F439224

General Info

Members Datasets Scaffolds Average Seq Length
418 207 836 153

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10052512|Ga0070666_100525123
Length 174
Sequence MLLDPASRDVRLHFRDMPKLSHYDRAGRATMVDVSTKSVSKREAEASAFIELTPEVLRALPANPKGDPLEVARLAGIMAAKKTSDLIPMCHPLPLSHVDVSIRLCENGVAISSRVTTTAVTGVEMEALVAVSVAALTVYDMCKALDKGIRIREIKLERKSGGKSGDYVRRRKKI

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
95 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.31
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 17.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10052512 3300005335 Unclassified 2747
2 LJNas_1000348 3300000546 Bacteria 8112
3 Ga0065712_10215342 3300005290 Bacteria 1059
4 Ga0065715_10258067 3300005293 Bacteria 1138
5 Ga0070658_10822693 3300005327 Unclassified 807
6 Ga0070683_100059686 3300005329 Bacteria 3544
7 Ga0070683_100087964 3300005329 Bacteria 2914
8 Ga0070683_100127344 3300005329 Unclassified 2408
9 Ga0070670_100008469 3300005331 Bacteria 8772
10 Ga0070670_100157013 3300005331 Unclassified 1971
11 Ga0068869_100012737 3300005334 Bacteria 5562
12 Ga0070680_100117874 3300005336 Bacteria 2214
13 Ga0070682_100176724 3300005337 Bacteria 1488
14 Ga0068868_100000465 3300005338 Bacteria 26992
15 Ga0068868_100021153 3300005338 Unclassified 4899
16 Ga0068868_100043091 3300005338 Bacteria 3525
17 Ga0068868_100871388 3300005338 Bacteria 817
18 Ga0068868_100968611 3300005338 Unclassified 777
19 Ga0070660_100094089 3300005339 Bacteria 2367
20 Ga0070689_100159591 3300005340 Bacteria 1822
21 Ga0070691_10142028 3300005341 Bacteria 1224
22 Ga0070687_100236072 3300005343 Bacteria 1128
23 Ga0070661_100101340 3300005344 Bacteria 2142
24 Ga0070661_100555002 3300005344 Bacteria 924
25 Ga0070675_100619410 3300005354 Bacteria 982
26 Ga0070671_100188748 3300005355 Bacteria 1747
27 Ga0070674_100263349 3300005356 Bacteria 1359
28 Ga0070673_100070923 3300005364 Bacteria 2798
29 Ga0070673_100261146 3300005364 Bacteria 1513
30 Ga0070659_100033114 3300005366 Bacteria 4012
31 Ga0070659_100413315 3300005366 Bacteria 1140
32 Ga0070667_100183324 3300005367 Unclassified 1852
33 Ga0070709_10007937 3300005434 Bacteria 5830
34 Ga0070709_10091456 3300005434 Bacteria 2008
35 Ga0070709_10243369 3300005434 Bacteria 1293
36 Ga0070709_10635496 3300005434 Bacteria 825
37 Ga0070714_100006205 3300005435 Bacteria 9194
38 Ga0070714_100020493 3300005435 Bacteria 5399
39 Ga0070714_100025754 3300005435 Bacteria 4857
40 Ga0070714_100115241 3300005435 Bacteria 2385
41 Ga0070714_100364892 3300005435 Bacteria 1358
42 Ga0070714_100779911 3300005435 Bacteria 925
43 Ga0070714_101155990 3300005435 Bacteria 755
44 Ga0070714_101963190 3300005435 Bacteria 571
45 Ga0070713_100003749 3300005436 Bacteria 10058
46 Ga0070713_100014838 3300005436 Bacteria 5800
47 Ga0070713_100120188 3300005436 Bacteria 2303
48 Ga0070713_100898977 3300005436 Bacteria 852
49 Ga0070710_10012248 3300005437 Bacteria 4254
50 Ga0070710_10077609 3300005437 Unclassified 1931
51 Ga0070711_100000476 3300005439 Bacteria 20852
52 Ga0070711_100629258 3300005439 Bacteria 898
53 Ga0070708_100010243 3300005445 Bacteria 7590
54 Ga0070708_100153292 3300005445 Bacteria 2144
55 Ga0070708_101209148 3300005445 Bacteria 707
56 Ga0070662_100463396 3300005457 Bacteria 1053
57 Ga0070681_10001481 3300005458 Bacteria 20738
58 Ga0070681_10016075 3300005458 Bacteria 7459
59 Ga0070681_10044122 3300005458 Bacteria 4463
60 Ga0070681_10596760 3300005458 Bacteria 1018
61 Ga0068867_100008997 3300005459 Bacteria 7046
62 Ga0070685_10332705 3300005466 Unclassified 1033
63 Ga0070706_100155333 3300005467 Bacteria 2136
64 Ga0070707_100224641 3300005468 Bacteria 1828
65 Ga0070707_100424782 3300005468 Bacteria 1289
66 Ga0070707_100942009 3300005468 Unclassified 828
67 Ga0070698_100090191 3300005471 Bacteria 3049
68 Ga0070699_100005316 3300005518 Bacteria 11297
69 Ga0070679_100002345 3300005530 Bacteria 17137
70 Ga0070679_100033636 3300005530 Bacteria 5076
71 Ga0070679_100039861 3300005530 Bacteria 4670
