F439221

General Info

Members Datasets Scaffolds Average Seq Length
418 230 408 135

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100162265|Ga0070670_1001622652
Length 149
Sequence MTKSRRDYIRLMAIELTQEVSERLSSDNYGWLTTVAKSGQPVPRLVWFYFDGTDVVVYSEPNAAKVRHIKNHPRVSLNLDSDGNGAGIIIIGGIATVDAQGIDPLADERYRAKYDELAASFGFSEEFLAAYNTRLKISIDKVWTTPTEG

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
6 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
7 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
8 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
9 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
10 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
221 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.84
Nodule 0
Rhizoplane 11.48
Rhizosphere 52.39
Stem 0
Stem Tuber 0
Unclassified 10.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10089003 3300003320 Bacteria 2771
2 Ga0055540_1001481 3300003792 Bacteria 13973
3 Ga0055540_1002635 3300003792 Bacteria 9303
4 Ga0055540_1004493 3300003792 Bacteria 6260
5 Ga0070658_10537355 3300005327 Bacteria 1011
6 Ga0070670_100162265 3300005331 Bacteria 1937
7 Ga0068868_100275701 3300005338 Bacteria 1422
8 Ga0070689_100460108 3300005340 Bacteria 1084
9 Ga0070692_10715180 3300005345 Bacteria 675
10 Ga0070668_100004049 3300005347 Bacteria 10851
11 Ga0070668_101075797 3300005347 Bacteria 725
12 Ga0070669_100013274 3300005353 Bacteria 5855
13 Ga0070671_100028266 3300005355 Bacteria 4617
14 Ga0070674_100535920 3300005356 Bacteria 980
15 Ga0070674_100712825 3300005356 Bacteria 859
16 Ga0070673_100485351 3300005364 Bacteria 1116
17 Ga0070659_101025542 3300005366 Bacteria 725
18 Ga0070667_100000582 3300005367 Bacteria 36093
19 Ga0070667_100028841 3300005367 Bacteria 4621
20 Ga0070709_10267370 3300005434 Bacteria 1238
21 Ga0070714_101589967 3300005435 Bacteria 638
22 Ga0070713_100083930 3300005436 Bacteria 2724
23 Ga0070711_101167478 3300005439 Bacteria 665
24 Ga0070663_100170262 3300005455 Bacteria 1683
25 Ga0070678_100334652 3300005456 Bacteria 1297
26 Ga0070685_10010167 3300005466 Bacteria 4885
27 Ga0070679_101902205 3300005530 Bacteria 544
28 Ga0070684_100360763 3300005535 Bacteria 1337
29 Ga0068853_100064787 3300005539 Bacteria 3170
30 Ga0068853_100596285 3300005539 Bacteria 1049
31 Ga0070686_100140209 3300005544 Bacteria 1682
32 Ga0070686_100284971 3300005544 Bacteria 1220
33 Ga0070696_101381622 3300005546 Bacteria 600
34 Ga0070693_100061368 3300005547 Bacteria 2185
35 Ga0070665_100002795 3300005548 Bacteria 18921
36 Ga0070665_100105894 3300005548 Bacteria 2814
37 Ga0068855_100439401 3300005563 Bacteria 1425
38 Ga0068852_100767539 3300005616 Bacteria 977
39 Ga0068859_100003603 3300005617 Bacteria 15790
40 Ga0068864_100116925 3300005618 Bacteria 2380
41 Ga0068866_10730672 3300005718 Bacteria 682
42 Ga0068863_100002822 3300005841 Bacteria 17205
43 Ga0068863_100222342 3300005841 Bacteria 1819
44 Ga0068858_100005156 3300005842 Bacteria 12801
45 Ga0068858_100592500 3300005842 Bacteria 1075
46 Ga0068860_100000016 3300005843 Bacteria 310468
47 Ga0068860_100306007 3300005843 Bacteria 1558
48 Ga0068860_100619741 3300005843 Bacteria 1088
49 Ga0068860_100695642 3300005843 Bacteria 1026
50 Ga0068862_100000051 3300005844 Bacteria 145362
51 Ga0081455_10060197 3300005937 Bacteria 3203
52 Ga0081455_10079850 3300005937 Bacteria 2684
53 Ga0075365_10000705 3300006038 Bacteria 13444
54 Ga0075365_10015788 3300006038 Bacteria 4575
55 Ga0075365_10018736 3300006038 Bacteria 4262
56 Ga0075368_10015011 3300006042 Bacteria 2868
57 Ga0075363_100001263 3300006048 Bacteria 9407
58 Ga0075363_100003824 3300006048 Bacteria 6490
59 Ga0075363_100006656 3300006048 Bacteria 5268
60 Ga0075363_100016444 3300006048 Bacteria 3654
61 Ga0075363_100017873 3300006048 Bacteria 3524
62 Ga0075363_100027392 3300006048 Bacteria 2922
63 Ga0075363_100113376 3300006048 Bacteria 1509
64 Ga0075363_100165182 3300006048 Bacteria 1255
65 Ga0075363_100326346 3300006048 Bacteria 893
66 Ga0075363_100418604 3300006048 Bacteria 789
67 Ga0075364_10001139 3300006051 Bacteria 14196
68 Ga0075364_10014357 3300006051 Bacteria 4893
69 Ga0075364_10017459 3300006051 Bacteria 4484
70 Ga0075364_10048009 3300006051 Bacteria 2781
71 Ga0075364_10077092 3300006051 Bacteria 2200
72 Ga0075364_10170500 3300006051 Bacteria 1471
73 Ga0075364_10220557 3300006051 Bacteria 1287
74 Ga0075364_10468475 3300006051 Bacteria 861
75 Ga0075364_10497855 3300006051 Bacteria 833
76 Ga0070712_101031321 3300006175 Bacteria 712
77 Ga0075362_10006082 3300006177 Bacteria 4470
78 Ga0075362_10018252 3300006177 Bacteria 2900
79 Ga0075362_10022583 3300006177 Bacteria 2652
80 Ga0075362_10256608 3300006177 Bacteria 861
81 Ga0075367_10006553 3300006178 Bacteria 5892
82 Ga0075367_10233422 3300006178 Bacteria 1152
83 Ga0075367_10637133 3300006178 Bacteria 678
84 Ga0075369_10000381 3300006186 Bacteria 13317
85 Ga0075369_10044745 3300006186 Bacteria 1902
86 Ga0075369_10059683 3300006186 Bacteria 1662
87 Ga0075369_10061245 3300006186 Bacteria 1642
88 Ga0075369_10094727 3300006186 Bacteria 1335
89 Ga0075369_10113210 3300006186 Bacteria 1224
90 Ga0075369_10159713 3300006186 Bacteria 1033
91 Ga0075369_10162242 3300006186 Bacteria 1025
92 Ga0075369_10194374 3300006186 Bacteria 935
93 Ga0075366_10364306 3300006195 Bacteria 888
94 Ga0075370_10006823 3300006353 Bacteria 5772
95 Ga0075370_10026962 3300006353 Bacteria 3185
96 Ga0075370_10043723 3300006353 Bacteria 2532
97 Ga0075370_10206680 3300006353 Bacteria 1159
98 Ga0075370_10257339 3300006353 Bacteria 1035
99 Ga0075370_10271473 3300006353 Bacteria 1007
100 Ga0075428_100148796 3300006844 Bacteria 2544
101 Ga0075430_100009778 3300006846 Bacteria 8111
102 Ga0075430_100194012 3300006846 Bacteria 1687
103 Ga0075429_100388893 3300006880 Bacteria 1221
104 Ga0097620_100003604 3300006931 Bacteria 15790
105 Ga0099795_10061536 3300007788 Bacteria 1394
106 Ga0105250_10149916 3300009092 Bacteria 970
107 Ga0111539_10825307 3300009094 Bacteria 1079
108 Ga0105247_10000017 3300009101 Bacteria 260438
