F439182

General Info

Members Datasets Scaffolds Average Seq Length
417 368 834 133

Family's Representative Sequence

Representative Sequence 3300059492|Ga0587073_0118813|Ga0587073_0118813_65_535
Length 156
Sequence MYLIDTNVISEARRGTAEATSWLRTADPSTVYLSVITLGEVMRGIALKRKSDPRAAAHLEEWLRKLRHDHSSRILPITDQIAVEWGRIAALRPRGDADGLIAATAIVHDLIVVTRNVDDFDDTGVSVINPWDQASYCWLGSLGKAQSIGSLPCSAR

Samples

Sample ID Description Type Environment
1 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
45 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
51 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
52 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
171 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
184 2509276019 Ensifer aridi TW10 Isolate Nodule
185 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
186 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
187 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
188 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
189 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
190 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
191 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
192 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
193 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
194 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
195 2516143018 Ensifer sp. BR816 Isolate Nodule
196 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
197 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
198 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
199 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
200 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
201 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
202 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
203 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
204 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
205 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
206 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
207 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
208 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
209 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
210 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
211 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
212 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
213 2643221582 Rhizobium sp. Root651 Isolate Unclassified
214 2643221607 Rhizobium sp. Root73 Isolate Unclassified
215 2643221618 Ensifer sp. Root231 Isolate Unclassified
216 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
217 2643221655 Ensifer sp. Root1252 Isolate Unclassified
218 2643221659 Ensifer sp. Root127 Isolate Unclassified
219 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
220 2643221698 Ensifer sp. Root142 Isolate Unclassified
221 2643221712 Ensifer sp. Root258 Isolate Unclassified
222 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
223 2718217927 Rhizobium sp. N324 Isolate Nodule
224 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
225 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
226 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
227 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
228 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
229 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
230 2718218423 Rhizobium sp. N941 Isolate Nodule
231 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
232 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
233 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
234 2721755809 Rhizobium sp. N541 Isolate Nodule
235 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
236 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
237 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
238 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
239 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
240 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
241 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
242 2791355256 Rhizobium sp. M10 Isolate Nodule
243 2791355260 Rhizobium sp. L9 Isolate Nodule
244 2791355262 Rhizobium sp. M1 Isolate Nodule
245 2791355263 Rhizobium chutanense C5 Isolate Nodule
246 2791355265 Rhizobium sp. H4 Isolate Nodule
247 2791355267 Rhizobium sp. L18 Isolate Nodule
248 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
249 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
250 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
251 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
252 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
253 2838048938 Rhizobium pisi 27/80 Isolate Nodule
254 2838061910 Rhizobium phaseoli L15 Isolate Nodule
255 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
256 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
257 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
258 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