72 Ga0070679_100063618 3300005530 Bacteria 3677
73 Ga0070679_100242194 3300005530 Unclassified 1761
74 Ga0070679_100275045 3300005530 Bacteria 1637
75 Ga0070684_100083958 3300005535 Unclassified 2823
76 Ga0070684_100138728 3300005535 Bacteria 2198
77 Ga0070697_100001591 3300005536 Bacteria 17329
78 Ga0070697_100006458 3300005536 Bacteria 9078
79 Ga0070697_100011237 3300005536 Bacteria 6998
80 Ga0070697_100023052 3300005536 Bacteria 4950
81 Ga0070697_100032036 3300005536 Bacteria 4228
82 Ga0068853_100911873 3300005539 Unclassified 844
83 Ga0070686_100730248 3300005544 Bacteria 792
84 Ga0070695_100225086 3300005545 Bacteria 1353
85 Ga0070693_100030183 3300005547 Bacteria 2962
86 Ga0070693_100050772 3300005547 Bacteria 2372
87 Ga0068855_100000477 3300005563 Bacteria 49253
88 Ga0068855_100000664 3300005563 Bacteria 41988
89 Ga0068855_100019350 3300005563 Bacteria 8181
90 Ga0068855_100049672 3300005563 Bacteria 4946
91 Ga0068855_101854371 3300005563 Bacteria 612
92 Ga0070664_100000304 3300005564 Bacteria 35664
93 Ga0070664_100211723 3300005564 Bacteria 1732
94 Ga0070664_100278840 3300005564 Bacteria 1507
95 Ga0068857_100008491 3300005577 Bacteria 8879
96 Ga0068857_100021111 3300005577 Bacteria 5730
97 Ga0068857_100072671 3300005577 Unclassified 3065
98 Ga0068854_100023308 3300005578 Unclassified 4227
99 Ga0068854_100028477 3300005578 Bacteria 3861
100 Ga0068854_100029396 3300005578 Bacteria 3804
101 Ga0068856_100000334 3300005614 Bacteria 51590
102 Ga0068856_100000667 3300005614 Bacteria 37242
103 Ga0068856_100001991 3300005614 Bacteria 21304
104 Ga0068856_100250121 3300005614 Bacteria 1788
105 Ga0068856_100561729 3300005614 Bacteria 1162
106 Ga0068852_100027791 3300005616 Bacteria 4617
107 Ga0068852_100088147 3300005616 Bacteria 2771
108 Ga0068852_100203012 3300005616 Unclassified 1876
109 Ga0068852_100693047 3300005616 Bacteria 1028
110 Ga0068859_100023059 3300005617 Bacteria 6242
111 Ga0068864_100012672 3300005618 Bacteria 6970
112 Ga0068864_100264071 3300005618 Bacteria 1602
113 Ga0068866_10001555 3300005718 Bacteria 9752
114 Ga0068866_10199642 3300005718 Unclassified 1194
115 Ga0068861_100269581 3300005719 Bacteria 1461
116 Ga0068870_10015894 3300005840 Bacteria 3583
117 Ga0068863_100044379 3300005841 Bacteria 4220
118 Ga0068863_100287811 3300005841 Bacteria 1593
119 Ga0068863_101277826 3300005841 Bacteria 741
120 Ga0068858_100003363 3300005842 Bacteria 15926
121 Ga0068858_100025554 3300005842 Bacteria 5495
122 Ga0068858_100063571 3300005842 Unclassified 3415
123 Ga0068860_100008186 3300005843 Bacteria 10409
124 Ga0068860_100057629 3300005843 Unclassified 3693
125 Ga0068860_100146847 3300005843 Bacteria 2269
126 Ga0070717_10000800 3300006028 Bacteria 20687
127 Ga0070717_10008127 3300006028 Bacteria 7829
128 Ga0070717_10291519 3300006028 Bacteria 1449
129 Ga0070717_11140892 3300006028 Bacteria 710
130 Ga0070715_10011807 3300006163 Unclassified 3156
131 Ga0070716_100270910 3300006173 Unclassified 1167
132 Ga0070716_100527649 3300006173 Bacteria 876
133 Ga0070712_100003881 3300006175 Bacteria 9207
134 Ga0070712_100319653 3300006175 Bacteria 1262
135 Ga0097621_100000153 3300006237 Bacteria 42702
136 Ga0097621_100000415 3300006237 Bacteria 29789
137 Ga0097621_100000992 3300006237 Bacteria 19954
138 Ga0097621_100021499 3300006237 Bacteria 4993
139 Ga0068871_100000565 3300006358 Bacteria 25303
140 Ga0068871_100000712 3300006358 Bacteria 22517
141 Ga0068871_100000931 3300006358 Bacteria 19542
142 Ga0075428_100762843 3300006844 Bacteria 1029
143 Ga0075434_100002949 3300006871 Bacteria 15125
144 Ga0068865_100009486 3300006881 Bacteria 6037
145 Ga0068865_100291754 3300006881 Unclassified 1302
146 Ga0075436_100160249 3300006914 Bacteria 1586
147 Ga0075436_100587951 3300006914 Bacteria 819
148 Ga0097620_100023059 3300006931 Bacteria 6242
149 Ga0099795_10051319 3300007788 Unclassified 1503
150 Ga0105240_10075270 3300009093 Unclassified 4164
151 Ga0105240_10100353 3300009093 Bacteria 3522
152 Ga0105240_10209712 3300009093 Bacteria 2277