109 Ga0105247_10034435 3300009101 Bacteria 3084
110 Ga0114129_10004320 3300009147 Bacteria 20095
111 Ga0105242_11436224 3300009176 Bacteria 719
112 Ga0105248_10000025 3300009177 Bacteria 259691
113 Ga0105248_10043695 3300009177 Bacteria 5025
114 Ga0105237_10000745 3300009545 Bacteria 44856
115 Ga0105238_10212968 3300009551 Bacteria 1908
116 Ga0105238_11050933 3300009551 Bacteria 836
117 Ga0105249_10000021 3300009553 Bacteria 260448
118 Ga0105033_112250 3300009986 Bacteria 759
119 Ga0105239_10001328 3300010375 Bacteria 33299
120 Ga0105239_10165844 3300010375 Bacteria 2470
121 Ga0157371_10594035 3300013102 Unclassified 823
122 Ga0157374_10692247 3300013296 Bacteria 1032
123 Ga0163162_10059117 3300013306 Bacteria 3864
124 Ga0163162_12316661 3300013306 Bacteria 617
125 Ga0157375_10222070 3300013308 Bacteria 2048
126 Ga0163163_10139323 3300014325 Bacteria 2468
127 Ga0163163_10152180 3300014325 Bacteria 2357
128 Ga0157380_10459276 3300014326 Bacteria 1225
129 Ga0157380_11220379 3300014326 Bacteria 796
130 Ga0157377_10069783 3300014745 Bacteria 2028
131 Ga0157379_10273565 3300014968 Bacteria 1536
132 Ga0157379_10401136 3300014968 Bacteria 1261
133 Ga0163161_10241633 3300017792 Bacteria 1404
134 Ga0163161_10342039 3300017792 Bacteria 1187
135 Ga0163161_11387095 3300017792 Bacteria 613
136 Ga0213874_10066160 3300021377 Bacteria 1143
137 Ga0209051_1001752 3300025303 Bacteria 17263
138 Ga0209051_1002406 3300025303 Bacteria 13458
139 Ga0209051_1012294 3300025303 Bacteria 4150
140 Ga0207642_10078364 3300025899 Bacteria 1597
141 Ga0207710_10000033 3300025900 Bacteria 260531
142 Ga0207710_10021480 3300025900 Bacteria 2767
143 Ga0207680_10614711 3300025903 Bacteria 777
144 Ga0207705_10429812 3300025909 Bacteria 1023
145 Ga0207671_10013580 3300025914 Bacteria 6480
146 Ga0207693_10217196 3300025915 Bacteria 1502
147 Ga0207663_10578251 3300025916 Bacteria 881
148 Ga0207657_10525972 3300025919 Bacteria 925
149 Ga0207646_10345437 3300025922 Bacteria 1344
150 Ga0207681_10004635 3300025923 Bacteria 8457
151 Ga0207694_10396907 3300025924 Bacteria 1147
152 Ga0207694_10398584 3300025924 Bacteria 1144
153 Ga0207650_10103542 3300025925 Bacteria 2195
154 Ga0207700_10087887 3300025928 Bacteria 2445
155 Ga0207664_10108065 3300025929 Bacteria 2309
156 Ga0207664_10203698 3300025929 Bacteria 1709
157 Ga0207664_11190039 3300025929 Bacteria 680
158 Ga0207644_10120252 3300025931 Bacteria 1999
159 Ga0207644_10758372 3300025931 Bacteria 811
160 Ga0207690_10685673 3300025932 Bacteria 842
161 Ga0207686_11160377 3300025934 Bacteria 631
162 Ga0207709_10755793 3300025935 Bacteria 782
163 Ga0207669_10047865 3300025937 Bacteria 2536
164 Ga0207665_10143705 3300025939 Bacteria 1704
165 Ga0207711_10000390 3300025941 Bacteria 46512
166 Ga0207711_10069330 3300025941 Bacteria 3056
167 Ga0207667_10404514 3300025949 Bacteria 1390
168 Ga0207712_10000005 3300025961 Bacteria 608697
169 Ga0207668_10001360 3300025972 Bacteria 14447
170 Ga0207658_10001262 3300025986 Bacteria 19997
171 Ga0207658_10048040 3300025986 Bacteria 3127
172 Ga0207658_10408183 3300025986 Bacteria 1195
173 Ga0207703_10030925 3300026035 Bacteria 4232
174 Ga0207703_11215376 3300026035 Bacteria 725
175 Ga0207639_10044745 3300026041 Bacteria 3330
176 Ga0207639_10795011 3300026041 Bacteria 881
177 Ga0207678_10017171 3300026067 Bacteria 6353
178 Ga0207678_10843195 3300026067 Bacteria 810
179 Ga0207641_10001387 3300026088 Bacteria 23866
180 Ga0207641_10003222 3300026088 Bacteria 14583
181 Ga0207641_10303461 3300026088 Bacteria 1509
182 Ga0207676_10364583 3300026095 Bacteria 1340
183 Ga0207683_10355947 3300026121 Bacteria 1344
184 Ga0207683_10650546 3300026121 Bacteria 976
185 Ga0268266_10005558 3300028379 Bacteria 11732
186 Ga0268266_10083342 3300028379 Bacteria 2791
187 Ga0268265_10000022 3300028380 Bacteria 270788
188 Ga0268264_10000005 3300028381 Bacteria 934972
189 Ga0268264_10300980 3300028381 Bacteria 1510
190 Ga0268264_11891241 3300028381 Bacteria 606
191 Ga0307405_10301890 3300031731 Bacteria 1215
192 Ga0307410_10661584 3300031852 Bacteria 877
193 Ga0307410_10778608 3300031852 Bacteria 812
194 Ga0307409_102055095 3300031995 Bacteria 601
195 Ga0307416_100052549 3300032002 Bacteria 3263
196 Ga0307416_101051694 3300032002 Bacteria 918
197 Ga0307416_101140208 3300032002 Bacteria 885
198 Ga0307416_102012688 3300032002 Bacteria 680
199 Ga0307411_10627017 3300032005 Bacteria 928
200 Ga0307411_11066002 3300032005 Bacteria 727
201 Ga0307415_100278018 3300032126 Bacteria 1375
202 Ga0307415_101221246 3300032126 Bacteria 709
203 Ga0316583_10070569 3300032133 Bacteria 1222
204 Ga0316584_0292875 3300036712 Bacteria 1180
205 Ga0395905_1653741 3300037471 Bacteria 545
206 Ga0436365_0842203 3300039437 Bacteria 27860
207 Ga0436363_0273080 3300039450 Bacteria 2589
208 Ga0439461_0014014 3300041410 Bacteria 1518
209 Ga0439466_0008319 3300041411 Bacteria 3910
210 Ga0439466_0010701 3300041411 Bacteria 3408
211 Ga0439466_0018459 3300041411 Bacteria 2502
212 Ga0439465_0013636 3300041413 Bacteria 2532
213 Ga0451789_0507954 3300041443 Bacteria 1747
214 Ga0451793_0140214 3300041452 Bacteria 3381
215 Ga0451793_1750832 3300041452 Bacteria 1024
216 Ga0451797_1329587 3300041453 Bacteria 639
217 Ga0451795_1240608 3300041456 Bacteria 1110
218 Ga0451795_1577984 3300041456 Bacteria 688
219 Ga0451802_1395454 3300041460 Bacteria 888
220 Ga0451802_2023222 3300041460 Bacteria 983
221 Ga0451804_0054343 3300041463 Bacteria 587
222 Ga0451804_0472646 3300041463 Bacteria 696
223 Ga0451807_0725696 3300041486 Bacteria 662
224 Ga0451807_2286951 3300041486 Bacteria 864
225 Ga0451837_0771116 3300041494 Bacteria 724
226 Ga0451841_0745063 3300041498 Bacteria 658
227 Ga0451849_0724616 3300041505 Bacteria 866
228 Ga0451853_1833492 3300041512 Bacteria 850
229 Ga0439431_0022522 3300041997 Bacteria 1519
230 Ga0439431_0046634 3300041997 Bacteria 1115
231 Ga0439445_0009995 3300042004 Bacteria 2240
232 Ga0439445_0038468 3300042004 Bacteria 1265
233 Ga0439434_0008920 3300042435 Bacteria 2946