259 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
260 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
261 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
262 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
263 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
264 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
265 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
266 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
267 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
268 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
269 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
270 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
271 2844163670 Ensifer sp. 1H6 Isolate Unclassified
272 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
273 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
274 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
275 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
276 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
277 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
278 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
279 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
280 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
281 2904699407
282 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
283 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
284 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
285 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
286 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
287 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
288 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
289 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
290 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
291 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
292 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
293 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
294 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
295 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
296 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
297 2933599457 Rhizobium phaseoli M3 Isolate Nodule
298 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
299 2936381700 Rhizobium chutanense C16 Isolate Unclassified
300 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
301 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
302 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
303 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
304 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
305 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
306 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
307 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
308 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
309 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
310 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
311 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
312 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
313 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
314 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
315 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
316 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
317 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
318 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
319 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
320 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
321 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
322 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
323 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
324 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
325 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
326 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
327 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
328 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
329 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
330 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
331 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
332 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
333 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
334 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
335 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
336 2996887358 Rhizobium sp. R711 Isolate Nodule
337 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
338 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
339 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
340 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
341 8005258706 Rhizobium sp. R693 Isolate Nodule
342 8005275841 Rhizobium sp. N4311 Isolate Nodule
343 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
344 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
345 8005321885 Rhizobium sp. R72 Isolate Nodule