153 Ga0105240_10216677 3300009093 Bacteria 2233
154 Ga0105240_12566410 3300009093 Bacteria 527
155 Ga0105245_10000384 3300009098 Bacteria 41154
156 Ga0105245_10917890 3300009098 Bacteria 918
157 Ga0114129_10064252 3300009147 Bacteria 5122
158 Ga0105241_10057374 3300009174 Bacteria 2987
159 Ga0105241_10086147 3300009174 Unclassified 2470
160 Ga0105241_10087087 3300009174 Unclassified 2457
161 Ga0105241_10330057 3300009174 Unclassified 1318
162 Ga0105241_10751425 3300009174 Bacteria 894
163 Ga0105242_10084569 3300009176 Bacteria 2659
164 Ga0105248_10008650 3300009177 Bacteria 11183
165 Ga0105248_10078001 3300009177 Unclassified 3725
166 Ga0105248_10090708 3300009177 Bacteria 3441
167 Ga0105248_10259934 3300009177 Unclassified 1954
168 Ga0105248_10315374 3300009177 Bacteria 1761
169 Ga0105237_10032816 3300009545 Bacteria 5257
170 Ga0105237_10113017 3300009545 Bacteria 2708
171 Ga0105237_10276364 3300009545 Bacteria 1682
172 Ga0105237_11475351 3300009545 Bacteria 687
173 Ga0105238_10000219 3300009551 Bacteria 63043
174 Ga0105238_10016350 3300009551 Bacteria 7510
175 Ga0105238_10381801 3300009551 Bacteria 1400
176 Ga0099796_10018343 3300010159 Bacteria 2100
177 Ga0105239_10037386 3300010375 Bacteria 5322
178 Ga0105239_10093575 3300010375 Unclassified 3319
179 Ga0105239_10116582 3300010375 Unclassified 2964
180 Ga0105239_11735372 3300010375 Bacteria 723
181 Ga0157373_10070944 3300013100 Bacteria 2462
182 Ga0157373_10092736 3300013100 Bacteria 2127
183 Ga0157373_10120707 3300013100 Unclassified 1842
184 Ga0157369_10000565 3300013105 Bacteria 48680
185 Ga0157369_10035102 3300013105 Bacteria 5500
186 Ga0157369_10039889 3300013105 Bacteria 5130
187 Ga0157369_10078981 3300013105 Unclassified 3525
188 Ga0157369_10561215 3300013105 Bacteria 1180
189 Ga0157374_10000280 3300013296 Bacteria 47309
190 Ga0157374_10000702 3300013296 Bacteria 29423
191 Ga0157374_10002230 3300013296 Bacteria 16325
192 Ga0157374_10025967 3300013296 Bacteria 5266
193 Ga0157374_10223212 3300013296 Bacteria 1849
194 Ga0157378_10000157 3300013297 Bacteria 64384
195 Ga0157378_10000229 3300013297 Bacteria 54489
196 Ga0157378_10000992 3300013297 Bacteria 26009
197 Ga0157378_10015156 3300013297 Bacteria 6749
198 Ga0157378_10041243 3300013297 Bacteria 4094
199 Ga0163162_10055181 3300013306 Bacteria 3999
200 Ga0163162_10302099 3300013306 Bacteria 1733
201 Ga0157372_10001179 3300013307 Bacteria 28254
202 Ga0157372_10002008 3300013307 Bacteria 22106
203 Ga0157372_10003049 3300013307 Bacteria 18055
204 Ga0157372_10034628 3300013307 Bacteria 5554
205 Ga0157372_10040580 3300013307 Bacteria 5141
206 Ga0157372_10269165 3300013307 Bacteria 1979
207 Ga0163163_10198807 3300014325 Bacteria 2053
208 Ga0182008_10041902 3300014497 Bacteria 2282
209 Ga0157377_10196744 3300014745 Bacteria 1277
210 Ga0157379_10142729 3300014968 Bacteria 2159
211 Ga0157376_10170557 3300014969 Unclassified 1981
212 Ga0157376_10195437 3300014969 Bacteria 1858
213 Ga0157376_10778524 3300014969 Bacteria 968
214 Ga0182006_1022385 3300015261 Unclassified 2628
215 Ga0182007_10037286 3300015262 Bacteria 1633
216 Ga0213874_10095823 3300021377 Bacteria 981
217 Ga0224569_100278 3300022732 Bacteria 4306
218 Ga0224571_100383 3300022734 Bacteria 2390
219 Ga0224572_1010833 3300024225 Bacteria 1719
220 Ga0228598_1001050 3300024227 Bacteria 6073
221 Ga0228598_1003343 3300024227 Bacteria 3455
222 Ga0207682_10180495 3300025893 Bacteria 964
223 Ga0207692_10532569 3300025898 Bacteria 749
224 Ga0207642_10097782 3300025899 Bacteria 1466
225 Ga0207680_10080054 3300025903 Unclassified 2051
226 Ga0207647_10050774 3300025904 Bacteria 2566
227 Ga0207699_10067113 3300025906 Bacteria 2180
228 Ga0207699_10474653 3300025906 Bacteria 900
229 Ga0207643_10045293 3300025908 Bacteria 2484
230 Ga0207705_11096505 3300025909 Unclassified 613
231 Ga0207684_10034641 3300025910 Bacteria 4290
232 Ga0207684_10227598 3300025910 Bacteria 1609
233 Ga0207684_10528918 3300025910 Bacteria 1009
234 Ga0207654_10084661 3300025911 Unclassified 1917