234 Ga0439434_0103082 3300042435 Bacteria 920
235 Ga0466972_0059163 3300044658 Bacteria 1839
236 Ga0466972_0253690 3300044658 Bacteria 822
237 Ga0466965_0012053 3300044683 Bacteria 4060
238 Ga0466966_0175981 3300044684 Bacteria 1299
239 Ga0466961_0006692 3300044693 Bacteria 7332
240 Ga0466963_0324860 3300044694 Bacteria 1083
241 Ga0466971_0061413 3300044719 Bacteria 1699
242 Ga0466968_0353064 3300044735 Bacteria 715
243 Ga0466968_0561364 3300044735 Bacteria 573
244 Ga0466970_0029435 3300044765 Bacteria 2891
245 Ga0466970_0166746 3300044765 Bacteria 1219
246 Ga0466957_0021395 3300044842 Bacteria 3810
247 Ga0466957_0064206 3300044842 Bacteria 2258
248 Ga0466957_0703052 3300044842 Bacteria 713
249 Ga0466960_0014243 3300044901 Bacteria 3399
250 Ga0466960_0108526 3300044901 Bacteria 1439
251 Ga0466959_0001602 3300045049 Bacteria 13955
252 Ga0466959_0020060 3300045049 Bacteria 4920
253 Ga0466958_0001984 3300045836 Bacteria 10057
254 Ga0466958_0044365 3300045836 Bacteria 2680
255 Ga0466958_0264967 3300045836 Bacteria 1100
256 Ga0466967_0225932 3300045976 Bacteria 1781
257 Ga0466967_0392341 3300045976 Bacteria 1349
258 Ga0466967_0655696 3300045976 Bacteria 1038
259 Ga0466967_1197784 3300045976 Bacteria 757
260 Ga0495638_0008424 3300046460 Bacteria 7314
261 Ga0495638_0034869 3300046460 Bacteria 3211
262 Ga0495606_0040835 3300046507 Bacteria 3115
263 Ga0495597_0280175 3300046542 Bacteria 650
264 Ga0495649_0465117 3300046694 Bacteria 631
265 Ga0495649_0597050 3300046694 Bacteria 545
266 Ga0495649_0651685 3300046694 Bacteria 518
267 Ga0495672_0050100 3300047320 Bacteria 2468
268 Ga0495672_0105235 3300047320 Bacteria 1523
269 Ga0495672_0210055 3300047320 Bacteria 967
270 Ga0495686_0002701 3300047472 Bacteria 16248
271 Ga0495626_0091864 3300048091 Bacteria 1334
272 Ga0496100_0001287 3300048903 Bacteria 12243
273 Ga0496100_0010237 3300048903 Bacteria 5303
274 Ga0496100_0487720 3300048903 Bacteria 948
275 Ga0496101_0000002 3300048904 Bacteria 410971
276 Ga0496101_0000933 3300048904 Bacteria 17243
277 Ga0496101_0026611 3300048904 Bacteria 4022
278 Ga0496101_0044913 3300048904 Bacteria 3163
279 Ga0496102_0000003 3300048905 Bacteria 592263
280 Ga0496102_0000449 3300048905 Bacteria 46890
281 Ga0496102_0051885 3300048905 Bacteria 3736
282 Ga0496102_0102925 3300048905 Bacteria 2655
283 Ga0496102_0266453 3300048905 Bacteria 1615
284 Ga0496103_0000014 3300048906 Bacteria 290397
285 Ga0496103_0000515 3300048906 Bacteria 31901
286 Ga0496104_0015477 3300048907 Bacteria 6908
287 Ga0496104_0026925 3300048907 Bacteria 5315
288 Ga0496105_0009653 3300048908 Bacteria 7555
289 Ga0496105_0080763 3300048908 Bacteria 2686
290 Ga0496106_0006137 3300048909 Bacteria 8888
291 Ga0496106_0137313 3300048909 Bacteria 1921
292 Ga0496107_0001748 3300048910 Bacteria 13670
293 Ga0496107_0011142 3300048910 Bacteria 6256
294 Ga0496108_0511535 3300048911 Bacteria 1048
295 Ga0496108_1388462 3300048911 Bacteria 588
296 Ga0496108_1763989 3300048911 Bacteria 508
297 Ga0496109_0011451 3300048912 Bacteria 7626
298 Ga0496109_0198744 3300048912 Bacteria 1885
299 Ga0496112_0125433 3300048915 Bacteria 2538
300 Ga0496112_1390818 3300048915 Bacteria 616
301 Ga0496113_0007237 3300048916 Bacteria 7115
302 Ga0496113_0168706 3300048916 Bacteria 1733
303 Ga0496113_0290173 3300048916 Bacteria 1309
304 Ga0496114_0000712 3300048917 Bacteria 24721
305 Ga0496115_0016508 3300048918 Bacteria 5624
306 Ga0496115_0280160 3300048918 Bacteria 1369
307 Ga0496115_0428946 3300048918 Bacteria 1070
308 Ga0496116_0000071 3300048919 Bacteria 244521
309 Ga0496116_0024374 3300048919 Bacteria 4477
310 Ga0496117_0000003 3300048920 Bacteria 1881097
311 Ga0496117_0000417 3300048920 Bacteria 71654
312 Ga0496117_0086444 3300048920 Bacteria 2037
313 Ga0496118_0000001 3300048921 Bacteria 1881100
314 Ga0496118_0000350 3300048921 Bacteria 78354
315 Ga0496118_0000604 3300048921 Bacteria 59356
316 Ga0496119_0003282 3300048922 Bacteria 16914
317 Ga0496119_0037686 3300048922 Bacteria 3136
318 Ga0496119_0060564 3300048922 Bacteria 2265
319 Ga0496120_0000157 3300048923 Bacteria 112786
320 Ga0496120_0073290 3300048923 Bacteria 1874
321 Ga0496121_0000019 3300048924 Bacteria 499976
322 Ga0496121_0008927 3300048924 Bacteria 11635
323 Ga0496121_0093145 3300048924 Bacteria 2347
324 Ga0496123_0009580 3300048926 Bacteria 8699
325 Ga0496124_0147534 3300048927 Bacteria 1849
326 Ga0496124_0218427 3300048927 Bacteria 1436
327 Ga0496124_0422504 3300048927 Bacteria 918
328 Ga0496125_0044866 3300048928 Bacteria 3730
329 Ga0496126_0000186 3300048929 Bacteria 140016
330 Ga0496126_0012171 3300048929 Bacteria 8831
331 Ga0496126_0015320 3300048929 Bacteria 7714
332 Ga0496126_0243470 3300048929 Bacteria 1501
333 Ga0496126_0256521 3300048929 Bacteria 1455
334 Ga0501032_0326092 3300049569 Bacteria 990
335 Ga0501033_0907432 3300049570 Bacteria 592
336 Ga0501034_0009569 3300049571 Bacteria 10141
337 Ga0501037_0000984 3300049573 Bacteria 21156
338 Ga0501038_0017689 3300049574 Bacteria 6442
339 Ga0501038_0524481 3300049574 Bacteria 903
340 Ga0501039_0001520 3300049575 Bacteria 17087
341 Ga0501040_0576659 3300049576 Bacteria 812
342 Ga0501043_0004771 3300049579 Bacteria 10986
343 Ga0501070_0008045 3300049586 Bacteria 8925
344 Ga0501070_1030070 3300049586 Bacteria 637
345 Ga0501070_1094516 3300049586 Bacteria 615
346 Ga0501073_0050796 3300049589 Bacteria 2905
347 Ga0501044_0012078 3300049823 Bacteria 9355
348 nmdc:mga03683_134570_c1 3300050489 Bacteria 1108
349 nmdc:mga03683_23353_c1 3300050489 Bacteria 2408
350 nmdc:mga03683_373957_c1 3300050489 Bacteria 677
351 nmdc:mga03683_54766_c1 3300050489 Bacteria 1673
352 nmdc:mga03n38_161210_c1 3300050490 Bacteria 1136
353 nmdc:mga03n38_225843_c1 3300050490 Bacteria 979
354 nmdc:mga03n38_25276_c1 3300050490 Bacteria 2437
355 nmdc:mga03n38_315051_c1 3300050490 Bacteria 843
356 nmdc:mga03n38_339310_c1 3300050490 Bacteria 815
357 nmdc:mga03n38_4282_c1 3300050490 Bacteria 4702
358 nmdc:mga03n38_4927_c1 3300050490 Bacteria 4483
