F439170

General Info

Members Datasets Scaffolds Average Seq Length
417 165 834 122

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0640696|Ga0501073_0640696_291_656
Length 121
Sequence MKRPERLAEALKEEISEVVGFELEDPRVEAVTVTEVAVSDDLRDAKVYVIVEGGGEEATKKALTALQHAATFVRQQVAMNLSLRFAPHIHFVRDTAEENAARVGRLLNEMAAKGELEEKTE

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
151 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
157 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
158 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
161 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
162 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.24
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 18.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0640696 3300049589 Bacteria 734
2 Ga0065712_10403154 3300005290 Bacteria 729
3 Ga0065715_10138120 3300005293 Bacteria 1896
4 Ga0065715_10147131 3300005293 Bacteria 1775
5 Ga0065715_10580791 3300005293 Unclassified 720
6 Ga0065707_10270493 3300005295 Bacteria 1069
7 Ga0070658_10109624 3300005327 Bacteria 2286
8 Ga0070676_10024030 3300005328 Bacteria 3430
9 Ga0070676_10060296 3300005328 Bacteria 2253
10 Ga0070676_10428546 3300005328 Unclassified 926
11 Ga0070683_100100235 3300005329 Bacteria 2727
12 Ga0070683_100500527 3300005329 Unclassified 1161
13 Ga0070670_100024555 3300005331 Bacteria 5182
14 Ga0070670_100026529 3300005331 Bacteria 4984
15 Ga0070670_100058212 3300005331 Bacteria 3317
16 Ga0070670_100568487 3300005331 Bacteria 1012
17 Ga0070677_10230884 3300005333 Bacteria 909
18 Ga0070666_10141003 3300005335 Bacteria 1679
19 Ga0070666_10855095 3300005335 Bacteria 671
20 Ga0070680_100110705 3300005336 Bacteria 2286
21 Ga0070680_101040238 3300005336 Bacteria 707
22 Ga0070682_100331953 3300005337 Bacteria 1127
23 Ga0070682_100663465 3300005337 Bacteria 832
24 Ga0068868_100599328 3300005338 Unclassified 976
25 Ga0068868_101099759 3300005338 Bacteria 731
26 Ga0070689_100330626 3300005340 Bacteria 1275
27 Ga0070689_100331186 3300005340 Unclassified 1274
28 Ga0070689_100875888 3300005340 Bacteria 793
29 Ga0070661_100014376 3300005344 Bacteria 5576
30 Ga0070661_100089297 3300005344 Bacteria 2282
31 Ga0070661_100218297 3300005344 Bacteria 1462
32 Ga0070661_101436639 3300005344 Unclassified 581
33 Ga0070661_101483019 3300005344 Unclassified 572
34 Ga0070675_100017278 3300005354 Bacteria 5731
35 Ga0070675_100061483 3300005354 Bacteria 3101
36 Ga0070675_100298807 3300005354 Bacteria 1418
37 Ga0070675_100555869 3300005354 Bacteria 1038
38 Ga0070671_100141658 3300005355 Bacteria 2029
39 Ga0070671_100205041 3300005355 Bacteria 1672
40 Ga0070671_100247742 3300005355 Bacteria 1513
41 Ga0070671_100349894 3300005355 Unclassified 1261
42 Ga0070671_100405753 3300005355 Bacteria 1166
43 Ga0070671_100687591 3300005355 Unclassified 887
44 Ga0070671_101138623 3300005355 Unclassified 686
45 Ga0070674_100636208 3300005356 Bacteria 905
46 Ga0070674_101090170 3300005356 Bacteria 705
47 Ga0070674_101148573 3300005356 Bacteria 688
48 Ga0070674_102024069 3300005356 Bacteria 525
49 Ga0070673_100055064 3300005364 Bacteria 3133
50 Ga0070673_100577509 3300005364 Unclassified 1023
51 Ga0070673_100912375 3300005364 Bacteria 815
52 Ga0070688_100057814 3300005365 Unclassified 2439
53 Ga0070688_100364471 3300005365 Bacteria 1061
54 Ga0070659_100014410 3300005366 Bacteria 5909
55 Ga0070659_100792839 3300005366 Bacteria 824
56 Ga0070667_100418985 3300005367 Bacteria 1220
57 Ga0070667_101543917 3300005367 Unclassified 624
58 Ga0070667_102043115 3300005367 Bacteria 540
59 Ga0070701_11024707 3300005438 Bacteria 577
60 Ga0070701_11144063 3300005438 Unclassified 550
61 Ga0070663_100208517 3300005455 Bacteria 1529
62 Ga0070663_100354197 3300005455 Unclassified 1189
63 Ga0070678_100124779 3300005456 Bacteria 2036
64 Ga0070678_100246854 3300005456 Bacteria 1495
65 Ga0070678_100347208 3300005456 Bacteria 1275
66 Ga0070678_100486397 3300005456 Bacteria 1087
67 Ga0070678_100935332 3300005456 Bacteria 794
68 Ga0070678_100936065 3300005456 Bacteria 794