346 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
347 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
348 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
349 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
350 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
351 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
352 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
353 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
354 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
355 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
356 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
357 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
358 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
359 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
360 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
361 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
362 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
363 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
364 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
365 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
366 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
367 8056382006 Rhizobium croatiense 13T Isolate Nodule
368 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.33
Metatranscriptomes 1.2
Isolates 44.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.83
Nodule 38.37
Rhizoplane 2.4
Rhizosphere 24.94
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587073_0118813 3300059492 Bacteria 711
2 JGI25155J39150_1000065 3300002704 Bacteria 69464
3 JGI25156J39149_1000144 3300002705 Bacteria 52681
4 JGI25154J39366_1000035 3300002738 Bacteria 172224
5 JGI25154J39366_1000201 3300002738 Bacteria 43222
6 JGI25157J39369_1000051 3300002741 Bacteria 111770
7 JGI25152J39213_1014044 3300002773 Bacteria 1639
8 JGI25152J39213_1015763 3300002773 Bacteria 1481
9 JGI25150J39212_1007233 3300002774 Bacteria 2240
10 JGI25159J45721_1003644 3300002987 Bacteria 5356
11 JGI25151J46595_10035151 3300003187 Bacteria 1907
12 JGI25153J46596_10034834 3300003215 Bacteria 1639
13 JGI25153J46596_10039250 3300003215 Bacteria 1481
14 rootH2_10055394 3300003320 Bacteria 1340
15 rootH1_10132254 3300003323 Bacteria 3604
16 rootH1_10206075 3300003323 Bacteria 1409
17 Ga0055524_1034074 3300003775 Bacteria 1415
18 Ga0055540_1000251 3300003792 Bacteria 48933
19 Ga0065165_1001054 3300005262 Bacteria 33088
20 Ga0070675_100600087 3300005354 Bacteria 998
21 Ga0070667_101154911 3300005367 Bacteria 724
22 Ga0070714_101458962 3300005435 Bacteria 668
23 Ga0070711_100338226 3300005439 Bacteria 1207
24 Ga0070711_100625905 3300005439 Bacteria 900
25 Ga0070663_101057206 3300005455 Bacteria 708
26 Ga0070679_100017174 3300005530 Bacteria 6999
27 Ga0068855_101793190 3300005563 Bacteria 624
28 Ga0068862_101806760 3300005844 Bacteria 620
29 Ga0075365_10013531 3300006038 Bacteria 4885
30 Ga0075363_100189308 3300006048 Bacteria 1173
31 Ga0075363_100302062 3300006048 Bacteria 929
32 Ga0075364_10533401 3300006051 Bacteria 802
33 Ga0075367_10001996 3300006178 Bacteria 9089
34 Ga0075367_10680214 3300006178 Bacteria 654
35 Ga0075369_10216871 3300006186 Bacteria 885
36 Ga0075366_10324242 3300006195 Bacteria 944
37 Ga0075370_10303583 3300006353 Bacteria 949
38 Ga0075370_10649773 3300006353 Bacteria 640
39 Ga0075436_100000646 3300006914 Bacteria 22924
40 Ga0079104_1050954 3300006946 Bacteria 922
41 Ga0099826_10016292 3300006948 Bacteria 5611
42 Ga0099795_10054329 3300007788 Bacteria 1468
43 Ga0105240_10032865 3300009093 Bacteria 6710
44 Ga0099796_10016278 3300010159 Bacteria 2192
45 Ga0157326_1088156 3300012513 Bacteria 518
46 Ga0157370_10042498 3300013104 Bacteria 4380
47 Ga0157378_10723492 3300013297 Bacteria 1016
48 Ga0182008_10245785 3300014497 Bacteria 922
49 Ga0182007_10123797 3300015262 Bacteria 866
50 Ga0206351_10899888 3300020077 Bacteria 751
51 Ga0154015_1013198 3300020610 Bacteria 931
52 Ga0214542_1012849 3300021321 Bacteria 10487
53 Ga0214543_1000351 3300021327 Bacteria 74129
54 Ga0213872_10226214 3300021361 Bacteria 795
55 Ga0213874_10039467 3300021377 Bacteria 1406
56 Ga0213876_10001757 3300021384 Bacteria 13138
57 Ga0213876_10066791 3300021384 Bacteria 1898
58 Ga0213875_10001460 3300021388 Bacteria 15303
59 Ga0228711_1013562 3300022739 Bacteria 9527
60 Ga0228710_1008252 3300022740 Bacteria 15010
61 Ga0209435_100005 3300025206 Bacteria 573745
62 Ga0209563_101969 3300025230 Bacteria 4940
63 Ga0207425_1001342 3300025245 Bacteria 10548
64 Ga0207425_1018171 3300025245 Bacteria 1530
65 Ga0209646_1000011 3300025246 Bacteria 573745
66 Ga0209026_1000008 3300025250 Bacteria 573745
67 Ga0209148_1013759 3300025254 Bacteria 1445
68 Ga0209759_1000004 3300025256 Bacteria 573745
69 Ga0209129_1002380 3300025258 Bacteria 9255
70 Ga0209129_1008435 3300025258 Bacteria 2866
71 Ga0209673_1000974 3300025273 Bacteria 35340
72 Ga0209130_1000264 3300025284 Bacteria 65849