235 Ga0207654_10339907 3300025911 Bacteria 1031
236 Ga0207654_10427210 3300025911 Unclassified 925
237 Ga0207707_10000681 3300025912 Bacteria 33712
238 Ga0207707_10027950 3300025912 Bacteria 4932
239 Ga0207695_10007887 3300025913 Bacteria 13438
240 Ga0207695_10153236 3300025913 Bacteria 2242
241 Ga0207695_10395467 3300025913 Bacteria 1267
242 Ga0207671_10031184 3300025914 Bacteria 3972
243 Ga0207671_10040340 3300025914 Unclassified 3456
244 Ga0207693_10163232 3300025915 Bacteria 1753
245 Ga0207663_10393927 3300025916 Bacteria 1058
246 Ga0207660_10049324 3300025917 Bacteria 2983
247 Ga0207657_10033756 3300025919 Bacteria 4609
248 Ga0207649_10126719 3300025920 Bacteria 1729
249 Ga0207652_10020957 3300025921 Bacteria 5391
250 Ga0207652_10021846 3300025921 Bacteria 5286
251 Ga0207652_10027833 3300025921 Unclassified 4714
252 Ga0207652_10235299 3300025921 Bacteria 1651
253 Ga0207646_10075610 3300025922 Unclassified 3009
254 Ga0207694_10001905 3300025924 Bacteria 17287
255 Ga0207694_10146764 3300025924 Bacteria 1899
256 Ga0207694_11529033 3300025924 Bacteria 563
257 Ga0207650_10006405 3300025925 Bacteria 8018
258 Ga0207659_10477189 3300025926 Bacteria 1053
259 Ga0207687_10004670 3300025927 Bacteria 9113
260 Ga0207687_11001026 3300025927 Bacteria 717
261 Ga0207700_10020596 3300025928 Bacteria 4483
262 Ga0207700_10091323 3300025928 Bacteria 2405
263 Ga0207700_10213407 3300025928 Bacteria 1633
264 Ga0207700_10258161 3300025928 Bacteria 1491
265 Ga0207700_10530147 3300025928 Bacteria 1044
266 Ga0207664_10010781 3300025929 Bacteria 6466
267 Ga0207664_10217660 3300025929 Bacteria 1655
268 Ga0207664_10241552 3300025929 Bacteria 1573
269 Ga0207664_10695321 3300025929 Bacteria 914
270 Ga0207644_10478172 3300025931 Bacteria 1026
271 Ga0207690_11059622 3300025932 Bacteria 675
272 Ga0207706_10007827 3300025933 Bacteria 9863
273 Ga0207706_10387448 3300025933 Bacteria 1212
274 Ga0207706_10766034 3300025933 Bacteria 822
275 Ga0207686_10066763 3300025934 Bacteria 2299
276 Ga0207670_10259725 3300025936 Bacteria 1346
277 Ga0207669_10234957 3300025937 Bacteria 1355
278 Ga0207704_10004850 3300025938 Bacteria 6175
279 Ga0207704_10439504 3300025938 Unclassified 1039
280 Ga0207665_10697833 3300025939 Bacteria 798
281 Ga0207711_10016537 3300025941 Bacteria 6127
282 Ga0207711_10170605 3300025941 Unclassified 1974
283 Ga0207711_10812916 3300025941 Bacteria 870
284 Ga0207711_10955352 3300025941 Bacteria 796
285 Ga0207689_10036713 3300025942 Bacteria 4068
286 Ga0207661_10108858 3300025944 Bacteria 2340
287 Ga0207661_10236256 3300025944 Bacteria 1620
288 Ga0207679_10000789 3300025945 Bacteria 20715
289 Ga0207679_10035126 3300025945 Bacteria 3543
290 Ga0207679_10422746 3300025945 Bacteria 1176
291 Ga0207667_10000764 3300025949 Bacteria 41822
292 Ga0207667_10017825 3300025949 Bacteria 7983
293 Ga0207667_10042765 3300025949 Bacteria 4813
294 Ga0207667_10153289 3300025949 Unclassified 2371
295 Ga0207667_10392934 3300025949 Bacteria 1412
296 Ga0207667_11566948 3300025949 Bacteria 628
297 Ga0207651_10241259 3300025960 Bacteria 1473
298 Ga0207651_10289963 3300025960 Bacteria 1356
299 Ga0207640_10003853 3300025981 Bacteria 8094
300 Ga0207640_10029683 3300025981 Bacteria 3359
301 Ga0207640_10044967 3300025981 Unclassified 2833
302 Ga0207640_10187006 3300025981 Bacteria 1558
303 Ga0207658_10151438 3300025986 Unclassified 1890
304 Ga0207677_10003799 3300026023 Bacteria 8020
305 Ga0207677_10005450 3300026023 Bacteria 6908
306 Ga0207677_10043002 3300026023 Unclassified 3001
307 Ga0207677_10342032 3300026023 Bacteria 1250
308 Ga0207703_10013014 3300026035 Bacteria 6483
309 Ga0207703_10018742 3300026035 Bacteria 5406
310 Ga0207703_11105667 3300026035 Unclassified 761
311 Ga0207639_10092987 3300026041 Bacteria 2417
312 Ga0207702_10001773 3300026078 Bacteria 21236
313 Ga0207702_10002987 3300026078 Bacteria 15742
314 Ga0207702_10087803 3300026078 Bacteria 2716
315 Ga0207702_10106864 3300026078 Bacteria 2481
316 Ga0207702_10168453 3300026078 Bacteria 2006
317 Ga0207641_10033924 3300026088 Bacteria 4243