69 Ga0070662_100383104 3300005457 Bacteria 1158
70 Ga0070681_10022567 3300005458 Bacteria 6321
71 Ga0070681_10031862 3300005458 Bacteria 5292
72 Ga0070681_10242533 3300005458 Bacteria 1716
73 Ga0068867_100415439 3300005459 Bacteria 1138
74 Ga0068867_100672084 3300005459 Bacteria 911
75 Ga0070685_10236163 3300005466 Bacteria 1205
76 Ga0070685_10632192 3300005466 Unclassified 774
77 Ga0070685_11398176 3300005466 Bacteria 537
78 Ga0070679_100004186 3300005530 Bacteria 13303
79 Ga0070684_100189941 3300005535 Bacteria 1869
80 Ga0070684_100537760 3300005535 Bacteria 1084
81 Ga0068853_100004805 3300005539 Bacteria 10508
82 Ga0068853_100009472 3300005539 Bacteria 7848
83 Ga0068853_100054452 3300005539 Bacteria 3447
84 Ga0070672_100161773 3300005543 Bacteria 1858
85 Ga0070672_100238889 3300005543 Bacteria 1528
86 Ga0070672_100643214 3300005543 Bacteria 926
87 Ga0070672_100650474 3300005543 Unclassified 921
88 Ga0070686_100173664 3300005544 Bacteria 1526
89 Ga0070696_100361287 3300005546 Bacteria 1127
90 Ga0070693_100214107 3300005547 Unclassified 1259
91 Ga0070704_100191773 3300005549 Bacteria 1643
92 Ga0068855_100492482 3300005563 Bacteria 1333
93 Ga0068855_101643575 3300005563 Unclassified 656
94 Ga0070664_100057316 3300005564 Bacteria 3311
95 Ga0070664_100195875 3300005564 Bacteria 1801
96 Ga0070664_100214939 3300005564 Bacteria 1719
97 Ga0068857_100025363 3300005577 Bacteria 5220
98 Ga0068857_100373538 3300005577 Bacteria 1323
99 Ga0068857_100562410 3300005577 Bacteria 1075
100 Ga0068857_100612702 3300005577 Bacteria 1030
101 Ga0068854_100124976 3300005578 Unclassified 1958
102 Ga0068854_100316958 3300005578 Bacteria 1266
103 Ga0068854_101160136 3300005578 Bacteria 691
104 Ga0068856_100225603 3300005614 Bacteria 1889
105 Ga0070702_101392463 3300005615 Unclassified 573
106 Ga0068852_100161252 3300005616 Bacteria 2094
107 Ga0068852_100188985 3300005616 Bacteria 1942
108 Ga0068852_100298816 3300005616 Bacteria 1558
109 Ga0068852_100486460 3300005616 Bacteria 1227
110 Ga0068859_101217349 3300005617 Bacteria 829
111 Ga0068859_101805066 3300005617 Unclassified 675
112 Ga0068864_100138595 3300005618 Bacteria 2192
113 Ga0068864_100519123 3300005618 Bacteria 1148
114 Ga0068866_10657619 3300005718 Bacteria 714
115 Ga0068861_100076542 3300005719 Bacteria 2608
116 Ga0068851_10066461 3300005834 Bacteria 1858
117 Ga0068851_10246390 3300005834 Bacteria 1012
118 Ga0068851_10899831 3300005834 Unclassified 554
119 Ga0068870_10064572 3300005840 Bacteria 1978
120 Ga0068870_10136032 3300005840 Bacteria 1433
121 Ga0068870_10383638 3300005840 Bacteria 910
122 Ga0068870_10614901 3300005840 Bacteria 740
123 Ga0068863_100349452 3300005841 Bacteria 1440
124 Ga0068863_102030232 3300005841 Unclassified 585
125 Ga0068858_100229283 3300005842 Bacteria 1760
126 Ga0068858_100289026 3300005842 Bacteria 1562
127 Ga0068858_100864874 3300005842 Bacteria 883
128 Ga0068860_100721603 3300005843 Bacteria 1007
129 Ga0068862_100125739 3300005844 Bacteria 2263
130 Ga0068862_100155350 3300005844 Bacteria 2039
131 Ga0068862_100391164 3300005844 Bacteria 1299
132 Ga0068862_100506979 3300005844 Bacteria 1146
133 Ga0068862_101216727 3300005844 Bacteria 752
134 Ga0068862_101727165 3300005844 Unclassified 634
135 Ga0097621_100341789 3300006237 Bacteria 1329
136 Ga0097621_100567164 3300006237 Bacteria 1035
137 Ga0068871_100738953 3300006358 Bacteria 904
138 Ga0068865_100292768 3300006881 Bacteria 1300
139 Ga0068865_100621382 3300006881 Bacteria 915
140 Ga0097620_101217573 3300006931 Bacteria 829
141 Ga0097620_101804765 3300006931 Unclassified 675
142 Ga0105240_10116527 3300009093 Bacteria 3223
143 Ga0105240_10385510 3300009093 Bacteria 1582
144 Ga0111539_10016686 3300009094 Bacteria 9102
145 Ga0111539_10953524 3300009094 Bacteria 997
146 Ga0111539_11294543 3300009094 Bacteria 846
147 Ga0105241_10074826 3300009174 Bacteria 2638
148 Ga0105241_11929174 3300009174 Bacteria 580
149 Ga0105248_10348034 3300009177 Bacteria 1668
150 Ga0105248_11456103 3300009177 Bacteria 775