73 Ga0209676_1042314 3300025292 Bacteria 1266
74 Ga0209025_1007184 3300025294 Bacteria 8404
75 Ga0209025_1016089 3300025294 Bacteria 4451
76 Ga0209025_1043197 3300025294 Bacteria 1903
77 Ga0209758_1005800 3300025297 Bacteria 9254
78 Ga0209758_1008021 3300025297 Bacteria 6980
79 Ga0209758_1017894 3300025297 Bacteria 3502
80 Ga0209050_1006652 3300025298 Bacteria 6766
81 Ga0209256_1000175 3300025299 Bacteria 127671
82 Ga0209256_1000212 3300025299 Bacteria 109885
83 Ga0207426_1002562 3300025302 Bacteria 11373
84 Ga0207426_1010432 3300025302 Bacteria 3602
85 Ga0209051_1000127 3300025303 Bacteria 142254
86 Ga0209051_1032040 3300025303 Bacteria 2011
87 Ga0209257_1002379 3300025304 Bacteria 18851
88 Ga0209257_1003156 3300025304 Bacteria 14688
89 Ga0209257_1021341 3300025304 Bacteria 2356
90 Ga0207707_10124368 3300025912 Bacteria 2255
91 Ga0207695_10006048 3300025913 Bacteria 15796
92 Ga0207663_10507509 3300025916 Bacteria 937
93 Ga0207652_10036811 3300025921 Bacteria 4139
94 Ga0207667_11525090 3300025949 Bacteria 639
95 Ga0207668_10414559 3300025972 Bacteria 1142
96 Ga0207640_10162863 3300025981 Bacteria 1652
97 Ga0207678_11066642 3300026067 Bacteria 715
98 Ga0209281_1038134 3300027111 Bacteria 822
99 Ga0209371_1015926 3300027312 Bacteria 2000
100 Ga0209179_1103056 3300027512 Unclassified 636
101 Ga0209282_1034690 3300027666 Bacteria 3064
102 Ga0268265_11961812 3300028380 Bacteria 592
103 Ga0307515_10265411 3300028794 Bacteria 1446
104 Ga0265338_10003658 3300028800 Bacteria 21412
105 Ga0268256_1018949 3300030500 Bacteria 1897
106 Ga0265330_10088661 3300031235 Bacteria 1329
107 Ga0307513_10331441 3300031456 Bacteria 1276
108 Ga0307513_10958440 3300031456 Bacteria 564
109 Ga0307508_10004137 3300031616 Bacteria 14283
110 Ga0307405_10004399 3300031731 Bacteria 6657
111 Ga0307406_10205824 3300031901 Bacteria 1452
112 Ga0307412_10415601 3300031911 Bacteria 1099
113 Ga0307416_101669240 3300032002 Bacteria 742
114 Ga0307510_10476358 3300033180 Unclassified 690
115 Ga0436365_0396709 3300039437 Bacteria 84982
116 Ga0436365_0725938 3300039437 Bacteria 912
117 Ga0436365_1389296 3300039437 Unclassified 928
118 Ga0436360_0461768 3300039438 Unclassified 1063
119 Ga0436360_0478326 3300039438 Unclassified 915
120 Ga0436361_0156209 3300039447 Unclassified 1286
121 Ga0436361_1134239 3300039447 Bacteria 1267
122 Ga0436363_0229077 3300039450 Bacteria 1035
123 Ga0436363_0236160 3300039450 Bacteria 7769
124 Ga0436362_0532755 3300039453 Bacteria 7119
125 Ga0439436_0111941 3300041404 Bacteria 762
126 Ga0439439_0136180 3300041406 Bacteria 691
127 Ga0451837_0249830 3300041494 Bacteria 1329
128 Ga0451839_0967207 3300041496 Bacteria 2551
129 Ga0451841_0504411 3300041498 Bacteria 2425
130 Ga0451841_1134976 3300041498 Bacteria 938
131 Ga0451849_0195575 3300041505 Bacteria 1113
132 Ga0451849_0788698 3300041505 Bacteria 1177
133 Ga0451851_0185205 3300041507 Bacteria 671
134 Ga0451851_0690652 3300041507 Bacteria 1534
135 Ga0451843_0091176 3300041509 Bacteria 1947
136 Ga0451855_0515309 3300041511 Bacteria 1113
137 Ga0439462_0048554 3300042015 Bacteria 1138
138 Ga0466966_0039222 3300044684 Bacteria 3051
139 Ga0466963_0476797 3300044694 Bacteria 881
140 Ga0466970_0032130 3300044765 Bacteria 2773
141 Ga0466957_0067592 3300044842 Bacteria 2205
142 Ga0466967_1543591 3300045976 Bacteria 661
143 Ga0495638_0220718 3300046460 Bacteria 1060
144 Ga0495650_0081050 3300046471 Bacteria 1251
145 Ga0495585_0486901 3300046492 Bacteria 587
146 Ga0495607_0105827 3300046501 Bacteria 1499
147 Ga0495606_0055284 3300046507 Bacteria 2568
148 Ga0495610_0000628 3300046512 Bacteria 34953
149 Ga0495620_0043002 3300046515 Bacteria 1970
150 Ga0495631_0227851 3300046518 Bacteria 795
151 Ga0495632_0034117 3300046519 Bacteria 2607
152 Ga0495643_0015099 3300046522 Bacteria 4576
153 Ga0495648_0052483 3300046524 Bacteria 2476
154 Ga0495648_0416661 3300046524 Unclassified 596
155 Ga0495663_0337657 3300046525 Bacteria 547
156 Ga0495633_0243433 3300046558 Bacteria 821
157 Ga0495668_0053352 3300046616 Bacteria 2235
158 Ga0495668_0344590 3300046616 Bacteria 818
159 Ga0495625_0286773 3300046660 Bacteria 1058
160 Ga0495625_0495225 3300046660 Bacteria 748
161 Ga0495588_0283699 3300046674 Bacteria 873
162 Ga0495681_0130046 3300047470 Bacteria 1072
163 Ga0495686_0000422 3300047472 Bacteria 66571
164 Ga0495686_0005749 3300047472 Bacteria 9693
165 Ga0495615_0194834 3300048090 Bacteria 623
166 Ga0496100_0630300 3300048903 Bacteria 834
167 Ga0496100_0731948 3300048903 Bacteria 773
168 Ga0496101_0243445 3300048904 Bacteria 1400
169 Ga0496102_0151259 3300048905 Bacteria 2181
170 Ga0496104_0475401 3300048907 Bacteria 1161
171 Ga0496106_0870866 3300048909 Bacteria 712
172 Ga0496110_0388193 3300048913 Bacteria 1272
173 Ga0496114_0021635 3300048917 Bacteria 5234
174 Ga0496114_0377619 3300048917 Bacteria 1255
175 Ga0496116_0011612 3300048919 Bacteria 7269
176 Ga0496116_0237415 3300048919 Bacteria 919
177 Ga0496116_0288119 3300048919 Bacteria 790
