F439124

General Info

Members Datasets Scaffolds Average Seq Length
417 205 834 228

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0043047|Ga0466963_0043047_361_1092
Length 243
Sequence VGEVVEMSLLADTANLHTFVEAFRFIQHNPGVLAQKTLEQLELSGAALGIAAGITLPLGIALGHFHRFSGLAIGASILGRGLPSLVLIGAFLTVLGIGFVNNMVALAVLGSGPILTTAYSAVDGVDRDAVEAARGMGMTRPQILRRVELPLGIPLLFTGIRIAAVTIVATAPIAAIAGGGGLGDIIVNQASYRLSGVLGASICVMVLSAAVYSVLVALQLAVTPRGLRSTRVRRAPLSRKEQQ

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 2.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.67
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0043047 3300044694 Bacteria 2967
2 rootH1_10153720 3300003323 Bacteria 2116
3 Ga0070658_10006698 3300005327 Bacteria 9327
4 Ga0070658_10138258 3300005327 Bacteria 2034
5 Ga0070658_10218709 3300005327 Bacteria 1610
6 Ga0070658_10672458 3300005327 Unclassified 898
7 Ga0070683_100036299 3300005329 Bacteria 4510
8 Ga0070683_100091121 3300005329 Bacteria 2863
9 Ga0070683_100244283 3300005329 Unclassified 1707
10 Ga0070683_100379647 3300005329 Unclassified 1347
11 Ga0070680_100042965 3300005336 Bacteria 3670
12 Ga0070680_100066058 3300005336 Bacteria 2965
13 Ga0070680_100080681 3300005336 Bacteria 2683
14 Ga0070660_100002536 3300005339 Bacteria 12518
15 Ga0070660_100002588 3300005339 Bacteria 12413
16 Ga0070660_100002791 3300005339 Bacteria 11997
17 Ga0070660_100283483 3300005339 Bacteria 1356
18 Ga0070661_100028456 3300005344 Bacteria 4031
19 Ga0070661_100038162 3300005344 Bacteria 3496
20 Ga0070661_100076059 3300005344 Bacteria 2474
21 Ga0070661_100169669 3300005344 Bacteria 1656
22 Ga0070661_100390746 3300005344 Bacteria 1098
23 Ga0070671_100503402 3300005355 Bacteria 1042
24 Ga0070674_100297097 3300005356 Bacteria 1286
25 Ga0070659_100032546 3300005366 Bacteria 4045
26 Ga0070659_100109674 3300005366 Bacteria 2228
27 Ga0070667_100052920 3300005367 Bacteria 3426
28 Ga0070709_10191543 3300005434 Bacteria 1443
29 Ga0070714_100074280 3300005435 Bacteria 2947
30 Ga0070714_100084082 3300005435 Bacteria 2776
31 Ga0070714_100636572 3300005435 Unclassified 1026
32 Ga0070713_100077959 3300005436 Bacteria 2819
33 Ga0070710_10153952 3300005437 Unclassified 1420
34 Ga0070711_100077320 3300005439 Unclassified 2362
35 Ga0070694_100102220 3300005444 Bacteria 2029
36 Ga0070708_100115341 3300005445 Bacteria 2472
37 Ga0070663_100140626 3300005455 Bacteria 1842
38 Ga0070678_100324328 3300005456 Bacteria 1316
39 Ga0070681_10006341 3300005458 Bacteria 11502
40 Ga0070681_10062653 3300005458 Bacteria 3692
41 Ga0070681_10109813 3300005458 Bacteria 2698
42 Ga0070681_10112606 3300005458 Bacteria 2661
43 Ga0070681_10174107 3300005458 Bacteria 2074
44 Ga0070681_10247870 3300005458 Bacteria 1694
45 Ga0070681_10339161 3300005458 Bacteria 1413
46 Ga0070706_100329428 3300005467 Bacteria 1424
47 Ga0070707_100306993 3300005468 Bacteria 1542
48 Ga0070679_100004917 3300005530 Bacteria 12329
49 Ga0070679_100008887 3300005530 Bacteria 9480
50 Ga0070679_100030937 3300005530 Bacteria 5287
51 Ga0070679_100045772 3300005530 Bacteria 4360
52 Ga0070679_100091018 3300005530 Bacteria 3038
53 Ga0070679_100650848 3300005530 Bacteria 996
54 Ga0070679_100698984 3300005530 Bacteria 957
55 Ga0070684_100050984 3300005535 Bacteria 3595
56 Ga0070684_100061661 3300005535 Bacteria 3283
57 Ga0070684_100244293 3300005535 Bacteria 1640