151 Ga0105248_11602332 3300009177 Unclassified 738
152 Ga0105248_11964618 3300009177 Unclassified 664
153 Ga0105248_12453415 3300009177 Unclassified 594
154 Ga0105248_12559428 3300009177 Bacteria 582
155 Ga0105237_10015457 3300009545 Bacteria 7943
156 Ga0105237_12010246 3300009545 Unclassified 587
157 Ga0105249_10005137 3300009553 Bacteria 11290
158 Ga0105249_10089228 3300009553 Bacteria 2881
159 Ga0105249_10404148 3300009553 Bacteria 1397
160 Ga0105249_10476532 3300009553 Unclassified 1290
161 Ga0105239_10073201 3300010375 Bacteria 3767
162 Ga0105239_10522098 3300010375 Unclassified 1351
163 Ga0157373_10024690 3300013100 Bacteria 4353
164 Ga0157373_10187811 3300013100 Bacteria 1456
165 Ga0157371_10191284 3300013102 Unclassified 1465
166 Ga0157370_10131231 3300013104 Bacteria 2337
167 Ga0157370_10208684 3300013104 Bacteria 1811
168 Ga0157370_10456743 3300013104 Bacteria 1174
169 Ga0157370_10947498 3300013104 Unclassified 780
170 Ga0157369_10114460 3300013105 Bacteria 2864
171 Ga0157369_10174181 3300013105 Bacteria 2266
172 Ga0157374_10041396 3300013296 Bacteria 4245
173 Ga0157374_10259852 3300013296 Bacteria 1710
174 Ga0157374_12647541 3300013296 Bacteria 529
175 Ga0157378_10795658 3300013297 Bacteria 971
176 Ga0157378_11363287 3300013297 Unclassified 751
177 Ga0163162_10107214 3300013306 Bacteria 2889
178 Ga0163162_10143339 3300013306 Unclassified 2503
179 Ga0163162_10289153 3300013306 Unclassified 1771
180 Ga0163162_10453799 3300013306 Bacteria 1414
181 Ga0163162_10714544 3300013306 Bacteria 1123
182 Ga0163162_13319486 3300013306 Unclassified 515
183 Ga0157372_10009871 3300013307 Bacteria 10154
184 Ga0157372_10019972 3300013307 Bacteria 7222
185 Ga0157372_10055385 3300013307 Bacteria 4429
186 Ga0157372_10663226 3300013307 Bacteria 1214
187 Ga0157372_11071877 3300013307 Bacteria 932
188 Ga0157375_10140571 3300013308 Bacteria 2541
189 Ga0157375_10441933 3300013308 Bacteria 1466
190 Ga0157375_10885886 3300013308 Unclassified 1037
191 Ga0157375_11056325 3300013308 Bacteria 949
192 Ga0157375_11075479 3300013308 Bacteria 941
193 Ga0157375_11156812 3300013308 Bacteria 907
194 Ga0163163_10082808 3300014325 Bacteria 3213
195 Ga0163163_10146213 3300014325 Bacteria 2408
196 Ga0163163_10564592 3300014325 Bacteria 1201
197 Ga0163163_11043055 3300014325 Bacteria 881
198 Ga0163163_11261523 3300014325 Bacteria 801
199 Ga0157380_10068844 3300014326 Unclassified 2854
200 Ga0157380_10134146 3300014326 Bacteria 2117
201 Ga0157380_10153227 3300014326 Bacteria 1995
202 Ga0157380_10233722 3300014326 Bacteria 1653
203 Ga0157380_10954240 3300014326 Unclassified 888
204 Ga0157377_10144389 3300014745 Bacteria 1465
205 Ga0157377_10365210 3300014745 Bacteria 973
206 Ga0157377_11111044 3300014745 Bacteria 606
207 Ga0157376_10314023 3300014969 Bacteria 1488
208 Ga0157376_10341433 3300014969 Bacteria 1430
209 Ga0157376_10465249 3300014969 Bacteria 1236
210 Ga0157376_12402731 3300014969 Bacteria 566
211 Ga0163161_10004057 3300017792 Bacteria 10240
212 Ga0163161_10473832 3300017792 Bacteria 1015
213 Ga0163161_10696563 3300017792 Bacteria 845
214 Ga0207697_10136346 3300025315 Unclassified 1062
215 Ga0207656_10071501 3300025321 Bacteria 1543
216 Ga0207656_10215974 3300025321 Bacteria 931
217 Ga0207682_10007748 3300025893 Bacteria 4267
218 Ga0207682_10093758 3300025893 Bacteria 1305
219 Ga0207682_10261008 3300025893 Unclassified 808
220 Ga0207682_10357366 3300025893 Unclassified 688
221 Ga0207688_10678963 3300025901 Bacteria 651
222 Ga0207688_10942270 3300025901 Unclassified 546
223 Ga0207680_10191094 3300025903 Bacteria 1390
224 Ga0207680_10505103 3300025903 Bacteria 861
225 Ga0207645_10110937 3300025907 Bacteria 1776
226 Ga0207645_10211861 3300025907 Unclassified 1276
227 Ga0207643_10038054 3300025908 Bacteria 2701
228 Ga0207643_10053996 3300025908 Bacteria 2283
229 Ga0207705_10005176 3300025909 Bacteria 9778
230 Ga0207654_11272780 3300025911 Bacteria 536
231 Ga0207707_10069869 3300025912 Bacteria 3060
232 Ga0207707_10301591 3300025912 Bacteria 1385
233 Ga0207695_10311591 3300025913 Bacteria 1464