178 Ga0496117_0049319 3300048920 Bacteria 2996
179 Ga0496118_0006700 3300048921 Bacteria 12555
180 Ga0496118_0139290 3300048921 Bacteria 1542
181 Ga0496119_0352774 3300048922 Bacteria 712
182 Ga0496122_0113682 3300048925 Bacteria 1768
183 Ga0496124_0090889 3300048927 Bacteria 2489
184 Ga0496125_0252208 3300048928 Bacteria 1112
185 Ga0496126_0043450 3300048929 Bacteria 4146
186 Ga0496126_0243387 3300048929 Bacteria 1502
187 Ga0496126_0492326 3300048929 Bacteria 981
188 Ga0495678_172740 3300049459 Bacteria 682
189 Ga0495682_0146982 3300049460 Bacteria 841
190 Ga0501031_0009373 3300049568 Bacteria 6364
191 Ga0501032_0198841 3300049569 Bacteria 1308
192 Ga0501033_0132342 3300049570 Bacteria 1806
193 Ga0501033_0189554 3300049570 Bacteria 1472
194 Ga0501034_0030728 3300049571 Bacteria 5459
195 Ga0501034_0090140 3300049571 Bacteria 3064
196 Ga0501034_0293788 3300049571 Bacteria 1562
197 Ga0501036_0074558 3300049572 Bacteria 2870
198 Ga0501037_0220023 3300049573 Bacteria 1336
199 Ga0501043_0044549 3300049579 Bacteria 3488
200 Ga0501043_0292630 3300049579 Bacteria 1246
201 Ga0501047_1269764 3300049581 Bacteria 550
202 Ga0501048_0356640 3300049582 Bacteria 1043
203 Ga0501070_0423313 3300049586 Bacteria 1075
204 Ga0501035_0011819 3300049822 Bacteria 8085
205 Ga0501035_0092228 3300049822 Bacteria 2665
206 Ga0501044_0165143 3300049823 Bacteria 2188
207 Ga0501044_1178511 3300049823 Unclassified 634
208 nmdc:mga03n38_204209_c1 3300050490 Bacteria 1024
209 nmdc:mga03n38_936982_c1 3300050490 Bacteria 510
210 nmdc:mga00v17_408787_c1 3300050491 Bacteria 882
211 nmdc:mga0yw44_23629_c1 3300050492 Bacteria 3466
212 nmdc:mga06z11_6328_c1 3300050494 Bacteria 2975
213 nmdc:mga07m45_825305_c1 3300050496 Unclassified 531
214 nmdc:mga08x19_98_c1 3300050514 Bacteria 77403
215 nmdc:mga0sz30_253014_c1 3300050516 Bacteria 784
216 Ga0500556_0029532 3300053104 Bacteria 1850
217 Ga0500569_240354 3300053109 Bacteria 615
218 Ga0500607_088103 3300053121 Bacteria 1568
219 Ga0500655_006977 3300053133 Bacteria 2030
220 Ga0500658_0116085 3300053134 Bacteria 1183
221 Ga0500573_0005140 3300053140 Bacteria 6980
222 Ga0500590_022899 3300053148 Bacteria 3245
223 Ga0500622_0000609 3300053156 Bacteria 32500
224 Ga0500622_0072794 3300053156 Bacteria 1734
225 Ga0500624_014140 3300053157 Bacteria 1204
226 Ga0500627_0025651 3300053158 Bacteria 2425
227 Ga0500627_0165251 3300053158 Bacteria 998
228 Ga0500634_0006542 3300053161 Bacteria 5650
229 Ga0500636_0013086 3300053177 Bacteria 4868
230 Ga0587080_028737 3300059503 Bacteria 956
231 Ga0587067_048263 3300059640 Bacteria 852
232 2509111249 2508501122 Bacteria 6292184
233 2509379924 2509276019 Bacteria 6802256
234 2510137674 2510065019 Bacteria 6903379
235 2510307419 2510065057 Bacteria 6649661
236 2510893496 2510461076 Bacteria 8618824
237 2513571722 2513237084 Bacteria 7231967
238 2513621300 2513237091 Bacteria 6900273
239 2513712588 2513237103 Bacteria 7647401
240 2513867666 2513237138 Bacteria 7368160
241 2515109250 2515075009 Bacteria 7288508
242 2515641683 2515154114 Bacteria 7848616
243 2515659045 2515154116 Bacteria 7552979
244 2516207442 2516143018 Bacteria 6951533
245 2516897947 2516653046 Bacteria 6989037
246 2517042384 2516653077 Bacteria 7555578
247 2517099442 2517093000 Bacteria 7412387
248 2517411919 2517287029 Bacteria 6905599
249 2517567844 2517487022 Bacteria 7227575
250 2524459089 2524023209 Bacteria 6679728
251 2524541798 2524023228 Bacteria 10118060
252 2528856493 2528768022 Bacteria 10457665
253 2551714836 2551306089 Bacteria 7162724
254 2551730755 2551306091 Bacteria 7086830
255 2558864894 2558860100 Bacteria 8458965
256 2585168979 2582581283 Bacteria 6030556
257 2585330995 2582581316 Bacteria 7774528
258 2585396307 2582581866 Bacteria 6859583
259 2599722989 2599185236 Bacteria 6875203
260 2616554693 2615840698 Bacteria 7319877
261 2617386796 2617270742 Bacteria 6808054
262 2643919688 2643221582 Bacteria 5804683
263 2644051281 2643221607 Bacteria 6314006
264 2644106695 2643221618 Bacteria 7717186
265 2644200952 2643221636 Bacteria 6583769
266 2644309999 2643221655 Bacteria 7722067
267 2644331950 2643221659 Bacteria 7890716
268 2644484185 2643221686 Bacteria 6310811
269 2644545591 2643221698 Bacteria 7756764
270 2644616217 2643221712 Bacteria 7729434
271 2692317957 2690316117 Bacteria 6800650
272 2719384597 2718217927 Bacteria 6972593
273 2719664344 2718217997 Bacteria 6740740
274 2720490764 2718218199 Bacteria 6740745
275 2720612127 2718218232 Bacteria 6720332
276 2720618959 2718218233 Bacteria 6662049
277 2720630366 2718218235 Bacteria 6630699
278 2720774060 2718218269 Bacteria 6906114
279 2721398307 2718218423 Bacteria 6438183
280 2723025787 2721755556 Bacteria 6745503
281 2723559327 2721755684 Bacteria 6859907
282 2723565948 2721755685 Bacteria 6704835
283 2724037120 2721755809 Bacteria 6438790
284 2724088667 2721755819 Bacteria 6906405
285 2724103213 2721755822 Bacteria 6726041
286 2724109046 2721755823 Bacteria 6752556