58 Ga0068853_100577995 3300005539 Bacteria 1066
59 Ga0070696_100027459 3300005546 Bacteria 3878
60 Ga0070665_100100147 3300005548 Bacteria 2902
61 Ga0068855_100071887 3300005563 Bacteria 4021
62 Ga0068855_100172808 3300005563 Bacteria 2446
63 Ga0068857_100025458 3300005577 Bacteria 5210
64 Ga0068857_100056650 3300005577 Bacteria 3478
65 Ga0068857_100237206 3300005577 Bacteria 1669
66 Ga0068856_100478034 3300005614 Bacteria 1267
67 Ga0068852_100077723 3300005616 Bacteria 2934
68 Ga0068852_100158072 3300005616 Bacteria 2113
69 Ga0081455_10060567 3300005937 Bacteria 3191
70 Ga0070717_10166366 3300006028 Bacteria 1915
71 Ga0070717_10843085 3300006028 Bacteria 834
72 Ga0070712_100354563 3300006175 Bacteria 1201
73 Ga0068871_100621508 3300006358 Bacteria 984
74 Ga0075434_100138680 3300006871 Bacteria 2452
75 Ga0105240_10059608 3300009093 Bacteria 4762
76 Ga0105240_10493746 3300009093 Bacteria 1362
77 Ga0105240_11166927 3300009093 Bacteria 817
78 Ga0105245_10440969 3300009098 Bacteria 1309
79 Ga0105243_10290189 3300009148 Bacteria 1477
80 Ga0105243_10604573 3300009148 Bacteria 1056
81 Ga0105241_10135168 3300009174 Bacteria 2001
82 Ga0105242_10028750 3300009176 Bacteria 4427
83 Ga0105237_10186806 3300009545 Bacteria 2072
84 Ga0105238_10129618 3300009551 Bacteria 2500
85 Ga0105238_10505017 3300009551 Bacteria 1210
86 Ga0105239_10154403 3300010375 Bacteria 2563
87 Ga0157370_10005691 3300013104 Bacteria 13930
88 Ga0157370_10013717 3300013104 Bacteria 8331
89 Ga0157370_10039933 3300013104 Bacteria 4533
90 Ga0157370_10048958 3300013104 Bacteria 4047
91 Ga0157370_10051021 3300013104 Bacteria 3953
92 Ga0157370_10514403 3300013104 Bacteria 1099
93 Ga0157369_10001416 3300013105 Bacteria 29494
94 Ga0157369_10036208 3300013105 Bacteria 5408
95 Ga0157369_10463777 3300013105 Bacteria 1311
96 Ga0157369_10479226 3300013105 Bacteria 1288
97 Ga0157374_10059938 3300013296 Bacteria 3560
98 Ga0157372_10138846 3300013307 Bacteria 2799
99 Ga0157372_10185653 3300013307 Bacteria 2408
100 Ga0157372_10230783 3300013307 Bacteria 2146
101 Ga0157375_10096200 3300013308 Bacteria 3034
102 Ga0182008_10068736 3300014497 Bacteria 1743
103 Ga0197907_10556612 3300020069 Bacteria 2389
104 Ga0206356_10329673 3300020070 Bacteria 3146
105 Ga0206356_11357368 3300020070 Bacteria 1066
106 Ga0206356_11822134 3300020070 Bacteria 1885
107 Ga0206354_10165242 3300020081 Unclassified 1892
108 Ga0206354_10941924 3300020081 Bacteria 4274
109 Ga0206354_10947822 3300020081 Bacteria 2098
110 Ga0206354_10967026 3300020081 Bacteria 2053
111 Ga0206353_11209468 3300020082 Bacteria 1321
112 Ga0206353_11342297 3300020082 Bacteria 5050
113 Ga0206353_11537554 3300020082 Bacteria 3130
114 Ga0206353_11764618 3300020082 Bacteria 4761
115 Ga0207647_10052707 3300025904 Bacteria 2510
116 Ga0207699_10315015 3300025906 Unclassified 1096
117 Ga0207705_10024153 3300025909 Bacteria 4338
118 Ga0207705_10174143 3300025909 Bacteria 1621
119 Ga0207705_10374627 3300025909 Bacteria 1099
120 Ga0207684_10162750 3300025910 Bacteria 1922
121 Ga0207707_10002474 3300025912 Bacteria 16635
122 Ga0207707_10110068 3300025912 Bacteria 2407
123 Ga0207707_10139621 3300025912 Bacteria 2119
124 Ga0207707_10311003 3300025912 Bacteria 1361
125 Ga0207707_10465360 3300025912 Bacteria 1081
126 Ga0207695_10128443 3300025913 Bacteria 2494