234 Ga0207671_10565368 3300025914 Unclassified 907
235 Ga0207660_10039142 3300025917 Bacteria 3313
236 Ga0207660_10908051 3300025917 Bacteria 719
237 Ga0207657_10088623 3300025919 Bacteria 2586
238 Ga0207657_10154591 3300025919 Bacteria 1866
239 Ga0207649_10034500 3300025920 Bacteria 3032
240 Ga0207649_10237383 3300025920 Bacteria 1307
241 Ga0207649_10387675 3300025920 Bacteria 1043
242 Ga0207649_11195232 3300025920 Bacteria 601
243 Ga0207652_10015778 3300025921 Bacteria 6154
244 Ga0207652_10150586 3300025921 Bacteria 2083
245 Ga0207650_10203443 3300025925 Bacteria 1587
246 Ga0207650_10251382 3300025925 Unclassified 1431
247 Ga0207650_10333596 3300025925 Bacteria 1244
248 Ga0207650_10558110 3300025925 Unclassified 960
249 Ga0207659_10029497 3300025926 Bacteria 3740
250 Ga0207659_10083045 3300025926 Bacteria 2374
251 Ga0207659_10698983 3300025926 Bacteria 868
252 Ga0207687_11353616 3300025927 Bacteria 612
253 Ga0207644_10399427 3300025931 Bacteria 1123
254 Ga0207644_10481681 3300025931 Bacteria 1022
255 Ga0207644_10598846 3300025931 Bacteria 915
256 Ga0207644_10676705 3300025931 Bacteria 860
257 Ga0207706_10106823 3300025933 Bacteria 2463
258 Ga0207706_10163408 3300025933 Bacteria 1957
259 Ga0207670_10185016 3300025936 Bacteria 1572
260 Ga0207691_10190527 3300025940 Bacteria 1789
261 Ga0207691_10526305 3300025940 Bacteria 1003
262 Ga0207691_10709051 3300025940 Unclassified 848
263 Ga0207691_11040710 3300025940 Unclassified 682
264 Ga0207661_10086257 3300025944 Bacteria 2605
265 Ga0207661_10689679 3300025944 Unclassified 939
266 Ga0207679_10031015 3300025945 Bacteria 3739
267 Ga0207679_10084935 3300025945 Bacteria 2430
268 Ga0207679_10181920 3300025945 Bacteria 1740
269 Ga0207679_10945216 3300025945 Unclassified 789
270 Ga0207667_10469549 3300025949 Bacteria 1278
271 Ga0207651_10013169 3300025960 Bacteria 4720
272 Ga0207651_10216268 3300025960 Bacteria 1546
273 Ga0207712_10032498 3300025961 Bacteria 3523
274 Ga0207712_10193646 3300025961 Bacteria 1606
275 Ga0207640_10041212 3300025981 Bacteria 2935
276 Ga0207640_10092319 3300025981 Bacteria 2100
277 Ga0207640_10870479 3300025981 Bacteria 785
278 Ga0207640_10871339 3300025981 Unclassified 785
279 Ga0207677_10723379 3300026023 Bacteria 885
280 Ga0207677_10918094 3300026023 Unclassified 790
281 Ga0207703_10257186 3300026035 Bacteria 1577
282 Ga0207703_11529356 3300026035 Unclassified 642
283 Ga0207639_10022952 3300026041 Bacteria 4500
284 Ga0207639_10066924 3300026041 Bacteria 2794
285 Ga0207639_10216051 3300026041 Bacteria 1653
286 Ga0207678_10199319 3300026067 Bacteria 1711
287 Ga0207678_10330666 3300026067 Bacteria 1312
288 Ga0207708_11829115 3300026075 Bacteria 533
289 Ga0207641_10817228 3300026088 Unclassified 923
290 Ga0207641_10865281 3300026088 Bacteria 896
291 Ga0207648_10292866 3300026089 Bacteria 1458
292 Ga0207648_11658540 3300026089 Unclassified 601
293 Ga0207676_10185245 3300026095 Bacteria 1826
294 Ga0207676_10202590 3300026095 Bacteria 1755
295 Ga0207676_10447885 3300026095 Bacteria 1216
296 Ga0207674_10010053 3300026116 Bacteria 10764
297 Ga0207674_10103186 3300026116 Bacteria 2831
298 Ga0207674_10351441 3300026116 Bacteria 1425
299 Ga0207675_100311266 3300026118 Bacteria 1536
300 Ga0207675_100962429 3300026118 Bacteria 871
301 Ga0207683_10129196 3300026121 Bacteria 2272
302 Ga0207683_10136040 3300026121 Bacteria 2212
303 Ga0207683_10418919 3300026121 Bacteria 1233
304 Ga0207683_10734061 3300026121 Bacteria 916
305 Ga0207698_10065631 3300026142 Bacteria 2852
306 Ga0207698_10698219 3300026142 Bacteria 1009
307 Ga0207698_10964570 3300026142 Bacteria 862
308 Ga0209974_10232271 3300027876 Unclassified 690
309 Ga0268265_10307863 3300028380 Bacteria 1429
310 Ga0268265_10407223 3300028380 Bacteria 1259
311 Ga0268265_10420358 3300028380 Bacteria 1241
312 Ga0268265_11205406 3300028380 Bacteria 755
313 Ga0268264_10215216 3300028381 Bacteria 1766
314 Ga0307408_100035740 3300031548 Bacteria 3488
315 Ga0307405_10000448 3300031731 Bacteria 15415
316 Ga0307405_10099304 3300031731 Bacteria 1948