318 Ga0207641_10187291 3300026088 Bacteria 1900
319 Ga0207648_10009875 3300026089 Bacteria 9097
320 Ga0207648_10140263 3300026089 Unclassified 2130
321 Ga0207676_10002632 3300026095 Bacteria 12794
322 Ga0207676_10023956 3300026095 Bacteria 4512
323 Ga0207676_10080678 3300026095 Bacteria 2641
324 Ga0207676_10232203 3300026095 Unclassified 1650
325 Ga0207674_10003318 3300026116 Bacteria 19788
326 Ga0207674_10034148 3300026116 Bacteria 5320
327 Ga0207674_10043435 3300026116 Bacteria 4634
328 Ga0207675_100442123 3300026118 Bacteria 1287
329 Ga0207683_10292247 3300026121 Bacteria 1490
330 Ga0207698_10028935 3300026142 Unclassified 3960
331 Ga0207698_11006438 3300026142 Bacteria 844
332 Ga0209179_1014552 3300027512 Unclassified 1446
333 Ga0265357_1003812 3300028023 Bacteria 1327
334 Ga0268266_10152686 3300028379 Bacteria 2083
335 Ga0268266_10833276 3300028379 Unclassified 891
336 Ga0268264_10053800 3300028381 Bacteria 3359
337 Ga0265770_1004103 3300030878 Bacteria 1984
338 Ga0265760_10001600 3300031090 Bacteria 6659
339 Ga0265760_10016092 3300031090 Bacteria 2145
340 Ga0373930_0140965 3300034816 Unclassified 599
341 Ga0373936_0044227 3300035113 Bacteria 1791
342 Ga0373945_0116710 3300035116 Unclassified 1058
343 Ga0373946_0032360 3300035171 Bacteria 2100
344 Ga0373955_0300578 3300035172 Bacteria 968
345 Ga0373924_0065086 3300035410 Unclassified 1531
346 Ga0373924_0099108 3300035410 Bacteria 1252
347 Ga0373931_0039397 3300035691 Bacteria 2476
348 Ga0373931_0170103 3300035691 Bacteria 1283
349 Ga0373935_0066593 3300035692 Bacteria 2314
350 Ga0373935_0316565 3300035692 Unclassified 1106
351 Ga0373927_0130136 3300035695 Bacteria 1644
352 Ga0373927_0229280 3300035695 Unclassified 1220
353 Ga0373927_0240943 3300035695 Unclassified 1188
354 Ga0373927_1130079 3300035695 Bacteria 517
355 Ga0373933_0334109 3300035724 Unclassified 983
356 Ga0373947_0048813 3300035725 Bacteria 2540
357 Ga0373937_0245265 3300036401 Unclassified 1688
358 Ga0373937_0286151 3300036401 Bacteria 1557
359 Ga0373937_0365621 3300036401 Bacteria 1368
360 Ga0373925_0033519 3300037068 Unclassified 3784
361 Ga0395900_0293443 3300037418 Bacteria 1614
362 Ga0395898_0153351 3300037466 Bacteria 2204
363 Ga0395898_1169328 3300037466 Bacteria 701
364 Ga0395905_0039526 3300037471 Bacteria 4426
365 Ga0395905_0063097 3300037471 Bacteria 3466
366 Ga0395905_0177653 3300037471 Bacteria 1998
367 Ga0395901_0626701 3300038443 Bacteria 1082
368 Ga0436363_0828059 3300039450 Bacteria 1359
369 Ga0466963_0025699 3300044694 Bacteria 3758
370 Ga0466967_0140561 3300045976 Bacteria 2248
371 Ga0495629_0167697 3300046459 Bacteria 1525
372 Ga0495580_0001212 3300046472 Bacteria 22706
373 Ga0495580_0001301 3300046472 Bacteria 22045
374 Ga0495580_0012898 3300046472 Bacteria 6403
375 Ga0495580_0014014 3300046472 Bacteria 6098
376 Ga0495580_0041131 3300046472 Bacteria 3297
377 Ga0495580_0216481 3300046472 Bacteria 1317
378 Ga0495580_0299275 3300046472 Bacteria 1095
379 Ga0495630_0020435 3300046517 Bacteria 4883
380 Ga0495665_0068026 3300046531 Unclassified 1878
381 Ga0495586_0245415 3300046535 Bacteria 1021
382 Ga0495656_0243790 3300046615 Bacteria 906
383 Ga0495635_0599763 3300046663 Unclassified 719
384 Ga0495646_0336197 3300046680 Unclassified 793
385 Ga0495669_0016621 3300046684 Bacteria 3152
386 Ga0495669_0344429 3300046684 Bacteria 720
387 Ga0495674_0022663 3300047319 Bacteria 5790
388 Ga0495674_0089456 3300047319 Unclassified 2632
389 Ga0495674_0705423 3300047319 Bacteria 792
390 Ga0496100_0580655 3300048903 Unclassified 869
391 Ga0496102_0169000 3300048905 Bacteria 2058
392 Ga0496102_0227879 3300048905 Bacteria 1757
393 Ga0496103_0318378 3300048906 Bacteria 1000
394 Ga0496104_0060068 3300048907 Unclassified 3601
395 Ga0496104_0262620 3300048907 Bacteria 1639
396 Ga0496105_0138035 3300048908 Bacteria 2008
397 Ga0496105_0288890 3300048908 Unclassified 1321
398 Ga0496106_0030578 3300048909 Bacteria 4014
399 Ga0496108_0099713 3300048911 Bacteria 2476
400 Ga0496109_0098752 3300048912 Bacteria 2707