359 nmdc:mga00v17_137325_c1 3300050491 Bacteria 1566
360 nmdc:mga00v17_166222_c1 3300050491 Bacteria 1421
361 nmdc:mga00v17_17921_c1 3300050491 Bacteria 4016
362 nmdc:mga00v17_196576_c1 3300050491 Bacteria 1303
363 nmdc:mga00v17_221830_c1 3300050491 Bacteria 1224
364 nmdc:mga00v17_44398_c1 3300050491 Bacteria 2680
365 nmdc:mga00v17_614_c1 3300050491 Bacteria 19754
366 nmdc:mga00v17_920_c1 3300050491 Bacteria 15828
367 nmdc:mga0yw44_13741_c1 3300050492 Bacteria 4274
368 nmdc:mga0yw44_852_c1 3300050492 Bacteria 11429
369 nmdc:mga0k408_337505_c1 3300050493 Bacteria 899
370 nmdc:mga06z11_226382_c1 3300050494 Bacteria 1094
371 nmdc:mga06z11_4992_c1 3300050494 Bacteria 5273
372 nmdc:mga06z11_534043_c1 3300050494 Bacteria 712
373 nmdc:mga07m45_43201_c1 3300050496 Bacteria 2527
374 nmdc:mga07m45_72153_c2 3300050496 Bacteria 1111
375 nmdc:mga07m45_763_c1 3300050496 Bacteria 13819
376 nmdc:mga05p37_6888_c1 3300050507 Bacteria 13395
377 nmdc:mga09592_337730_c1 3300050508 Bacteria 1304
378 nmdc:mga0qj67_93574_c1 3300050509 Bacteria 2417
379 nmdc:mga0sz30_100603_c1 3300050516 Bacteria 792
380 nmdc:mga0sz30_130966_c1 3300050516 Bacteria 1105
381 nmdc:mga0sz30_179064_c1 3300050516 Bacteria 940
382 nmdc:mga0sz30_184629_c1 3300050516 Bacteria 926
383 nmdc:mga0sz30_329714_c1 3300050516 Bacteria 682
384 nmdc:mga0sz30_343_c1 3300050516 Bacteria 17800
385 nmdc:mga0sz30_63200_c1 3300050516 Bacteria 1584
386 nmdc:mga0sz30_76406_c2 3300050516 Bacteria 809
387 Ga0500610_0053993 3300053079 Bacteria 2095
388 Ga0500635_0044293 3300053080 Bacteria 1500
389 Ga0495655_0017092 3300053083 Bacteria 1574
390 Ga0500643_016794 3300053087 Bacteria 2469
391 Ga0500643_032706 3300053087 Bacteria 1577
392 Ga0500644_0090982 3300053088 Bacteria 1142
393 Ga0500641_0176496 3300053096 Bacteria 918
394 Ga0500556_0011612 3300053104 Bacteria 2611
395 Ga0500562_029716 3300053108 Bacteria 1438
396 Ga0500652_001182 3300053131 Bacteria 8321
397 Ga0500652_074359 3300053131 Bacteria 1411
398 Ga0500652_208193 3300053131 Bacteria 791
399 Ga0500655_063077 3300053133 Bacteria 749
400 Ga0500568_0075804 3300053139 Bacteria 1282
401 Ga0500588_0191024 3300053146 Bacteria 756
402 Ga0500616_0011912 3300053153 Bacteria 5111
403 Ga0500627_0024961 3300053158 Bacteria 2452
404 Ga0500627_0282309 3300053158 Bacteria 728
405 Ga0500633_0093980 3300053160 Bacteria 1098
406 Ga0500645_000361 3300053730 Bacteria 32453
407 Ga0500645_010095 3300053730 Bacteria 3141
408 Ga0466962_0041122 3300061719 Bacteria 2212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0091864 Ga0495626_0091864_926_1315 117
2 3300049570 Ga0501033_0907432 Ga0501033_0907432_192_578 117
3 3300005539 Ga0068853_100064787 Ga0068853_1000647873 118
4 3300026041 Ga0207639_10044745 Ga0207639_100447453 118
5 3300044683 Ga0466965_0012053 Ga0466965_0012053_2115_2525 118
6 3300044684 Ga0466966_0175981 Ga0466966_0175981_830_1240 118
7 3300044693 Ga0466961_0006692 Ga0466961_0006692_6767_7177 118
8 3300044694 Ga0466963_0324860 Ga0466963_0324860_489_899 118
9 3300044735 Ga0466968_0353064 Ga0466968_0353064_158_568 118
10 3300044765 Ga0466970_0029435 Ga0466970_0029435_1400_1810 118
11 3300044842 Ga0466957_0021395 Ga0466957_0021395_2056_2466 118
12 3300044901 Ga0466960_0108526 Ga0466960_0108526_739_1149 118
13 3300045049 Ga0466959_0001602 Ga0466959_0001602_10094_10504 118
14 3300045836 Ga0466958_0001984 Ga0466958_0001984_665_1075 118
15 3300045976 Ga0466967_0655696 Ga0466967_0655696_110_520 118
16 3300047472 Ga0495686_0002701 Ga0495686_0002701_10530_10943 118
17 3300005546 Ga0070696_101381622 Ga0070696_1013816221 119
18 3300005843 Ga0068860_100619741 Ga0068860_1006197412 119
19 3300006175 Ga0070712_101031321 Ga0070712_1010313212 119
20 3300013296 Ga0157374_10692247 Ga0157374_106922471 119
21 3300028381 Ga0268264_11891241 Ga0268264_118912411 119
22 3300013102 Ga0157371_10594035 Ga0157371_105940351 120
23 iso_pu_bacteria 2643221687 2644489930 121
24 iso_pu_bacteria 2643221715 2644635527 121
25 iso_pu_bacteria 2738541274 2738707494 121
26 iso_pu_bacteria 2738543028 2739333990 121
27 iso_pu_bacteria 2902792274 2902793297 121
28 iso_pu_bacteria 2902799365 2902802874 121
29 iso_pu_bacteria 2902810491 2902813474 121
30 iso_pu_bacteria 2902837492 2902841555 121
31 iso_pu_bacteria 2929212328 2929213986 121
32 iso_pu_bacteria 2939582691 2939587785 121
33 3300032133 Ga0316583_10070569 Ga0316583_100705692 122
34 3300036712 Ga0316584_0292875 Ga0316584_0292875_103_519 122
35 3300048929 Ga0496126_0243470 Ga0496126_0243470_702_1112 122
36 3300005356 Ga0070674_100712825 Ga0070674_1007128251 123
37 3300014326 Ga0157380_11220379 Ga0157380_112203792 123
38 3300017792 Ga0163161_10241633 Ga0163161_102416331 123
39 3300025915 Ga0207693_10217196 Ga0207693_102171963 124
40 3300025929 Ga0207664_10108065 Ga0207664_101080653 124
41 3300050490 nmdc:mga03n38_315051_c1 nmdc:mga03n38_315051_c1_66_473 124
42 3300003792 Ga0055540_1001481 Ga0055540_100148113 125
43 3300003792 Ga0055540_1002635 Ga0055540_10026354 125
44 3300003792 Ga0055540_1004493 Ga0055540_10044933 125
45 3300005327 Ga0070658_10537355 Ga0070658_105373551 125
46 3300005338 Ga0068868_100275701 Ga0068868_1002757012 125
47 3300005347 Ga0070668_100004049 Ga0070668_1000040496 125
48 3300005347 Ga0070668_101075797 Ga0070668_1010757972 125
49 3300005353 Ga0070669_100013274 Ga0070669_1000132747 125
50 3300005356 Ga0070674_100535920 Ga0070674_1005359202 125
51 3300005366 Ga0070659_101025542 Ga0070659_1010255421 125
52 3300005367 Ga0070667_100000582 Ga0070667_10000058233 125
53 3300005455 Ga0070663_100170262 Ga0070663_1001702622 125
54 3300005539 Ga0068853_100596285 Ga0068853_1005962852 125
55 3300005547 Ga0070693_100061368 Ga0070693_1000613684 125
56 3300005548 Ga0070665_100105894 Ga0070665_1001058942 125
57 3300005563 Ga0068855_100439401 Ga0068855_1004394012 125
58 3300005616 Ga0068852_100767539 Ga0068852_1007675392 125
59 3300005617 Ga0068859_100003603 Ga0068859_10000360318 125
60 3300005841 Ga0068863_100002822 Ga0068863_1000028226 125