317 Ga0307405_10226628 3300031731 Bacteria 1375
318 Ga0307405_10238264 3300031731 Bacteria 1346
319 Ga0307405_10256655 3300031731 Bacteria 1303
320 Ga0307405_11306517 3300031731 Bacteria 631
321 Ga0307413_10003693 3300031824 Bacteria 6506
322 Ga0307413_10024261 3300031824 Bacteria 3303
323 Ga0307413_10143479 3300031824 Bacteria 1653
324 Ga0307413_10144060 3300031824 Bacteria 1651
325 Ga0307413_10192285 3300031824 Bacteria 1466
326 Ga0307413_10469005 3300031824 Bacteria 1003
327 Ga0307413_10539131 3300031824 Bacteria 944
328 Ga0307410_10002288 3300031852 Bacteria 9188
329 Ga0307410_10012803 3300031852 Bacteria 4868
330 Ga0307410_10014488 3300031852 Bacteria 4641
331 Ga0307410_10023073 3300031852 Bacteria 3860
332 Ga0307410_10038390 3300031852 Bacteria 3136
333 Ga0307410_10203140 3300031852 Bacteria 1514
334 Ga0307410_10395879 3300031852 Bacteria 1115
335 Ga0307406_10003483 3300031901 Bacteria 8563
336 Ga0307406_10037292 3300031901 Bacteria 3001
337 Ga0307406_10110813 3300031901 Bacteria 1889
338 Ga0307406_10191684 3300031901 Unclassified 1497
339 Ga0307406_10358298 3300031901 Bacteria 1142
340 Ga0307406_10476808 3300031901 Bacteria 1007
341 Ga0307407_10008050 3300031903 Bacteria 4812
342 Ga0307407_10018272 3300031903 Bacteria 3542
343 Ga0307407_10036260 3300031903 Bacteria 2716
344 Ga0307407_10043331 3300031903 Bacteria 2529
345 Ga0307407_10158119 3300031903 Bacteria 1480
346 Ga0307407_10361282 3300031903 Bacteria 1031
347 Ga0307407_10818235 3300031903 Bacteria 710
348 Ga0307412_10045083 3300031911 Bacteria 2880
349 Ga0307412_10168995 3300031911 Bacteria 1633
350 Ga0307412_10272312 3300031911 Bacteria 1325
351 Ga0307412_10299998 3300031911 Bacteria 1269
352 Ga0307412_11107895 3300031911 Bacteria 705
353 Ga0307412_11488769 3300031911 Unclassified 615
354 Ga0307409_100015404 3300031995 Bacteria 5018
355 Ga0307409_100056005 3300031995 Bacteria 3047
356 Ga0307409_100058116 3300031995 Bacteria 3002
357 Ga0307409_100118449 3300031995 Bacteria 2236
358 Ga0307409_100484104 3300031995 Bacteria 1201
359 Ga0307409_100850422 3300031995 Unclassified 923
360 Ga0307409_100964355 3300031995 Bacteria 869
361 Ga0307409_101546825 3300031995 Unclassified 691
362 Ga0307416_100019948 3300032002 Bacteria 4768
363 Ga0307416_100049360 3300032002 Bacteria 3346
364 Ga0307416_100106027 3300032002 Bacteria 2462
365 Ga0307416_100114614 3300032002 Bacteria 2385
366 Ga0307416_100329292 3300032002 Bacteria 1534
367 Ga0307416_100695940 3300032002 Bacteria 1105
368 Ga0307416_101193983 3300032002 Bacteria 866
369 Ga0307414_10026040 3300032004 Bacteria 3759
370 Ga0307414_10161707 3300032004 Bacteria 1779
371 Ga0307414_10411384 3300032004 Unclassified 1177
372 Ga0307411_10010182 3300032005 Bacteria 4998
373 Ga0307411_10033531 3300032005 Bacteria 3185
374 Ga0307411_10036966 3300032005 Bacteria 3065
375 Ga0307411_10224364 3300032005 Bacteria 1460
376 Ga0307411_10272875 3300032005 Bacteria 1342
377 Ga0307411_10338611 3300032005 Bacteria 1221
378 Ga0307415_100005243 3300032126 Bacteria 6859
379 Ga0307415_100027027 3300032126 Bacteria 3629
380 Ga0307415_100081864 3300032126 Bacteria 2308
381 Ga0307415_100108340 3300032126 Bacteria 2055
382 Ga0307415_100118849 3300032126 Unclassified 1977
383 Ga0307415_100286584 3300032126 Bacteria 1357
384 Ga0307415_101145553 3300032126 Bacteria 730
385 Ga0395905_0709248 3300037471 Unclassified 908
386 Ga0395905_1325399 3300037471 Unclassified 624
387 Ga0436365_1769421 3300039437 Bacteria 1096
388 Ga0436362_0851961 3300039453 Bacteria 1828
389 Ga0451789_1326439 3300041443 Unclassified 651
390 Ga0451835_0809813 3300041492 Unclassified 619
391 Ga0451853_0811976 3300041512 Bacteria 1131
392 Ga0439432_049786 3300042006 Bacteria 1309
393 Ga0450898_023413 3300042134 Unclassified 1098
394 Ga0495629_0300620 3300046459 Bacteria 1099
395 Ga0495621_0313983 3300046539 Bacteria 652
396 Ga0495671_0467601 3300046692 Bacteria 602
397 Ga0495684_0685878 3300047471 Bacteria 681
398 Ga0501072_0002999 3300049588 Bacteria 12731
399 Ga0501202_049348 3300049652 Bacteria 929
