0011532	Ga0495686_0011532_2749_3429	217
339	3300053138	Ga0500564_000080	Ga0500564_000080_18413_19072	217
340	3300003215	JGI25153J46596_10024156	JGI25153J46596_100241562	218
341	3300003215	JGI25153J46596_10031996	JGI25153J46596_100319962	218
342	3300003773	Ga0055537_1002154	Ga0055537_10021543	218
343	3300003775	Ga0055524_1004327	Ga0055524_10043274	218
344	3300003781	Ga0055536_1000576	Ga0055536_10005762	218
345	3300003790	Ga0055528_1029017	Ga0055528_10290172	218
346	3300003791	Ga0055530_10001308	Ga0055530_1000130820	218
347	3300005262	Ga0065165_1001939	Ga0065165_100193915	218
348	3300025263	Ga0209565_1000324	Ga0209565_10003249	218
349	3300025273	Ga0209673_1003485	Ga0209673_10034853	218
350	3300025292	Ga0209676_1000295	Ga0209676_100029532	218
351	3300025295	Ga0209564_1022970	Ga0209564_10229702	218
352	3300025295	Ga0209564_1044168	Ga0209564_10441682	218
353	3300025297	Ga0209758_1000779	Ga0209758_100077911	218
354	3300025297	Ga0209758_1003218	Ga0209758_10032188	218
355	3300025298	Ga0209050_1000362	Ga0209050_100036224	218
356	3300025298	Ga0209050_1003869	Ga0209050_10038699	218
357	3300025299	Ga0209256_1001012	Ga0209256_10010129	218
358	3300025299	Ga0209256_1009806	Ga0209256_10098063	218
359	3300025303	Ga0209051_1004334	Ga0209051_10043346	218
360	3300025304	Ga0209257_1006529	Ga0209257_10065292	218
361	3300028794	Ga0307515_10139640	Ga0307515_101396402	218
362	3300041413	Ga0439465_0013590	Ga0439465_0013590_1745_2413	218
363	3300046460	Ga0495638_0000884	Ga0495638_0000884_14191_14859	218
364	3300046460	Ga0495638_0001082	Ga0495638_0001082_21997_22653	218
365	3300046460	Ga0495638_0011795	Ga0495638_0011795_2741_3409	218
366	3300046460	Ga0495638_0076433	Ga0495638_0076433_59_736	218
367	3300046471	Ga0495650_0000046	Ga0495650_0000046_326845_327513	218
368	3300046506	Ga0495583_0000003	Ga0495583_0000003_47165_47833	218
369	3300046512	Ga0495610_0000779	Ga0495610_0000779_1336_2004	218
370	3300046512	Ga0495610_0003404	Ga0495610_0003404_7038_7706	218
371	3300046513	Ga0495616_0000473	Ga0495616_0000473_10550_11206	218
372	3300046513	Ga0495616_0017364	Ga0495616_0017364_432_1100	218
373	3300046515	Ga0495620_0013580	Ga0495620_0013580_1013_1681	218
374	3300046519	Ga0495632_0003085	Ga0495632_0003085_5041_5697	218
375	3300046519	Ga0495632_0093430	Ga0495632_0093430_390_1046	218
376	3300046520	Ga0495637_0001422	Ga0495637_0001422_8192_8860	218
377	3300046522	Ga0495643_0101183	Ga0495643_0101183_545_1213	218
378	3300046524	Ga0495648_0040202	Ga0495648_0040202_877_1545	218
379	3300046524	Ga0495648_0063498	Ga0495648_0063498_1483_2151	218
380	3300046530	Ga0495654_0000023	Ga0495654_0000023_51345_52013	218
381	3300046542	Ga0495597_0060985	Ga0495597_0060985_338_1006	218
382	3300046616	Ga0495668_0005347	Ga0495668_0005347_5363_6019	218
383	3300046660	Ga0495625_0001472	Ga0495625_0001472_468_1124	218
384	3300046660	Ga0495625_0107598	Ga0495625_0107598_439_1107	218
385	3300046660	Ga0495625_0354530	Ga0495625_0354530_51_719	218
386	3300046691	Ga0495670_0087361	Ga0495670_0087361_478_1146	218
387	3300046692	Ga0495671_0028071	Ga0495671_0028071_1428_2102	218
388	3300046810	Ga0495660_0012126	Ga0495660_0012126_4326_4982	218
389	3300047320	Ga0495672_0000311	Ga0495672_0000311_23872_24540	218
390	3300047323	Ga0495683_0086311	Ga0495683_0086311_722_1378	218
391	3300047446	Ga0495679_013323	Ga0495679_013323_32_700	218
392	3300047469	Ga0495673_0001008	Ga0495673_0001008_6119_6787	218
393	3300047470	Ga0495681_0043583	Ga0495681_0043583_211_867	218
394	3300047470	Ga0495681_0057281	Ga0495681_0057281_380_1054	218
395	3300047472	Ga0495686_0067895	Ga0495686_0067895_1481_2149	218
396	3300047472	Ga0495686_0078038	Ga0495686_0078038_62_730	218
397	3300048909	Ga0496106_0015925	Ga0496106_0015925_2117_2773	218
398	3300048910	Ga0496107_0000112	Ga0496107_0000112_19609_20265	218
399	3300048918	Ga0496115_0009878	Ga0496115_0009878_6083_6748	218
400	3300048924	Ga0496121_0001796	Ga0496121_0001796_19725_20381	218
401	3300048924	Ga0496121_0292447	Ga0496121_0292447_104_787	218
402	3300048927	Ga0496124_0014384	Ga0496124_0014384_3324_4007	218
403	3300053093	Ga0500651_0237573	Ga0500651_0237573_387_1043	218
404	3300053102	Ga0500554_001287	Ga0500554_001287_1182_1850	218
405	3300053104	Ga0500556_0000314	Ga0500556_0000314_14505_15173	218
406	3300053125	Ga0500618_000092	Ga0500618_000092_67567_68235	218
407	3300053134	Ga0500658_0002597	Ga0500658_0002597_3431_4099	218
408	3300053136	Ga0500559_0000046	Ga0500559_0000046_46709_47377	218
409	3300053136	Ga0500559_0001854	Ga0500559_0001854_145_813	218
410	3300053136	Ga0500559_0002680	Ga0500559_0002680_6847_7524	218
411	3300053153	Ga0500616_0068741	Ga0500616_0068741_861_1529	218
412	3300053156	Ga0500622_0005190	Ga0500622_0005190_4116_4808	218
413	3300053156	Ga0500622_0010791	Ga0500622_0010791_1361_2029	218
414	3300053158	Ga0500627_0051129	Ga0500627_0051129_1070_1747	218
415	3300053727	Ga0500611_001212	Ga0500611_001212_787_1455	218
416	3300053730	Ga0500645_001187	Ga0500645_001187_1472_2140	218
417	3300053731	Ga0500609_009655	Ga0500609_009655_624_1280	218
418	iso_pu_bacteria	2884960567	2884961446	218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07021