61 3300005842 Ga0068858_100005156 Ga0068858_1000051567 125
62 3300005842 Ga0068858_100592500 Ga0068858_1005925002 125
63 3300005843 Ga0068860_100000016 Ga0068860_100000016202 125
64 3300005844 Ga0068862_100000051 Ga0068862_10000005149 125
65 3300006038 Ga0075365_10018736 Ga0075365_100187364 125
66 3300006048 Ga0075363_100006656 Ga0075363_1000066563 125
67 3300006048 Ga0075363_100017873 Ga0075363_1000178732 125
68 3300006048 Ga0075363_100113376 Ga0075363_1001133762 125
69 3300006051 Ga0075364_10170500 Ga0075364_101705003 125
70 3300006051 Ga0075364_10220557 Ga0075364_102205572 125
71 3300006051 Ga0075364_10468475 Ga0075364_104684752 125
72 3300006051 Ga0075364_10497855 Ga0075364_104978552 125
73 3300006186 Ga0075369_10044745 Ga0075369_100447452 125
74 3300006186 Ga0075369_10059683 Ga0075369_100596832 125
75 3300006186 Ga0075369_10061245 Ga0075369_100612452 125
76 3300006186 Ga0075369_10094727 Ga0075369_100947272 125
77 3300006186 Ga0075369_10162242 Ga0075369_101622422 125
78 3300006186 Ga0075369_10194374 Ga0075369_101943741 125
79 3300006353 Ga0075370_10043723 Ga0075370_100437232 125
80 3300006931 Ga0097620_100003604 Ga0097620_10000360418 125
81 3300009101 Ga0105247_10000017 Ga0105247_10000017223 125
82 3300009177 Ga0105248_10000025 Ga0105248_10000025154 125
83 3300009545 Ga0105237_10000745 Ga0105237_1000074535 125
84 3300009551 Ga0105238_10212968 Ga0105238_102129683 125
85 3300009551 Ga0105238_11050933 Ga0105238_110509332 125
86 3300009553 Ga0105249_10000021 Ga0105249_10000021100 125
87 3300010375 Ga0105239_10001328 Ga0105239_100013282 125
88 3300010375 Ga0105239_10165844 Ga0105239_101658443 125
89 3300013306 Ga0163162_10059117 Ga0163162_100591175 125
90 3300014325 Ga0163163_10152180 Ga0163163_101521804 125
91 3300014745 Ga0157377_10069783 Ga0157377_100697833 125
92 3300014968 Ga0157379_10401136 Ga0157379_104011362 125
93 3300017792 Ga0163161_11387095 Ga0163161_113870952 125
94 3300021377 Ga0213874_10066160 Ga0213874_100661602 125
95 3300025303 Ga0209051_1001752 Ga0209051_10017523 125
96 3300025303 Ga0209051_1002406 Ga0209051_100240612 125
97 3300025303 Ga0209051_1012294 Ga0209051_10122945 125
98 3300025900 Ga0207710_10000033 Ga0207710_1000003342 125
99 3300025909 Ga0207705_10429812 Ga0207705_104298122 125
100 3300025914 Ga0207671_10013580 Ga0207671_100135807 125
101 3300025919 Ga0207657_10525972 Ga0207657_105259722 125
102 3300025923 Ga0207681_10004635 Ga0207681_100046352 125
103 3300025924 Ga0207694_10396907 Ga0207694_103969072 125
104 3300025924 Ga0207694_10398584 Ga0207694_103985841 125
105 3300025932 Ga0207690_10685673 Ga0207690_106856732 125
106 3300025935 Ga0207709_10755793 Ga0207709_107557932 125
107 3300025941 Ga0207711_10000390 Ga0207711_1000039037 125
108 3300025949 Ga0207667_10404514 Ga0207667_104045142 125
109 3300025961 Ga0207712_10000005 Ga0207712_10000005478 125
110 3300025972 Ga0207668_10001360 Ga0207668_100013608 125
111 3300025986 Ga0207658_10001262 Ga0207658_1000126211 125
112 3300026035 Ga0207703_10030925 Ga0207703_100309251 125
113 3300026035 Ga0207703_11215376 Ga0207703_112153762 125
114 3300026041 Ga0207639_10795011 Ga0207639_107950112 125
115 3300026067 Ga0207678_10017171 Ga0207678_100171714 125
116 3300026088 Ga0207641_10003222 Ga0207641_1000322210 125
117 3300026121 Ga0207683_10355947 Ga0207683_103559472 125
118 3300028379 Ga0268266_10083342 Ga0268266_100833426 125
119 3300028380 Ga0268265_10000022 Ga0268265_10000022224 125
120 3300028381 Ga0268264_10000005 Ga0268264_10000005473 125
121 3300031731 Ga0307405_10301890 Ga0307405_103018902 125
122 3300031852 Ga0307410_10661584 Ga0307410_106615842 125
123 3300031852 Ga0307410_10778608 Ga0307410_107786082 125
124 3300031995 Ga0307409_102055095 Ga0307409_1020550951 125
125 3300032002 Ga0307416_101051694 Ga0307416_1010516942 125
126 3300032005 Ga0307411_11066002 Ga0307411_110660022 125
127 3300032126 Ga0307415_101221246 Ga0307415_1012212462 125
128 3300039450 Ga0436363_0273080 Ga0436363_0273080_1115_1528 125
129 3300041410 Ga0439461_0014014 Ga0439461_0014014_485_898 125
130 3300041411 Ga0439466_0008319 Ga0439466_0008319_2916_3329 125
131 3300041411 Ga0439466_0018459 Ga0439466_0018459_1301_1714 125
132 3300041443 Ga0451789_0507954 Ga0451789_0507954_1113_1523 125
133 3300041452 Ga0451793_0140214 Ga0451793_0140214_93_503 125
134 3300041452 Ga0451793_1750832 Ga0451793_1750832_40_453 125
135 3300041453 Ga0451797_1329587 Ga0451797_1329587_128_538 125
136 3300041456 Ga0451795_1240608 Ga0451795_1240608_76_486 125
137 3300041456 Ga0451795_1577984 Ga0451795_1577984_176_589 125
138 3300041460 Ga0451802_1395454 Ga0451802_1395454_327_740 125
139 3300041460 Ga0451802_2023222 Ga0451802_2023222_19_429 125
140 3300041463 Ga0451804_0472646 Ga0451804_0472646_196_609 125
141 3300041486 Ga0451807_0725696 Ga0451807_0725696_83_493 125
142 3300041494 Ga0451837_0771116 Ga0451837_0771116_173_586 125
143 3300041498 Ga0451841_0745063 Ga0451841_0745063_11_424 125
144 3300041505 Ga0451849_0724616 Ga0451849_0724616_127_540 125
145 3300041512 Ga0451853_1833492 Ga0451853_1833492_61_471 125
146 3300041997 Ga0439431_0022522 Ga0439431_0022522_990_1403 125
147 3300041997 Ga0439431_0046634 Ga0439431_0046634_663_1076 125
148 3300042004 Ga0439445_0009995 Ga0439445_0009995_1608_2021 125
149 3300042004 Ga0439445_0038468 Ga0439445_0038468_94_507 125
150 3300042435 Ga0439434_0008920 Ga0439434_0008920_502_915 125
151 3300042435 Ga0439434_0103082 Ga0439434_0103082_458_871 125
152 3300044658 Ga0466972_0059163 Ga0466972_0059163_348_761 125
153 3300044658 Ga0466972_0253690 Ga0466972_0253690_324_737 125
154 3300044719 Ga0466971_0061413 Ga0466971_0061413_297_707 125
155 3300044735 Ga0466968_0561364 Ga0466968_0561364_79_492 125
156 3300044765 Ga0466970_0166746 Ga0466970_0166746_682_1095 125
157 3300044842 Ga0466957_0064206 Ga0466957_0064206_1581_1994 125
158 3300044842 Ga0466957_0703052 Ga0466957_0703052_39_449 125
159 3300044901 Ga0466960_0014243 Ga0466960_0014243_256_669 125
160 3300045049 Ga0466959_0020060 Ga0466959_0020060_4383_4796 125