401 Ga0496109_1472999 3300048912 Unclassified 616
402 Ga0496110_0161949 3300048913 Bacteria 2028
403 Ga0496111_0241170 3300048914 Bacteria 1342
404 Ga0496112_0011207 3300048915 Bacteria 8177
405 Ga0496112_0079235 3300048915 Unclassified 3249
406 Ga0496112_0121059 3300048915 Bacteria 2586
407 Ga0496112_0384837 3300048915 Bacteria 1343
408 Ga0501067_0190336 3300049583 Bacteria 1143
409 Ga0501069_0867318 3300049585 Bacteria 549
410 Ga0501073_0010534 3300049589 Bacteria 6771
411 Ga0501083_0239538 3300049744 Bacteria 1181
412 nmdc:mga05p37_893174_c1 3300050507 Bacteria 959
413 nmdc:mga08x19_1056781_c1 3300050514 Bacteria 576
414 nmdc:mga08x19_417247_c1 3300050514 Bacteria 942
415 Ga0495601_0012392 3300053077 Bacteria 5115
416 Ga0500590_246033 3300053148 Bacteria 715
417 Ga0501084_0159354 3300054114 Bacteria 1904
418 Ga0501082_0129022 3300060353 Bacteria 2194
419 Ga0070666_10052512
420 LJNas_1000348
421 Ga0065712_10215342
422 Ga0065715_10258067
423 Ga0070658_10822693
424 Ga0070683_100059686
425 Ga0070683_100087964
426 Ga0070683_100127344
427 Ga0070670_100008469
428 Ga0070670_100157013
429 Ga0068869_100012737
430 Ga0070680_100117874
431 Ga0070682_100176724
432 Ga0068868_100000465
433 Ga0068868_100021153
434 Ga0068868_100043091
435 Ga0068868_100871388
436 Ga0068868_100968611
437 Ga0070660_100094089
438 Ga0070689_100159591
439 Ga0070691_10142028
440 Ga0070687_100236072
441 Ga0070661_100101340
442 Ga0070661_100555002
443 Ga0070675_100619410
444 Ga0070671_100188748
445 Ga0070674_100263349
446 Ga0070673_100070923
447 Ga0070673_100261146
448 Ga0070659_100033114
449 Ga0070659_100413315
450 Ga0070667_100183324
451 Ga0070709_10007937
452 Ga0070709_10091456
453 Ga0070709_10243369
454 Ga0070709_10635496
455 Ga0070714_100006205
456 Ga0070714_100020493
457 Ga0070714_100025754
458 Ga0070714_100115241
459 Ga0070714_100364892
460 Ga0070714_100779911
461 Ga0070714_101155990
462 Ga0070714_101963190
463 Ga0070713_100003749
464 Ga0070713_100014838
465 Ga0070713_100120188
466 Ga0070713_100898977
467 Ga0070710_10012248
468 Ga0070710_10077609
469 Ga0070711_100000476
470 Ga0070711_100629258
471 Ga0070708_100010243
472 Ga0070708_100153292
473 Ga0070708_101209148
474 Ga0070662_100463396
475 Ga0070681_10001481
476 Ga0070681_10016075
477 Ga0070681_10044122
478 Ga0070681_10596760
479 Ga0068867_100008997
480 Ga0070685_10332705
481 Ga0070706_100155333
482 Ga0070707_100224641
483 Ga0070707_100424782
484 Ga0070707_100942009
485 Ga0070698_100090191
486 Ga0070699_100005316
487 Ga0070679_100002345
488 Ga0070679_100033636
489 Ga0070679_100039861
490 Ga0070679_100063618
491 Ga0070679_100242194
492 Ga0070679_100275045
493 Ga0070684_100083958
494 Ga0070684_100138728
495 Ga0070697_100001591
496 Ga0070697_100006458
497 Ga0070697_100011237
498 Ga0070697_100023052
499 Ga0070697_100032036
500 Ga0068853_100911873
501 Ga0070686_100730248
502 Ga0070695_100225086
503 Ga0070693_100030183
504 Ga0070693_100050772
505 Ga0068855_100000477
506 Ga0068855_100000664
507 Ga0068855_100019350
508 Ga0068855_100049672
509 Ga0068855_101854371
510 Ga0070664_100000304
511 Ga0070664_100211723
512 Ga0070664_100278840
513 Ga0068857_100008491
514 Ga0068857_100021111
515 Ga0068857_100072671
516 Ga0068854_100023308
517 Ga0068854_100028477
518 Ga0068854_100029396
519 Ga0068856_100000334
520 Ga0068856_100000667
521 Ga0068856_100001991
522 Ga0068856_100250121
523 Ga0068856_100561729
524 Ga0068852_100027791
525 Ga0068852_100088147
526 Ga0068852_100203012
527 Ga0068852_100693047
528 Ga0068859_100023059
529 Ga0068864_100012672
530 Ga0068864_100264071
531 Ga0068866_10001555
532 Ga0068866_10199642
533 Ga0068861_100269581
534 Ga0068870_10015894
535 Ga0068863_100044379
536 Ga0068863_100287811
537 Ga0068863_101277826
538 Ga0068858_100003363
539 Ga0068858_100025554
540 Ga0068858_100063571
541 Ga0068860_100008186
542 Ga0068860_100057629
543 Ga0068860_100146847
544 Ga0070717_10000800
545 Ga0070717_10008127
546 Ga0070717_10291519
547 Ga0070717_11140892
548 Ga0070715_10011807
549 Ga0070716_100270910