400 Ga0501209_073769 3300049656 Bacteria 974
401 Ga0501239_007101 3300049672 Bacteria 1166
402 Ga0501239_026445 3300049672 Unclassified 740
403 Ga0501249_004122 3300049679 Bacteria 2941
404 Ga0501257_135388 3300049686 Bacteria 669
405 Ga0501259_051623 3300049688 Unclassified 836
406 Ga0501225_0117794 3300049705 Bacteria 787
407 Ga0501229_028762 3300049706 Unclassified 756
408 Ga0501263_001604 3300049760 Bacteria 2165
409 Ga0501266_044622 3300049763 Unclassified 669
410 Ga0501268_045425 3300049765 Bacteria 838
411 Ga0501270_022342 3300049767 Bacteria 975
412 Ga0501273_026610 3300049770 Bacteria 807
413 Ga0501204_036931 3300049850 Bacteria 701
414 nmdc:mga08y16_427564_c1 3300050511 Bacteria 1353
415 nmdc:mga08y16_558818_c1 3300050511 Unclassified 1157
416 Ga0495601_0314780 3300053077 Bacteria 1019
417 Ga0590074_132195 3300059423 Unclassified 502
418 Ga0501073_0640696
419 Ga0065712_10403154
420 Ga0065715_10138120
421 Ga0065715_10147131
422 Ga0065715_10580791
423 Ga0065707_10270493
424 Ga0070658_10109624
425 Ga0070676_10024030
426 Ga0070676_10060296
427 Ga0070676_10428546
428 Ga0070683_100100235
429 Ga0070683_100500527
430 Ga0070670_100024555
431 Ga0070670_100026529
432 Ga0070670_100058212
433 Ga0070670_100568487
434 Ga0070677_10230884
435 Ga0070666_10141003
436 Ga0070666_10855095
437 Ga0070680_100110705
438 Ga0070680_101040238
439 Ga0070682_100331953
440 Ga0070682_100663465
441 Ga0068868_100599328
442 Ga0068868_101099759
443 Ga0070689_100330626
444 Ga0070689_100331186
445 Ga0070689_100875888
446 Ga0070661_100014376
447 Ga0070661_100089297
448 Ga0070661_100218297
449 Ga0070661_101436639
450 Ga0070661_101483019
451 Ga0070675_100017278
452 Ga0070675_100061483
453 Ga0070675_100298807
454 Ga0070675_100555869
455 Ga0070671_100141658
456 Ga0070671_100205041
457 Ga0070671_100247742
458 Ga0070671_100349894
459 Ga0070671_100405753
460 Ga0070671_100687591
461 Ga0070671_101138623
462 Ga0070674_100636208
463 Ga0070674_101090170
464 Ga0070674_101148573
465 Ga0070674_102024069
466 Ga0070673_100055064
467 Ga0070673_100577509
468 Ga0070673_100912375
469 Ga0070688_100057814
470 Ga0070688_100364471
471 Ga0070659_100014410
472 Ga0070659_100792839
473 Ga0070667_100418985
474 Ga0070667_101543917
475 Ga0070667_102043115
476 Ga0070701_11024707
477 Ga0070701_11144063
478 Ga0070663_100208517
479 Ga0070663_100354197
480 Ga0070678_100124779
481 Ga0070678_100246854
482 Ga0070678_100347208
483 Ga0070678_100486397
484 Ga0070678_100935332
485 Ga0070678_100936065
486 Ga0070662_100383104
487 Ga0070681_10022567
488 Ga0070681_10031862
489 Ga0070681_10242533
490 Ga0068867_100415439
491 Ga0068867_100672084
492 Ga0070685_10236163
493 Ga0070685_10632192
494 Ga0070685_11398176
495 Ga0070679_100004186
496 Ga0070684_100189941
497 Ga0070684_100537760
498 Ga0068853_100004805
499 Ga0068853_100009472
500 Ga0068853_100054452
501 Ga0070672_100161773
502 Ga0070672_100238889
503 Ga0070672_100643214
504 Ga0070672_100650474
505 Ga0070686_100173664
506 Ga0070696_100361287
507 Ga0070693_100214107
508 Ga0070704_100191773
509 Ga0068855_100492482
510 Ga0068855_101643575
511 Ga0070664_100057316
512 Ga0070664_100195875
513 Ga0070664_100214939
514 Ga0068857_100025363
515 Ga0068857_100373538
516 Ga0068857_100562410
517 Ga0068857_100612702
518 Ga0068854_100124976
519 Ga0068854_100316958
520 Ga0068854_101160136
521 Ga0068856_100225603
522 Ga0070702_101392463
523 Ga0068852_100161252
524 Ga0068852_100188985
525 Ga0068852_100298816
526 Ga0068852_100486460
527 Ga0068859_101217349
528 Ga0068859_101805066
529 Ga0068864_100138595
530 Ga0068864_100519123
531 Ga0068866_10657619
532 Ga0068861_100076542
533 Ga0068851_10066461
534 Ga0068851_10246390
535 Ga0068851_10899831
536 Ga0068870_10064572
537 Ga0068870_10136032
538 Ga0068870_10383638
539 Ga0068870_10614901
540 Ga0068863_100349452
541 Ga0068863_102030232
542 Ga0068858_100229283
543 Ga0068858_100289026
544 Ga0068858_100864874
545 Ga0068860_100721603
546 Ga0068862_100125739
547 Ga0068862_100155350
548 Ga0068862_100391164
549 Ga0068862_100506979
550 Ga0068862_101216727