161 3300045836 Ga0466958_0044365 Ga0466958_0044365_1353_1763 125
162 3300045976 Ga0466967_0225932 Ga0466967_0225932_170_604 125
163 3300045976 Ga0466967_0392341 Ga0466967_0392341_169_582 125
164 3300045976 Ga0466967_1197784 Ga0466967_1197784_119_529 125
165 3300046460 Ga0495638_0008424 Ga0495638_0008424_5849_6262 125
166 3300046460 Ga0495638_0034869 Ga0495638_0034869_2761_3171 125
167 3300046507 Ga0495606_0040835 Ga0495606_0040835_1418_1828 125
168 3300046542 Ga0495597_0280175 Ga0495597_0280175_85_498 125
169 3300046694 Ga0495649_0465117 Ga0495649_0465117_131_544 125
170 3300046694 Ga0495649_0597050 Ga0495649_0597050_13_423 125
171 3300046694 Ga0495649_0651685 Ga0495649_0651685_10_423 125
172 3300047320 Ga0495672_0050100 Ga0495672_0050100_988_1398 125
173 3300047320 Ga0495672_0105235 Ga0495672_0105235_694_1104 125
174 3300047320 Ga0495672_0210055 Ga0495672_0210055_400_810 125
175 3300048903 Ga0496100_0010237 Ga0496100_0010237_3489_3899 125
176 3300048903 Ga0496100_0487720 Ga0496100_0487720_26_439 125
177 3300048904 Ga0496101_0000002 Ga0496101_0000002_326561_326971 125
178 3300048904 Ga0496101_0026611 Ga0496101_0026611_1702_2115 125
179 3300048904 Ga0496101_0044913 Ga0496101_0044913_1355_1768 125
180 3300048905 Ga0496102_0000003 Ga0496102_0000003_51877_52287 125
181 3300048905 Ga0496102_0000449 Ga0496102_0000449_8024_8437 125
182 3300048905 Ga0496102_0102925 Ga0496102_0102925_2198_2608 125
183 3300048906 Ga0496103_0000014 Ga0496103_0000014_238329_238739 125
184 3300048906 Ga0496103_0000515 Ga0496103_0000515_26417_26830 125
185 3300048909 Ga0496106_0137313 Ga0496106_0137313_207_617 125
186 3300048910 Ga0496107_0011142 Ga0496107_0011142_4086_4496 125
187 3300048911 Ga0496108_0511535 Ga0496108_0511535_12_425 125
188 3300048911 Ga0496108_1763989 Ga0496108_1763989_46_456 125
189 3300048912 Ga0496109_0011451 Ga0496109_0011451_787_1200 125
190 3300048915 Ga0496112_0125433 Ga0496112_0125433_110_523 125
191 3300048915 Ga0496112_1390818 Ga0496112_1390818_38_451 125
192 3300048916 Ga0496113_0007237 Ga0496113_0007237_2402_2815 125
193 3300048916 Ga0496113_0168706 Ga0496113_0168706_204_617 125
194 3300048918 Ga0496115_0280160 Ga0496115_0280160_673_1083 125
195 3300048918 Ga0496115_0428946 Ga0496115_0428946_571_984 125
196 3300048919 Ga0496116_0000071 Ga0496116_0000071_51012_51422 125
197 3300048919 Ga0496116_0024374 Ga0496116_0024374_2625_3038 125
198 3300048920 Ga0496117_0000003 Ga0496117_0000003_539977_540387 125
199 3300048920 Ga0496117_0000417 Ga0496117_0000417_44423_44836 125
200 3300048920 Ga0496117_0086444 Ga0496117_0086444_512_922 125
201 3300048921 Ga0496118_0000001 Ga0496118_0000001_539980_540390 125
202 3300048921 Ga0496118_0000350 Ga0496118_0000350_43802_44215 125
203 3300048921 Ga0496118_0000604 Ga0496118_0000604_14281_14691 125
204 3300048922 Ga0496119_0003282 Ga0496119_0003282_3624_4034 125
205 3300048922 Ga0496119_0037686 Ga0496119_0037686_1315_1728 125
206 3300048922 Ga0496119_0060564 Ga0496119_0060564_1445_1855 125
207 3300048923 Ga0496120_0000157 Ga0496120_0000157_60378_60788 125
208 3300048923 Ga0496120_0073290 Ga0496120_0073290_269_682 125
209 3300048924 Ga0496121_0000019 Ga0496121_0000019_61293_61703 125
210 3300048924 Ga0496121_0008927 Ga0496121_0008927_7777_8190 125
211 3300048924 Ga0496121_0093145 Ga0496121_0093145_1924_2334 125
212 3300048926 Ga0496123_0009580 Ga0496123_0009580_6953_7366 125
213 3300048927 Ga0496124_0147534 Ga0496124_0147534_730_1143 125
214 3300048927 Ga0496124_0218427 Ga0496124_0218427_915_1325 125
215 3300048927 Ga0496124_0422504 Ga0496124_0422504_127_540 125
216 3300048928 Ga0496125_0044866 Ga0496125_0044866_2261_2671 125
217 3300048929 Ga0496126_0000186 Ga0496126_0000186_51898_52308 125
218 3300048929 Ga0496126_0012171 Ga0496126_0012171_3759_4172 125
219 3300048929 Ga0496126_0015320 Ga0496126_0015320_956_1369 125
220 3300048929 Ga0496126_0256521 Ga0496126_0256521_607_1017 125
221 3300049569 Ga0501032_0326092 Ga0501032_0326092_388_801 125
222 3300049571 Ga0501034_0009569 Ga0501034_0009569_3481_3894 125
223 3300049573 Ga0501037_0000984 Ga0501037_0000984_13676_14089 125
224 3300049574 Ga0501038_0017689 Ga0501038_0017689_3643_4056 125
225 3300049574 Ga0501038_0524481 Ga0501038_0524481_305_718 125
226 3300049575 Ga0501039_0001520 Ga0501039_0001520_361_774 125
227 3300049576 Ga0501040_0576659 Ga0501040_0576659_317_730 125
228 3300049579 Ga0501043_0004771 Ga0501043_0004771_2164_2577 125
229 3300049586 Ga0501070_0008045 Ga0501070_0008045_6796_7209 125
230 3300049586 Ga0501070_1030070 Ga0501070_1030070_37_450 125
231 3300049589 Ga0501073_0050796 Ga0501073_0050796_687_1100 125
232 3300049823 Ga0501044_0012078 Ga0501044_0012078_3183_3593 125
233 3300050490 nmdc:mga03n38_161210_c1 nmdc:mga03n38_161210_c1_712_1125 125
234 3300050491 nmdc:mga00v17_166222_c1 nmdc:mga00v17_166222_c1_790_1200 125
235 3300050491 nmdc:mga00v17_196576_c1 nmdc:mga00v17_196576_c1_391_804 125
236 3300050491 nmdc:mga00v17_221830_c1 nmdc:mga00v17_221830_c1_514_927 125
237 3300050492 nmdc:mga0yw44_13741_c1 nmdc:mga0yw44_13741_c1_1637_2047 125
238 3300050516 nmdc:mga0sz30_100603_c1 nmdc:mga0sz30_100603_c1_201_611 125
239 3300050516 nmdc:mga0sz30_184629_c1 nmdc:mga0sz30_184629_c1_74_487 125
240 3300050516 nmdc:mga0sz30_63200_c1 nmdc:mga0sz30_63200_c1_401_814 125
241 3300050516 nmdc:mga0sz30_76406_c2 nmdc:mga0sz30_76406_c2_170_580 125
242 3300053079 Ga0500610_0053993 Ga0500610_0053993_1417_1830 125
243 3300053083 Ga0495655_0017092 Ga0495655_0017092_115_528 125
244 3300053087 Ga0500643_016794 Ga0500643_016794_880_1290 125
245 3300053087 Ga0500643_032706 Ga0500643_032706_604_1014 125
246 3300053088 Ga0500644_0090982 Ga0500644_0090982_123_536 125
247 3300053096 Ga0500641_0176496 Ga0500641_0176496_260_670 125
248 3300053104 Ga0500556_0011612 Ga0500556_0011612_1915_2328 125
249 3300053108 Ga0500562_029716 Ga0500562_029716_541_954 125
250 3300053131 Ga0500652_074359 Ga0500652_074359_165_575 125
251 3300053131 Ga0500652_208193 Ga0500652_208193_62_472 125