550 Ga0070716_100527649
551 Ga0070712_100003881
552 Ga0070712_100319653
553 Ga0097621_100000153
554 Ga0097621_100000415
555 Ga0097621_100000992
556 Ga0097621_100021499
557 Ga0068871_100000565
558 Ga0068871_100000712
559 Ga0068871_100000931
560 Ga0075428_100762843
561 Ga0075434_100002949
562 Ga0068865_100009486
563 Ga0068865_100291754
564 Ga0075436_100160249
565 Ga0075436_100587951
566 Ga0097620_100023059
567 Ga0099795_10051319
568 Ga0105240_10075270
569 Ga0105240_10100353
570 Ga0105240_10209712
571 Ga0105240_10216677
572 Ga0105240_12566410
573 Ga0105245_10000384
574 Ga0105245_10917890
575 Ga0114129_10064252
576 Ga0105241_10057374
577 Ga0105241_10086147
578 Ga0105241_10087087
579 Ga0105241_10330057
580 Ga0105241_10751425
581 Ga0105242_10084569
582 Ga0105248_10008650
583 Ga0105248_10078001
584 Ga0105248_10090708
585 Ga0105248_10259934
586 Ga0105248_10315374
587 Ga0105237_10032816
588 Ga0105237_10113017
589 Ga0105237_10276364
590 Ga0105237_11475351
591 Ga0105238_10000219
592 Ga0105238_10016350
593 Ga0105238_10381801
594 Ga0099796_10018343
595 Ga0105239_10037386
596 Ga0105239_10093575
597 Ga0105239_10116582
598 Ga0105239_11735372
599 Ga0157373_10070944
600 Ga0157373_10092736
601 Ga0157373_10120707
602 Ga0157369_10000565
603 Ga0157369_10035102
604 Ga0157369_10039889
605 Ga0157369_10078981
606 Ga0157369_10561215
607 Ga0157374_10000280
608 Ga0157374_10000702
609 Ga0157374_10002230
610 Ga0157374_10025967
611 Ga0157374_10223212
612 Ga0157378_10000157
613 Ga0157378_10000229
614 Ga0157378_10000992
615 Ga0157378_10015156
616 Ga0157378_10041243
617 Ga0163162_10055181
618 Ga0163162_10302099
619 Ga0157372_10001179
620 Ga0157372_10002008
621 Ga0157372_10003049
622 Ga0157372_10034628
623 Ga0157372_10040580
624 Ga0157372_10269165
625 Ga0163163_10198807
626 Ga0182008_10041902
627 Ga0157377_10196744
628 Ga0157379_10142729
629 Ga0157376_10170557
630 Ga0157376_10195437
631 Ga0157376_10778524
632 Ga0182006_1022385
633 Ga0182007_10037286
634 Ga0213874_10095823
635 Ga0224569_100278
636 Ga0224571_100383
637 Ga0224572_1010833
638 Ga0228598_1001050
639 Ga0228598_1003343
640 Ga0207682_10180495
641 Ga0207692_10532569
642 Ga0207642_10097782
643 Ga0207680_10080054
644 Ga0207647_10050774
645 Ga0207699_10067113
646 Ga0207699_10474653
647 Ga0207643_10045293
648 Ga0207705_11096505
649 Ga0207684_10034641
650 Ga0207684_10227598
651 Ga0207684_10528918
652 Ga0207654_10084661
653 Ga0207654_10339907
654 Ga0207654_10427210
655 Ga0207707_10000681
656 Ga0207707_10027950
657 Ga0207695_10007887
658 Ga0207695_10153236
659 Ga0207695_10395467
660 Ga0207671_10031184
661 Ga0207671_10040340
662 Ga0207693_10163232
663 Ga0207663_10393927
664 Ga0207660_10049324
665 Ga0207657_10033756
666 Ga0207649_10126719
667 Ga0207652_10020957
668 Ga0207652_10021846
669 Ga0207652_10027833
670 Ga0207652_10235299
671 Ga0207646_10075610
672 Ga0207694_10001905
673 Ga0207694_10146764
674 Ga0207694_11529033
675 Ga0207650_10006405
676 Ga0207659_10477189
677 Ga0207687_10004670
678 Ga0207687_11001026
679 Ga0207700_10020596
680 Ga0207700_10091323
681 Ga0207700_10213407
682 Ga0207700_10258161
683 Ga0207700_10530147
684 Ga0207664_10010781
685 Ga0207664_10217660
686 Ga0207664_10241552
687 Ga0207664_10695321
688 Ga0207644_10478172
689 Ga0207690_11059622
690 Ga0207706_10007827
691 Ga0207706_10387448
692 Ga0207706_10766034
693 Ga0207686_10066763
694 Ga0207670_10259725
695 Ga0207669_10234957
696 Ga0207704_10004850
697 Ga0207704_10439504
698 Ga0207665_10697833
699 Ga0207711_10016537
700 Ga0207711_10170605
701 Ga0207711_10812916
702 Ga0207711_10955352
703 Ga0207689_10036713
704 Ga0207661_10108858
705 Ga0207661_10236256
706 Ga0207679_10000789
707 Ga0207679_10035126
708 Ga0207679_10422746
709 Ga0207667_10000764
710 Ga0207667_10017825
711 Ga0207667_10042765
712 Ga0207667_10153289
713 Ga0207667_10392934
714 Ga0207667_11566948
715 Ga0207651_10241259
716 Ga0207651_10289963
717 Ga0207640_10003853
718 Ga0207640_10029683
719 Ga0207640_10044967
720 Ga0207640_10187006
721 Ga0207658_10151438
722 Ga0207677_10003799