MetW

Methionine biosynthesis protein MetW

13

207

0.99 PF08241

Methyltransf_11

Methyltransferase domain

30

117

0.9 PF13649

Methyltransf_25

Methyltransferase domain

29

116

0.9 PF13847

Methyltransf_31

Methyltransferase domain

23

121

0.9 PF13489

Methyltransf_23

Methyltransferase domain

11

176

0.75 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6uak-assembly1.cif.gz_A-2	lahsb - c-terminal methyltransferase involved in ripp biosynthesis	0.781	1	111
3cc8-assembly1.cif.gz_A-2	crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution	0.778	8	200
7o4o-assembly1.cif.gz_A	structure of staphylococcus aureus m1a22-trna methyltransferase in complex with s-adenosylhomocysteine	0.7646	1	200
6isv-assembly1.cif.gz_B	structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad	0.758	2	104
6qe6-assembly2.cif.gz_B	structure of m. capricolum trmk in complex with the natural cofactor product s-adenosyl-homocysteine (sah)	0.7544	1	200

ID	Description	Score	Start	End	Superfamily
af_Q50584_122_315_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8874	6	104	3.40.50.150
af_Q9VBZ6_765_943_3.40.50.1010	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease	0.8853	40	63	3.40.50.1010
af_Q54U59_216_375_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8561	18	104	3.40.50.150
af_I6X5U4_8_196_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8554	4	104	3.40.50.150
af_Q80WQ4_26_187_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8433	5	104	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y2JBE9-F1-model_v4	Methionine biosynthesis protein MetW	0.9942	3	68
AF-A0A7X6ZLT5-F1-model_v4	Homoserine O-acetyltransferase (EC 2.3.1.31)	0.9917	3	65	GO:0004414 GO:0009086 GO:0009092
AF-A0A4R9PH07-F1-model_v4	Methionine biosynthesis protein MetW	0.9898	5	65
AF-A0A6N7AMB5-F1-model_v4	SAM-dependent methyltransferase	0.9837	1	104	GO:0008168 GO:0032259
AF-A0A3C0A9P2-F1-model_v4	Methionine biosynthesis protein MetW	0.9825	5	65

Feature Viewer

pLDDT	pTM	Quality
85.11	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F439256

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07021

MetW

Methionine biosynthesis protein MetW

13

207

0.99

PF08241

Methyltransf_11

Methyltransferase domain

30

117

0.9

PF13649

Methyltransf_25

Methyltransferase domain

29

116

0.9

PF13847

Methyltransf_31

Methyltransferase domain

23

121

0.9

PF13489

Methyltransf_23

Methyltransferase domain

11

176

0.75

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map