252 3300053133 Ga0500655_063077 Ga0500655_063077_227_637 125
253 3300053139 Ga0500568_0075804 Ga0500568_0075804_635_1045 125
254 3300053146 Ga0500588_0191024 Ga0500588_0191024_167_577 125
255 3300053153 Ga0500616_0011912 Ga0500616_0011912_450_863 125
256 3300053158 Ga0500627_0024961 Ga0500627_0024961_877_1287 125
257 3300053158 Ga0500627_0282309 Ga0500627_0282309_20_433 125
258 3300053160 Ga0500633_0093980 Ga0500633_0093980_381_791 125
259 3300053730 Ga0500645_000361 Ga0500645_000361_19308_19718 125
260 3300053730 Ga0500645_010095 Ga0500645_010095_2435_2845 125
261 3300061719 Ga0466962_0041122 Ga0466962_0041122_1456_1866 125
262 3300005331 Ga0070670_100162265 Ga0070670_1001622652 126
263 3300005340 Ga0070689_100460108 Ga0070689_1004601081 126
264 3300005345 Ga0070692_10715180 Ga0070692_107151801 126
265 3300005355 Ga0070671_100028266 Ga0070671_1000282663 126
266 3300005364 Ga0070673_100485351 Ga0070673_1004853512 126
267 3300005367 Ga0070667_100028841 Ga0070667_1000288415 126
268 3300005434 Ga0070709_10267370 Ga0070709_102673702 126
269 3300005436 Ga0070713_100083930 Ga0070713_1000839301 126
270 3300005439 Ga0070711_101167478 Ga0070711_1011674781 126
271 3300005456 Ga0070678_100334652 Ga0070678_1003346522 126
272 3300005466 Ga0070685_10010167 Ga0070685_100101674 126
273 3300005530 Ga0070679_101902205 Ga0070679_1019022051 126
274 3300005535 Ga0070684_100360763 Ga0070684_1003607632 126
275 3300005544 Ga0070686_100140209 Ga0070686_1001402092 126
276 3300005544 Ga0070686_100284971 Ga0070686_1002849712 126
277 3300005548 Ga0070665_100002795 Ga0070665_1000027959 126
278 3300005618 Ga0068864_100116925 Ga0068864_1001169252 126
279 3300005718 Ga0068866_10730672 Ga0068866_107306721 126
280 3300005841 Ga0068863_100222342 Ga0068863_1002223422 126
281 3300005843 Ga0068860_100306007 Ga0068860_1003060072 126
282 3300005843 Ga0068860_100695642 Ga0068860_1006956422 126
283 3300005937 Ga0081455_10060197 Ga0081455_100601972 126
284 3300005937 Ga0081455_10079850 Ga0081455_100798502 126
285 3300006038 Ga0075365_10000705 Ga0075365_1000070511 126
286 3300006038 Ga0075365_10015788 Ga0075365_100157885 126
287 3300006042 Ga0075368_10015011 Ga0075368_100150114 126
288 3300006048 Ga0075363_100001263 Ga0075363_1000012634 126
289 3300006048 Ga0075363_100003824 Ga0075363_1000038244 126
290 3300006048 Ga0075363_100016444 Ga0075363_1000164443 126
291 3300006048 Ga0075363_100027392 Ga0075363_1000273922 126
292 3300006048 Ga0075363_100165182 Ga0075363_1001651822 126
293 3300006048 Ga0075363_100326346 Ga0075363_1003263461 126
294 3300006048 Ga0075363_100418604 Ga0075363_1004186041 126
295 3300006051 Ga0075364_10001139 Ga0075364_100011395 126
296 3300006051 Ga0075364_10014357 Ga0075364_100143573 126
297 3300006051 Ga0075364_10017459 Ga0075364_100174593 126
298 3300006051 Ga0075364_10048009 Ga0075364_100480093 126
299 3300006051 Ga0075364_10077092 Ga0075364_100770922 126
300 3300006177 Ga0075362_10006082 Ga0075362_100060823 126
301 3300006177 Ga0075362_10018252 Ga0075362_100182524 126
302 3300006177 Ga0075362_10022583 Ga0075362_100225835 126
303 3300006177 Ga0075362_10256608 Ga0075362_102566082 126
304 3300006178 Ga0075367_10006553 Ga0075367_100065532 126
305 3300006178 Ga0075367_10233422 Ga0075367_102334222 126
306 3300006178 Ga0075367_10637133 Ga0075367_106371331 126
307 3300006186 Ga0075369_10000381 Ga0075369_100003815 126
308 3300006186 Ga0075369_10113210 Ga0075369_101132102 126
309 3300006186 Ga0075369_10159713 Ga0075369_101597132 126
310 3300006195 Ga0075366_10364306 Ga0075366_103643062 126
311 3300006353 Ga0075370_10006823 Ga0075370_100068233 126
312 3300006353 Ga0075370_10026962 Ga0075370_100269624 126
313 3300006353 Ga0075370_10206680 Ga0075370_102066802 126
314 3300006353 Ga0075370_10257339 Ga0075370_102573392 126
315 3300006353 Ga0075370_10271473 Ga0075370_102714732 126
316 3300006844 Ga0075428_100148796 Ga0075428_1001487962 126
317 3300006846 Ga0075430_100009778 Ga0075430_10000977810 126
318 3300006846 Ga0075430_100194012 Ga0075430_1001940122 126
319 3300006880 Ga0075429_100388893 Ga0075429_1003888932 126
320 3300007788 Ga0099795_10061536 Ga0099795_100615363 126
321 3300009092 Ga0105250_10149916 Ga0105250_101499162 126
322 3300009094 Ga0111539_10825307 Ga0111539_108253071 126
323 3300009101 Ga0105247_10034435 Ga0105247_100344354 126
324 3300009147 Ga0114129_10004320 Ga0114129_1000432010 126
325 3300009176 Ga0105242_11436224 Ga0105242_114362241 126
326 3300009177 Ga0105248_10043695 Ga0105248_100436955 126
327 3300009986 Ga0105033_112250 Ga0105033_1122501 126
328 3300013306 Ga0163162_12316661 Ga0163162_123166611 126
329 3300013308 Ga0157375_10222070 Ga0157375_102220702 126
330 3300014325 Ga0163163_10139323 Ga0163163_101393232 126
331 3300014326 Ga0157380_10459276 Ga0157380_104592763 126
332 3300014968 Ga0157379_10273565 Ga0157379_102735653 126
333 3300017792 Ga0163161_10342039 Ga0163161_103420392 126
334 3300025899 Ga0207642_10078364 Ga0207642_100783643 126
335 3300025900 Ga0207710_10021480 Ga0207710_100214804 126
336 3300025903 Ga0207680_10614711 Ga0207680_106147112 126
337 3300025916 Ga0207663_10578251 Ga0207663_105782512 126
338 3300025922 Ga0207646_10345437 Ga0207646_103454372 126
339 3300025925 Ga0207650_10103542 Ga0207650_101035422 126
340 3300025928 Ga0207700_10087887 Ga0207700_100878874 126
341 3300025929 Ga0207664_10203698 Ga0207664_102036982 126
342 3300025931 Ga0207644_10120252 Ga0207644_101202523 126
343 3300025931 Ga0207644_10758372 Ga0207644_107583722 126
344 3300025934 Ga0207686_11160377 Ga0207686_111603771 126
345 3300025937 Ga0207669_10047865 Ga0207669_100478653 126
346 3300025939 Ga0207665_10143705 Ga0207665_101437052 126
347 3300025941 Ga0207711_10069330 Ga0207711_100693304 126
348 3300025986 Ga0207658_10048040 Ga0207658_100480402 126
349 3300025986 Ga0207658_10408183 Ga0207658_104081832 126
350 3300026067 Ga0207678_10843195 Ga0207678_108431951 126
351 3300026088 Ga0207641_10001387 Ga0207641_1000138729 126
352 3300026088 Ga0207641_10303461 Ga0207641_103034612 126