551 Ga0068862_101727165
552 Ga0097621_100341789
553 Ga0097621_100567164
554 Ga0068871_100738953
555 Ga0068865_100292768
556 Ga0068865_100621382
557 Ga0097620_101217573
558 Ga0097620_101804765
559 Ga0105240_10116527
560 Ga0105240_10385510
561 Ga0111539_10016686
562 Ga0111539_10953524
563 Ga0111539_11294543
564 Ga0105241_10074826
565 Ga0105241_11929174
566 Ga0105248_10348034
567 Ga0105248_11456103
568 Ga0105248_11602332
569 Ga0105248_11964618
570 Ga0105248_12453415
571 Ga0105248_12559428
572 Ga0105237_10015457
573 Ga0105237_12010246
574 Ga0105249_10005137
575 Ga0105249_10089228
576 Ga0105249_10404148
577 Ga0105249_10476532
578 Ga0105239_10073201
579 Ga0105239_10522098
580 Ga0157373_10024690
581 Ga0157373_10187811
582 Ga0157371_10191284
583 Ga0157370_10131231
584 Ga0157370_10208684
585 Ga0157370_10456743
586 Ga0157370_10947498
587 Ga0157369_10114460
588 Ga0157369_10174181
589 Ga0157374_10041396
590 Ga0157374_10259852
591 Ga0157374_12647541
592 Ga0157378_10795658
593 Ga0157378_11363287
594 Ga0163162_10107214
595 Ga0163162_10143339
596 Ga0163162_10289153
597 Ga0163162_10453799
598 Ga0163162_10714544
599 Ga0163162_13319486
600 Ga0157372_10009871
601 Ga0157372_10019972
602 Ga0157372_10055385
603 Ga0157372_10663226
604 Ga0157372_11071877
605 Ga0157375_10140571
606 Ga0157375_10441933
607 Ga0157375_10885886
608 Ga0157375_11056325
609 Ga0157375_11075479
610 Ga0157375_11156812
611 Ga0163163_10082808
612 Ga0163163_10146213
613 Ga0163163_10564592
614 Ga0163163_11043055
615 Ga0163163_11261523
616 Ga0157380_10068844
617 Ga0157380_10134146
618 Ga0157380_10153227
619 Ga0157380_10233722
620 Ga0157380_10954240
621 Ga0157377_10144389
622 Ga0157377_10365210
623 Ga0157377_11111044
624 Ga0157376_10314023
625 Ga0157376_10341433
626 Ga0157376_10465249
627 Ga0157376_12402731
628 Ga0163161_10004057
629 Ga0163161_10473832
630 Ga0163161_10696563
631 Ga0207697_10136346
632 Ga0207656_10071501
633 Ga0207656_10215974
634 Ga0207682_10007748
635 Ga0207682_10093758
636 Ga0207682_10261008
637 Ga0207682_10357366
638 Ga0207688_10678963
639 Ga0207688_10942270
640 Ga0207680_10191094
641 Ga0207680_10505103
642 Ga0207645_10110937
643 Ga0207645_10211861
644 Ga0207643_10038054
645 Ga0207643_10053996
646 Ga0207705_10005176
647 Ga0207654_11272780
648 Ga0207707_10069869
649 Ga0207707_10301591
650 Ga0207695_10311591
651 Ga0207671_10565368
652 Ga0207660_10039142
653 Ga0207660_10908051
654 Ga0207657_10088623
655 Ga0207657_10154591
656 Ga0207649_10034500
657 Ga0207649_10237383
658 Ga0207649_10387675
659 Ga0207649_11195232
660 Ga0207652_10015778
661 Ga0207652_10150586
662 Ga0207650_10203443
663 Ga0207650_10251382
664 Ga0207650_10333596
665 Ga0207650_10558110
666 Ga0207659_10029497
667 Ga0207659_10083045
668 Ga0207659_10698983
669 Ga0207687_11353616
670 Ga0207644_10399427
671 Ga0207644_10481681
672 Ga0207644_10598846
673 Ga0207644_10676705
674 Ga0207706_10106823
675 Ga0207706_10163408
676 Ga0207670_10185016
677 Ga0207691_10190527
678 Ga0207691_10526305
679 Ga0207691_10709051
680 Ga0207691_11040710
681 Ga0207661_10086257
682 Ga0207661_10689679
683 Ga0207679_10031015
684 Ga0207679_10084935
685 Ga0207679_10181920
686 Ga0207679_10945216
687 Ga0207667_10469549
688 Ga0207651_10013169
689 Ga0207651_10216268
690 Ga0207712_10032498
691 Ga0207712_10193646
692 Ga0207640_10041212
693 Ga0207640_10092319
694 Ga0207640_10870479
695 Ga0207640_10871339
696 Ga0207677_10723379
697 Ga0207677_10918094
698 Ga0207703_10257186
699 Ga0207703_11529356
700 Ga0207639_10022952
701 Ga0207639_10066924
702 Ga0207639_10216051
703 Ga0207678_10199319
704 Ga0207678_10330666
705 Ga0207708_11829115
706 Ga0207641_10817228
707 Ga0207641_10865281
708 Ga0207648_10292866
709 Ga0207648_11658540
710 Ga0207676_10185245
711 Ga0207676_10202590
712 Ga0207676_10447885
713 Ga0207674_10010053
714 Ga0207674_10103186
715 Ga0207674_10351441
716 Ga0207675_100311266
717 Ga0207675_100962429
718 Ga0207683_10129196
719 Ga0207683_10136040
720 Ga0207683_10418919
721 Ga0207683_10734061
722 Ga0207698_10065631
723 Ga0207698_10698219
724 Ga0207698_10964570