287 2725948062 2724679232 Bacteria 7646494
288 2730106723 2728369352 Bacteria 6745171
289 2757571106 2757320392 Bacteria 3737298
290 2792644282 2791355094 Bacteria 7011481
291 2793298520 2791355256 Bacteria 6798008
292 2793322899 2791355260 Bacteria 6598818
293 2793337485 2791355262 Bacteria 6774204
294 2793344030 2791355263 Bacteria 6872478
295 2793355869 2791355265 Bacteria 6539969
296 2793368188 2791355267 Bacteria 7222458
297 2802751962 2802428863 Bacteria 6410669
298 2819609847 2818991448 Bacteria 6772224
299 2838022458 2838016132 Bacteria 6577831
300 2838034072 2838029111 Bacteria 6603031
301 2838048735 2838042994 Bacteria 6046894
302 2838053738 2838048938 Bacteria 6044578
303 2838067770 2838061910 Bacteria 6794874
304 2838073056 2838068647 Bacteria 6208656
305 2842117351 2842110456 Bacteria 7656360
306 2842223447 2842217011 Bacteria 7497767
307 2842269835 2842264693 Bacteria 6472963
308 2842298442 2842298080 Bacteria 6123127
309 2842360454 2842357229 Bacteria 6485165
310 2842426771 2842422224 Bacteria 6239196
311 2842433720 2842428310 Bacteria 6767288
312 2842440048 2842434925 Bacteria 6502746
313 2842446597 2842441272 Bacteria 6769273
314 2842452187 2842447887 Bacteria 6754142
315 2842468051 2842462802 Bacteria 6588055
316 2842474577 2842469257 Bacteria 6752936
317 2842480760 2842475841 Bacteria 6603183
318 2842507429 2842502639 Bacteria 6604161
319 2842515813 2842509118 Bacteria 6850950
320 2844165219 2844163670 Bacteria 7266046
321 2847423541 2847417321 Bacteria 6913799
322 2848996912 2848992105 Bacteria 6810864
323 2850083802 2850079185 Bacteria 6848280
324 2852390895 2852387548 Bacteria 8025568
325 2855876254 2855872281 Bacteria 6964271
326 2857523809 2857516855 Bacteria 7787325
327 2876816823 2876808645 Bacteria 8824342
328 2879116643 2879110137 Bacteria 8907982
329 2903778352 2903768456 Bacteria 9749579
330 2904699625
331 2916027525 2916021584 Bacteria 6854472
332 2916031383 2916028427 Bacteria 6748433
333 2916046861 2916041962 Bacteria 6820487
334 2916052014 2916048683 Bacteria 6543552
335 2916058122 2916055098 Bacteria 6758838
336 2916078101 2916076590 Bacteria 6596108
337 2921238722 2921237296 Bacteria 6876710
338 2921245286 2921244191 Bacteria 6568419
339 2921266787 2921263974 Bacteria 6864552
340 2921287964 2921282425 Bacteria 6826397
341 2924149711 2924144063 Bacteria 6883928
342 2924175555 2924172951 Bacteria 6749356
343 2924205466 2924200457 Bacteria 6757188
344 2924207905 2924207177 Bacteria 6917007
345 2933593449 2933586486 Bacteria 7667493
346 2933603248 2933599457 Bacteria 5858799
347 2936373767 2936367885 Bacteria 7324495
348 2936386958 2936381700 Bacteria 7006523
349 2937020182 2937016420 Bacteria 6782579
350 2937043057 2937042894 Bacteria 6741576
351 2937057318 2937056579 Bacteria 7107896
352 2937072492 2937071275 Bacteria 6984483
353 2937132834 2937126314 Bacteria 6771275
354 2957420292 2957415311 Bacteria 6991633
355 2957450421 2957443900 Bacteria 6869977
356 2957465329 2957464669 Bacteria 6568877
357 2957480796 2957478035 Bacteria 6756658
358 2960586494 2960584000 Bacteria 6864594
359 2960617187 2960610863 Bacteria 6691244
360 2960626430 2960624210 Bacteria 6875384
361 2960660926 2960660292 Bacteria 7041660
362 2960693883 2960687367 Bacteria 6535474
363 2964608898 2964607997 Bacteria 7101408
364 2964628690 2964621998 Bacteria 6834995
365 2964642148 2964636051 Bacteria 7091832
366 2964669183 2964663802 Bacteria 7019362
367 2964676458 2964670856 Bacteria 6851364
368 2964690496 2964685014 Bacteria 6839111
369 2964693499 2964691889 Bacteria 6802758
370 2964708457 2964705432 Bacteria 7114648
371 2967691625 2967686174 Bacteria 6678622
372 2967703329 2967699805 Bacteria 6854538
373 2967748345 2967742019 Bacteria 6794534
374 2967750660 2967748971 Bacteria 6733771
375 2967774314 2967769361 Bacteria 6587838
376 2967777458 2967775926 Bacteria 6738189
377 2970146994 2970143518 Bacteria 6446480
378 2970159279 2970156795 Bacteria 7168044
379 2970170669 2970164137 Bacteria 6861252
380 2970171964 2970170962 Bacteria 6876229
381 2970179599 2970177841 Bacteria 6768001
382 2977521586 2977516862 Bacteria 6940108
383 2977529351 2977523885 Bacteria 6960446
384 2977564606 2977558990 Bacteria 6863948
385 2996891338 2996887358 Bacteria 5795980
386 3005418735 3005416602 Bacteria 7064308
387 639645641 639633055 Bacteria 7751309
388 648741984 648276728 Bacteria 6968865
389 8003998663 8003992118 Bacteria 7266902
390 8005263883 8005258706 Bacteria 6184835
391 8005279312 8005275841 Bacteria 6929066
392 8005284024 8005282627 Bacteria 6675747
393 8005318373 8005314921 Bacteria 7072929
394 8005325865 8005321885 Bacteria 5795980
395 8005382309 8005376324 Bacteria 6590079
396 8005432507 8005430974 Bacteria 6689030
397 8005466324 8005460587 Bacteria 7157962
398 8005488744 8005484373 Bacteria 6297373
399 8005499058 8005497431 Bacteria 6477605
400 8005559677 8005556819 Bacteria 6908598
401 8005563844 8005563573 Bacteria 7153261
402 8005620248 8005619151 Bacteria 7030230