353 3300026095 Ga0207676_10364583 Ga0207676_103645832 126
354 3300026121 Ga0207683_10650546 Ga0207683_106505461 126
355 3300028379 Ga0268266_10005558 Ga0268266_1000555812 126
356 3300028381 Ga0268264_10300980 Ga0268264_103009802 126
357 3300032002 Ga0307416_100052549 Ga0307416_1000525495 126
358 3300032002 Ga0307416_101140208 Ga0307416_1011402081 126
359 3300032002 Ga0307416_102012688 Ga0307416_1020126881 126
360 3300032005 Ga0307411_10627017 Ga0307411_106270172 126
361 3300032126 Ga0307415_100278018 Ga0307415_1002780183 126
362 3300037471 Ga0395905_1653741 Ga0395905_1653741_81_497 126
363 3300039437 Ga0436365_0842203 Ga0436365_0842203_18098_18511 126
364 3300041411 Ga0439466_0010701 Ga0439466_0010701_2771_3187 126
365 3300041413 Ga0439465_0013636 Ga0439465_0013636_1219_1635 126
366 3300041463 Ga0451804_0054343 Ga0451804_0054343_100_516 126
367 3300041486 Ga0451807_2286951 Ga0451807_2286951_270_686 126
368 3300048903 Ga0496100_0001287 Ga0496100_0001287_1432_1848 126
369 3300048904 Ga0496101_0000933 Ga0496101_0000933_1547_1963 126
370 3300048905 Ga0496102_0051885 Ga0496102_0051885_962_1378 126
371 3300048905 Ga0496102_0266453 Ga0496102_0266453_290_706 126
372 3300048907 Ga0496104_0015477 Ga0496104_0015477_4793_5209 126
373 3300048907 Ga0496104_0026925 Ga0496104_0026925_3558_3974 126
374 3300048908 Ga0496105_0009653 Ga0496105_0009653_849_1265 126
375 3300048908 Ga0496105_0080763 Ga0496105_0080763_1511_1927 126
376 3300048909 Ga0496106_0006137 Ga0496106_0006137_1909_2325 126
377 3300048910 Ga0496107_0001748 Ga0496107_0001748_1342_1758 126
378 3300048911 Ga0496108_1388462 Ga0496108_1388462_15_431 126
379 3300048912 Ga0496109_0198744 Ga0496109_0198744_1045_1461 126
380 3300048916 Ga0496113_0290173 Ga0496113_0290173_20_436 126
381 3300048917 Ga0496114_0000712 Ga0496114_0000712_51_467 126
382 3300048918 Ga0496115_0016508 Ga0496115_0016508_1335_1751 126
383 3300049586 Ga0501070_1094516 Ga0501070_1094516_154_570 126
384 3300050489 nmdc:mga03683_134570_c1 nmdc:mga03683_134570_c1_301_717 126
385 3300050489 nmdc:mga03683_23353_c1 nmdc:mga03683_23353_c1_1577_1993 126
386 3300050489 nmdc:mga03683_373957_c1 nmdc:mga03683_373957_c1_226_642 126
387 3300050489 nmdc:mga03683_54766_c1 nmdc:mga03683_54766_c1_267_692 126
388 3300050490 nmdc:mga03n38_225843_c1 nmdc:mga03n38_225843_c1_300_716 126
389 3300050490 nmdc:mga03n38_25276_c1 nmdc:mga03n38_25276_c1_99_515 126
390 3300050490 nmdc:mga03n38_339310_c1 nmdc:mga03n38_339310_c1_62_478 126
391 3300050490 nmdc:mga03n38_4282_c1 nmdc:mga03n38_4282_c1_2630_3046 126
392 3300050490 nmdc:mga03n38_4927_c1 nmdc:mga03n38_4927_c1_3170_3586 126
393 3300050491 nmdc:mga00v17_137325_c1 nmdc:mga00v17_137325_c1_595_1020 126
394 3300050491 nmdc:mga00v17_17921_c1 nmdc:mga00v17_17921_c1_3054_3470 126
395 3300050491 nmdc:mga00v17_44398_c1 nmdc:mga00v17_44398_c1_184_600 126
396 3300050491 nmdc:mga00v17_614_c1 nmdc:mga00v17_614_c1_8229_8645 126
397 3300050491 nmdc:mga00v17_920_c1 nmdc:mga00v17_920_c1_6471_6896 126
398 3300050492 nmdc:mga0yw44_852_c1 nmdc:mga0yw44_852_c1_7286_7702 126
399 3300050493 nmdc:mga0k408_337505_c1 nmdc:mga0k408_337505_c1_298_723 126
400 3300050494 nmdc:mga06z11_226382_c1 nmdc:mga06z11_226382_c1_179_595 126
401 3300050494 nmdc:mga06z11_4992_c1 nmdc:mga06z11_4992_c1_332_757 126
402 3300050494 nmdc:mga06z11_534043_c1 nmdc:mga06z11_534043_c1_211_627 126
403 3300050496 nmdc:mga07m45_43201_c1 nmdc:mga07m45_43201_c1_189_614 126
404 3300050496 nmdc:mga07m45_72153_c2 nmdc:mga07m45_72153_c2_460_876 126
405 3300050496 nmdc:mga07m45_763_c1 nmdc:mga07m45_763_c1_7641_8057 126
406 3300050507 nmdc:mga05p37_6888_c1 nmdc:mga05p37_6888_c1_8753_9169 126
407 3300050508 nmdc:mga09592_337730_c1 nmdc:mga09592_337730_c1_744_1160 126
408 3300050509 nmdc:mga0qj67_93574_c1 nmdc:mga0qj67_93574_c1_1195_1611 126
409 3300050516 nmdc:mga0sz30_130966_c1 nmdc:mga0sz30_130966_c1_620_1036 126
410 3300050516 nmdc:mga0sz30_179064_c1 nmdc:mga0sz30_179064_c1_60_476 126
411 3300050516 nmdc:mga0sz30_329714_c1 nmdc:mga0sz30_329714_c1_35_460 126
412 3300050516 nmdc:mga0sz30_343_c1 nmdc:mga0sz30_343_c1_15362_15778 126
413 3300053080 Ga0500635_0044293 Ga0500635_0044293_436_855 126
414 3300053131 Ga0500652_001182 Ga0500652_001182_2005_2424 126
415 3300003320 rootH2_10089003 rootH2_100890034 127
416 3300005435 Ga0070714_101589967 Ga0070714_1015899671 127
417 3300025929 Ga0207664_11190039 Ga0207664_111900392 127
418 3300045836 Ga0466958_0264967 Ga0466958_0264967_62_478 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

16

101

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7369 4 121
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.7009 7 119
2hq9-assembly1.cif.gz_B crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution 0.6961 4 121
2hq9-assembly1.cif.gz_A crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution 0.6868 8 121
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.6847 4 121
ID Description Score Start End Superfamily
af_O50398_10_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9194 2 123 2.30.110.10
af_O50398_10_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8772 2 123 2.30.110.10
af_A0A2R8Q548_824_944_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7571 18 50 2.30.29.30
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7123 4 127 2.30.110.10
af_Q1L8U8_634_686_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7117 20 47 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A654U7F9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.911 1 127 GO:0005829
GO:0016627
GO:0070967
AF-A0A7I9WZE8-F1-model_v4 deleted 0.9051 3 127
AF-A0A654U7F9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9041 1 127 GO:0005829
GO:0016627
GO:0070967
AF-A0A5C7XLA6-F1-model_v4 TIGR03667 family PPOX class F420-dependent oxidoreductase 0.89 5 123 GO:0005829
GO:0016020
GO:0016627
GO:0070967
AF-A0A7I9WZE8-F1-model_v4 deleted 0.8845 3 127

Feature Viewer

pLDDT pTM Quality
84.68 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map