723 Ga0207677_10005450
724 Ga0207677_10043002
725 Ga0207677_10342032
726 Ga0207703_10013014
727 Ga0207703_10018742
728 Ga0207703_11105667
729 Ga0207639_10092987
730 Ga0207702_10001773
731 Ga0207702_10002987
732 Ga0207702_10087803
733 Ga0207702_10106864
734 Ga0207702_10168453
735 Ga0207641_10033924
736 Ga0207641_10187291
737 Ga0207648_10009875
738 Ga0207648_10140263
739 Ga0207676_10002632
740 Ga0207676_10023956
741 Ga0207676_10080678
742 Ga0207676_10232203
743 Ga0207674_10003318
744 Ga0207674_10034148
745 Ga0207674_10043435
746 Ga0207675_100442123
747 Ga0207683_10292247
748 Ga0207698_10028935
749 Ga0207698_11006438
750 Ga0209179_1014552
751 Ga0265357_1003812
752 Ga0268266_10152686
753 Ga0268266_10833276
754 Ga0268264_10053800
755 Ga0265770_1004103
756 Ga0265760_10001600
757 Ga0265760_10016092
758 Ga0373930_0140965
759 Ga0373936_0044227
760 Ga0373945_0116710
761 Ga0373946_0032360
762 Ga0373955_0300578
763 Ga0373924_0065086
764 Ga0373924_0099108
765 Ga0373931_0039397
766 Ga0373931_0170103
767 Ga0373935_0066593
768 Ga0373935_0316565
769 Ga0373927_0130136
770 Ga0373927_0229280
771 Ga0373927_0240943
772 Ga0373927_1130079
773 Ga0373933_0334109
774 Ga0373947_0048813
775 Ga0373937_0245265
776 Ga0373937_0286151
777 Ga0373937_0365621
778 Ga0373925_0033519
779 Ga0395900_0293443
780 Ga0395898_0153351
781 Ga0395898_1169328
782 Ga0395905_0039526
783 Ga0395905_0063097
784 Ga0395905_0177653
785 Ga0395901_0626701
786 Ga0436363_0828059
787 Ga0466963_0025699
788 Ga0466967_0140561
789 Ga0495629_0167697
790 Ga0495580_0001212
791 Ga0495580_0001301
792 Ga0495580_0012898
793 Ga0495580_0014014
794 Ga0495580_0041131
795 Ga0495580_0216481
796 Ga0495580_0299275
797 Ga0495630_0020435
798 Ga0495665_0068026
799 Ga0495586_0245415
800 Ga0495656_0243790
801 Ga0495635_0599763
802 Ga0495646_0336197
803 Ga0495669_0016621
804 Ga0495669_0344429
805 Ga0495674_0022663
806 Ga0495674_0089456
807 Ga0495674_0705423
808 Ga0496100_0580655
809 Ga0496102_0169000
810 Ga0496102_0227879
811 Ga0496103_0318378
812 Ga0496104_0060068
813 Ga0496104_0262620
814 Ga0496105_0138035
815 Ga0496105_0288890
816 Ga0496106_0030578
817 Ga0496108_0099713
818 Ga0496109_0098752
819 Ga0496109_1472999
820 Ga0496110_0161949
821 Ga0496111_0241170
822 Ga0496112_0011207
823 Ga0496112_0079235
824 Ga0496112_0121059
825 Ga0496112_0384837
826 Ga0501067_0190336
827 Ga0501069_0867318
828 Ga0501073_0010534
829 Ga0501083_0239538
830 nmdc:mga05p37_893174_c1
831 nmdc:mga08x19_1056781_c1
832 nmdc:mga08x19_417247_c1
833 Ga0495601_0012392
834 Ga0500590_246033
835 Ga0501084_0159354
836 Ga0501082_0129022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

31

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ohd-assembly1.cif.gz_D crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii 0.9748 16 141
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.9676 12 145
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.9604 6 148
3jqj-assembly1.cif.gz_B crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 0.9589 12 156
3jqk-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) 0.9581 13 154
ID Description Score Start End Superfamily
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9676 12 145 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9622 4 155 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9573 16 141 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9537 5 155 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9536 4 155 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A382EVM7-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.989 16 155 GO:0006777
GO:0016829
AF-A0A2V9JT16-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC 0.9887 37 155 GO:0006777
GO:0061799
AF-A0A7V9C274-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9882 16 145 GO:0006777
GO:0061799
AF-A0A1H9H7X9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9869 16 155 GO:0006777
GO:0061799
AF-A0A3B1BGT7-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9864 16 156 GO:0006777
GO:0061798
GO:0061799

Map