403 8005626780 8005626139 Bacteria 6534237
404 8005670472 8005668836 Bacteria 6953162
405 8005682447 8005682033 Bacteria 6726518
406 8006984046 8006973647 Bacteria 10679141
407 8016511947 8016511872 Bacteria 9921665
408 8017066515 8017057580 Bacteria 10023680
409 8018163955 8018163183 Bacteria 7277977
410 8019648077 8019638758 Bacteria 9062356
411 8023685833 8023680758 Bacteria 7729763
412 8024486331 8024479707 Bacteria 6954785
413 8024488514 8024486573 Bacteria 6540512
414 8046771854 8046767195 Bacteria 7547379
415 8056379296 8056375014 Bacteria 7006639
416 8056385036 8056382006 Bacteria 6408074
417 8057878259 8057874678 Bacteria 7494653
418 Ga0587073_0118813
419 JGI25155J39150_1000065
420 JGI25156J39149_1000144
421 JGI25154J39366_1000035
422 JGI25154J39366_1000201
423 JGI25157J39369_1000051
424 JGI25152J39213_1014044
425 JGI25152J39213_1015763
426 JGI25150J39212_1007233
427 JGI25159J45721_1003644
428 JGI25151J46595_10035151
429 JGI25153J46596_10034834
430 JGI25153J46596_10039250
431 rootH2_10055394
432 rootH1_10132254
433 rootH1_10206075
434 Ga0055524_1034074
435 Ga0055540_1000251
436 Ga0065165_1001054
437 Ga0070675_100600087
438 Ga0070667_101154911
439 Ga0070714_101458962
440 Ga0070711_100338226
441 Ga0070711_100625905
442 Ga0070663_101057206
443 Ga0070679_100017174
444 Ga0068855_101793190
445 Ga0068862_101806760
446 Ga0075365_10013531
447 Ga0075363_100189308
448 Ga0075363_100302062
449 Ga0075364_10533401
450 Ga0075367_10001996
451 Ga0075367_10680214
452 Ga0075369_10216871
453 Ga0075366_10324242
454 Ga0075370_10303583
455 Ga0075370_10649773
456 Ga0075436_100000646
457 Ga0079104_1050954
458 Ga0099826_10016292
459 Ga0099795_10054329
460 Ga0105240_10032865
461 Ga0099796_10016278
462 Ga0157326_1088156
463 Ga0157370_10042498
464 Ga0157378_10723492
465 Ga0182008_10245785
466 Ga0182007_10123797
467 Ga0206351_10899888
468 Ga0154015_1013198
469 Ga0214542_1012849
470 Ga0214543_1000351
471 Ga0213872_10226214
472 Ga0213874_10039467
473 Ga0213876_10001757
474 Ga0213876_10066791
475 Ga0213875_10001460
476 Ga0228711_1013562
477 Ga0228710_1008252
478 Ga0209435_100005
479 Ga0209563_101969
480 Ga0207425_1001342
481 Ga0207425_1018171
482 Ga0209646_1000011
483 Ga0209026_1000008
484 Ga0209148_1013759
485 Ga0209759_1000004
486 Ga0209129_1002380
487 Ga0209129_1008435
488 Ga0209673_1000974
489 Ga0209130_1000264
490 Ga0209676_1042314
491 Ga0209025_1007184
492 Ga0209025_1016089
493 Ga0209025_1043197
494 Ga0209758_1005800
495 Ga0209758_1008021
496 Ga0209758_1017894
497 Ga0209050_1006652
498 Ga0209256_1000175
499 Ga0209256_1000212
500 Ga0207426_1002562
501 Ga0207426_1010432
502 Ga0209051_1000127
503 Ga0209051_1032040
504 Ga0209257_1002379
505 Ga0209257_1003156
506 Ga0209257_1021341
507 Ga0207707_10124368
508 Ga0207695_10006048
509 Ga0207663_10507509
510 Ga0207652_10036811
511 Ga0207667_11525090
512 Ga0207668_10414559
513 Ga0207640_10162863
514 Ga0207678_11066642
515 Ga0209281_1038134
516 Ga0209371_1015926
517 Ga0209179_1103056
518 Ga0209282_1034690
519 Ga0268265_11961812
520 Ga0307515_10265411
521 Ga0265338_10003658
522 Ga0268256_1018949
523 Ga0265330_10088661
524 Ga0307513_10331441
525 Ga0307513_10958440
526 Ga0307508_10004137
527 Ga0307405_10004399
528 Ga0307406_10205824
529 Ga0307412_10415601
530 Ga0307416_101669240
531 Ga0307510_10476358
532 Ga0436365_0396709
533 Ga0436365_0725938
534 Ga0436365_1389296
535 Ga0436360_0461768
536 Ga0436360_0478326
537 Ga0436361_0156209
538 Ga0436361_1134239
539 Ga0436363_0229077
540 Ga0436363_0236160
541 Ga0436362_0532755
542 Ga0439436_0111941
543 Ga0439439_0136180
544 Ga0451837_0249830
545 Ga0451839_0967207
546 Ga0451841_0504411
547 Ga0451841_1134976
548 Ga0451849_0195575
549 Ga0451849_0788698
550 Ga0451851_0185205
551 Ga0451851_0690652
552 Ga0451843_0091176
553 Ga0451855_0515309
554 Ga0439462_0048554
555 Ga0466966_0039222
556 Ga0466963_0476797
557 Ga0466970_0032130
558 Ga0466957_0067592
559 Ga0466967_1543591
560 Ga0495638_0220718
561 Ga0495650_0081050
562 Ga0495585_0486901
563 Ga0495607_0105827
564 Ga0495606_0055284
565 Ga0495610_0000628
566 Ga0495620_0043002
567 Ga0495631_0227851
568 Ga0495632_0034117
569 Ga0495643_0015099
570 Ga0495648_0052483
571 Ga0495648_0416661
572 Ga0495663_0337657
573 Ga0495633_0243433
574 Ga0495668_0053352
575 Ga0495668_0344590
576 Ga0495625_0286773
577 Ga0495625_0495225
578 Ga0495588_0283699
579 Ga0495681_0130046
580 Ga0495686_0000422
581 Ga0495686_0005749
582 Ga0495615_0194834
583 Ga0496100_0630300
584 Ga0496100_0731948
585 Ga0496101_0243445
586 Ga0496102_0151259
587 Ga0496104_0475401
588 Ga0496106_0870866
589 Ga0496110_0388193
590 Ga0496114_0021635
591 Ga0496114_0377619
592 Ga0496116_0011612
593 Ga0496116_0237415
594 Ga0496116_0288119
595 Ga0496117_0049319
596 Ga0496118_0006700
597 Ga0496118_0139290
598 Ga0496119_0352774
599 Ga0496122_0113682
600 Ga0496124_0090889
601 Ga0496125_0252208
602 Ga0496126_0043450
603 Ga0496126_0243387
604 Ga0496126_0492326
605 Ga0495678_172740
606 Ga0495682_0146982