725 Ga0209974_10232271
726 Ga0268265_10307863
727 Ga0268265_10407223
728 Ga0268265_10420358
729 Ga0268265_11205406
730 Ga0268264_10215216
731 Ga0307408_100035740
732 Ga0307405_10000448
733 Ga0307405_10099304
734 Ga0307405_10226628
735 Ga0307405_10238264
736 Ga0307405_10256655
737 Ga0307405_11306517
738 Ga0307413_10003693
739 Ga0307413_10024261
740 Ga0307413_10143479
741 Ga0307413_10144060
742 Ga0307413_10192285
743 Ga0307413_10469005
744 Ga0307413_10539131
745 Ga0307410_10002288
746 Ga0307410_10012803
747 Ga0307410_10014488
748 Ga0307410_10023073
749 Ga0307410_10038390
750 Ga0307410_10203140
751 Ga0307410_10395879
752 Ga0307406_10003483
753 Ga0307406_10037292
754 Ga0307406_10110813
755 Ga0307406_10191684
756 Ga0307406_10358298
757 Ga0307406_10476808
758 Ga0307407_10008050
759 Ga0307407_10018272
760 Ga0307407_10036260
761 Ga0307407_10043331
762 Ga0307407_10158119
763 Ga0307407_10361282
764 Ga0307407_10818235
765 Ga0307412_10045083
766 Ga0307412_10168995
767 Ga0307412_10272312
768 Ga0307412_10299998
769 Ga0307412_11107895
770 Ga0307412_11488769
771 Ga0307409_100015404
772 Ga0307409_100056005
773 Ga0307409_100058116
774 Ga0307409_100118449
775 Ga0307409_100484104
776 Ga0307409_100850422
777 Ga0307409_100964355
778 Ga0307409_101546825
779 Ga0307416_100019948
780 Ga0307416_100049360
781 Ga0307416_100106027
782 Ga0307416_100114614
783 Ga0307416_100329292
784 Ga0307416_100695940
785 Ga0307416_101193983
786 Ga0307414_10026040
787 Ga0307414_10161707
788 Ga0307414_10411384
789 Ga0307411_10010182
790 Ga0307411_10033531
791 Ga0307411_10036966
792 Ga0307411_10224364
793 Ga0307411_10272875
794 Ga0307411_10338611
795 Ga0307415_100005243
796 Ga0307415_100027027
797 Ga0307415_100081864
798 Ga0307415_100108340
799 Ga0307415_100118849
800 Ga0307415_100286584
801 Ga0307415_101145553
802 Ga0395905_0709248
803 Ga0395905_1325399
804 Ga0436365_1769421
805 Ga0436362_0851961
806 Ga0451789_1326439
807 Ga0451835_0809813
808 Ga0451853_0811976
809 Ga0439432_049786
810 Ga0450898_023413
811 Ga0495629_0300620
812 Ga0495621_0313983
813 Ga0495671_0467601
814 Ga0495684_0685878
815 Ga0501072_0002999
816 Ga0501202_049348
817 Ga0501209_073769
818 Ga0501239_007101
819 Ga0501239_026445
820 Ga0501249_004122
821 Ga0501257_135388
822 Ga0501259_051623
823 Ga0501225_0117794
824 Ga0501229_028762
825 Ga0501263_001604
826 Ga0501266_044622
827 Ga0501268_045425
828 Ga0501270_022342
829 Ga0501273_026610
830 Ga0501204_036931
831 nmdc:mga08y16_427564_c1
832 nmdc:mga08y16_558818_c1
833 Ga0495601_0314780
834 Ga0590074_132195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

3

107

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jos-assembly1.cif.gz_A ribosome binding factor a(rbfa) 0.8206 3 95
2e7g-assembly1.cif.gz_A solution structure of putative ribosome-binding factor a (rbfa) from human mutochondrial precursor 0.8105 1 95
7x9u-assembly1.cif.gz_A type-ii kh motif of human mitochondrial rbfa 0.8043 1 95
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.7861 3 92
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.785 3 92
ID Description Score Start End Superfamily
af_Q5VPH3_41_157_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8062 1 99 3.30.300.20
af_Q18170_73_171_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8043 6 93 3.30.300.20
af_A0A0G2K1B0_81_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.801 1 93 3.30.300.20
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.785 3 92 3.30.300.20
af_Q8SXX0_83_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7728 4 93 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V8R3C2-F1-model_v4 30S ribosome-binding factor RbfA 0.9234 11 97 GO:0005829
GO:0006364
GO:0043024
AF-A0A7W1JKP3-F1-model_v4 30S ribosome-binding factor RbfA 0.901 8 95 GO:0005829
GO:0006364
GO:0043024
AF-A0A2V8R3C2-F1-model_v4 30S ribosome-binding factor RbfA 0.8759 11 97 GO:0005829
GO:0006364
GO:0043024
AF-A0A1F2RPE2-F1-model_v4 Ribosome-binding factor A 0.8648 5 95 GO:0005829
GO:0030490
GO:0043024
AF-A0A1C4J8P5-F1-model_v4 deleted 0.8639 1 95

Map