607 Ga0501031_0009373
608 Ga0501032_0198841
609 Ga0501033_0132342
610 Ga0501033_0189554
611 Ga0501034_0030728
612 Ga0501034_0090140
613 Ga0501034_0293788
614 Ga0501036_0074558
615 Ga0501037_0220023
616 Ga0501043_0044549
617 Ga0501043_0292630
618 Ga0501047_1269764
619 Ga0501048_0356640
620 Ga0501070_0423313
621 Ga0501035_0011819
622 Ga0501035_0092228
623 Ga0501044_0165143
624 Ga0501044_1178511
625 nmdc:mga03n38_204209_c1
626 nmdc:mga03n38_936982_c1
627 nmdc:mga00v17_408787_c1
628 nmdc:mga0yw44_23629_c1
629 nmdc:mga06z11_6328_c1
630 nmdc:mga07m45_825305_c1
631 nmdc:mga08x19_98_c1
632 nmdc:mga0sz30_253014_c1
633 Ga0500556_0029532
634 Ga0500569_240354
635 Ga0500607_088103
636 Ga0500655_006977
637 Ga0500658_0116085
638 Ga0500573_0005140
639 Ga0500590_022899
640 Ga0500622_0000609
641 Ga0500622_0072794
642 Ga0500624_014140
643 Ga0500627_0025651
644 Ga0500627_0165251
645 Ga0500634_0006542
646 Ga0500636_0013086
647 Ga0587080_028737
648 Ga0587067_048263
649 2509111249
650 2509379924
651 2510137674
652 2510307419
653 2510893496
654 2513571722
655 2513621300
656 2513712588
657 2513867666
658 2515109250
659 2515641683
660 2515659045
661 2516207442
662 2516897947
663 2517042384
664 2517099442
665 2517411919
666 2517567844
667 2524459089
668 2524541798
669 2528856493
670 2551714836
671 2551730755
672 2558864894
673 2585168979
674 2585330995
675 2585396307
676 2599722989
677 2616554693
678 2617386796
679 2643919688
680 2644051281
681 2644106695
682 2644200952
683 2644309999
684 2644331950
685 2644484185
686 2644545591
687 2644616217
688 2692317957
689 2719384597
690 2719664344
691 2720490764
692 2720612127
693 2720618959
694 2720630366
695 2720774060
696 2721398307
697 2723025787
698 2723559327
699 2723565948
700 2724037120
701 2724088667
702 2724103213
703 2724109046
704 2725948062
705 2730106723
706 2757571106
707 2792644282
708 2793298520
709 2793322899
710 2793337485
711 2793344030
712 2793355869
713 2793368188
714 2802751962
715 2819609847
716 2838022458
717 2838034072
718 2838048735
719 2838053738
720 2838067770
721 2838073056
722 2842117351
723 2842223447
724 2842269835
725 2842298442
726 2842360454
727 2842426771
728 2842433720
729 2842440048
730 2842446597
731 2842452187
732 2842468051
733 2842474577
734 2842480760
735 2842507429
736 2842515813
737 2844165219
738 2847423541
739 2848996912
740 2850083802
741 2852390895
742 2855876254
743 2857523809
744 2876816823
745 2879116643
746 2903778352
747 2904699625
748 2916027525
749 2916031383
750 2916046861
751 2916052014
752 2916058122
753 2916078101
754 2921238722
755 2921245286
756 2921266787
757 2921287964
758 2924149711
759 2924175555
760 2924205466
761 2924207905
762 2933593449
763 2933603248
764 2936373767
765 2936386958
766 2937020182
767 2937043057
768 2937057318
769 2937072492
770 2937132834
771 2957420292
772 2957450421
773 2957465329
774 2957480796
775 2960586494
776 2960617187
777 2960626430
778 2960660926
779 2960693883
780 2964608898
781 2964628690
782 2964642148
783 2964669183
784 2964676458
785 2964690496
786 2964693499
787 2964708457
788 2967691625
789 2967703329
790 2967748345
791 2967750660
792 2967774314
793 2967777458
794 2970146994
795 2970159279
796 2970170669
797 2970171964
798 2970179599
799 2977521586
800 2977529351
801 2977564606
802 2996891338
803 3005418735
804 639645641
805 648741984
806 8003998663
807 8005263883
808 8005279312
809 8005284024
810 8005318373
811 8005325865
812 8005382309
813 8005432507
814 8005466324
815 8005488744
816 8005499058
817 8005559677
818 8005563844
819 8005620248
820 8005626780
821 8005670472
822 8005682447
823 8006984046
824 8016511947
825 8017066515
826 8018163955
827 8019648077
828 8023685833
829 8024486331
830 8024488514
831 8046771854
832 8056379296
833 8056385036
834 8057878259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.902 1 133
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.8769 1 133
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.8716 1 136
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.8656 1 136
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.807 2 130
ID Description Score Start End Superfamily
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9239 1 69 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8716 1 136 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8656 1 136 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8118 1 121 3.40.50.1010
af_Q60288_5_153_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8114 1 128 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A527YP03-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.994 1 82
AF-A0A838BF83-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9929 1 133 GO:0004518
GO:0046872
AF-A0A2V4WYV9-F1-model_v4 deleted 0.9925 1 135
AF-I6ARC3-F1-model_v4 Putative nucleic acid-binding protein 0.9917 32 131 GO:0004518
GO:0046872
AF-A0A370L4Q1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.991 1 133 GO:0000287
GO:0004540
GO:0090729

Map