127 Ga0207695_10502399 3300025913 Bacteria 1095
128 Ga0207671_10047037 3300025914 Bacteria 3193
129 Ga0207671_10136428 3300025914 Bacteria 1887
130 Ga0207693_10128467 3300025915 Bacteria 1992
131 Ga0207663_10192260 3300025916 Bacteria 1466
132 Ga0207660_10030221 3300025917 Bacteria 3723
133 Ga0207660_10045772 3300025917 Bacteria 3084
134 Ga0207660_10056508 3300025917 Bacteria 2808
135 Ga0207657_10000331 3300025919 Bacteria 50115
136 Ga0207657_10083251 3300025919 Bacteria 2684
137 Ga0207657_10155001 3300025919 Bacteria 1863
138 Ga0207649_10018667 3300025920 Bacteria 3949
139 Ga0207649_10040813 3300025920 Bacteria 2823
140 Ga0207652_10015667 3300025921 Bacteria 6172
141 Ga0207652_10032453 3300025921 Bacteria 4390
142 Ga0207652_10051503 3300025921 Bacteria 3530
143 Ga0207652_10064311 3300025921 Bacteria 3174
144 Ga0207652_10079320 3300025921 Bacteria 2868
145 Ga0207652_10108440 3300025921 Bacteria 2460
146 Ga0207646_10038543 3300025922 Bacteria 4304
147 Ga0207646_10262277 3300025922 Bacteria 1561
148 Ga0207694_10017446 3300025924 Bacteria 5426
149 Ga0207687_10298248 3300025927 Unclassified 1297
150 Ga0207664_10068062 3300025929 Bacteria 2859
151 Ga0207644_10443164 3300025931 Bacteria 1066
152 Ga0207690_10398258 3300025932 Bacteria 1097
153 Ga0207709_10263863 3300025935 Bacteria 1264
154 Ga0207661_10054522 3300025944 Bacteria 3203
155 Ga0207661_10060608 3300025944 Bacteria 3054
156 Ga0207661_10109915 3300025944 Bacteria 2329
157 Ga0207661_10136751 3300025944 Unclassified 2105
158 Ga0207661_10167212 3300025944 Bacteria 1912
159 Ga0207679_10126191 3300025945 Bacteria 2045
160 Ga0207667_10028354 3300025949 Bacteria 6081
161 Ga0207667_10102088 3300025949 Bacteria 2958
162 Ga0207667_10105212 3300025949 Bacteria 2911
163 Ga0207667_10264734 3300025949 Bacteria 1758
164 Ga0207667_10273827 3300025949 Bacteria 1725
165 Ga0207640_10457573 3300025981 Bacteria 1053
166 Ga0207658_10011476 3300025986 Bacteria 6030
167 Ga0207639_10311861 3300026041 Bacteria 1394
168 Ga0207678_10104130 3300026067 Bacteria 2422
169 Ga0207678_10455047 3300026067 Bacteria 1113
170 Ga0207702_10497339 3300026078 Bacteria 1188
171 Ga0207702_10879669 3300026078 Bacteria 887
172 Ga0207674_10015292 3300026116 Bacteria 8437
173 Ga0207674_10058906 3300026116 Bacteria 3888
174 Ga0207674_10133174 3300026116 Bacteria 2449
175 Ga0207683_10023548 3300026121 Bacteria 5297
176 Ga0207683_10504220 3300026121 Unclassified 1118
177 Ga0207698_10177098 3300026142 Bacteria 1884
178 Ga0265334_10075098 3300028573 Bacteria 1253
179 Ga0265318_10112698 3300028577 Bacteria 1000
180 Ga0265336_10042134 3300028666 Bacteria 1394
181 Ga0265338_10009330 3300028800 Bacteria 11722
182 Ga0265330_10020944 3300031235 Bacteria 2988
183 Ga0265325_10020520 3300031241 Bacteria 3642
184 Ga0265339_10056365 3300031249 Bacteria 2128
185 Ga0265331_10029383 3300031250 Bacteria 2744
186 Ga0265327_10007969 3300031251 Bacteria 8011
187 Ga0265316_10034284 3300031344 Bacteria 4124
188 Ga0265314_10004860 3300031711 Bacteria 12290
189 Ga0373934_0075532 3300035086 Bacteria 1351
190 Ga0373943_0000896 3300035170 Bacteria 13120
191 Ga0373946_0006600 3300035171 Bacteria 4211
192 Ga0373955_0201408 3300035172 Bacteria 1185
193 Ga0373924_0025143 3300035410 Bacteria 2353
194 Ga0373935_0019317 3300035692 Bacteria 4156
195 Ga0373927_0018279 3300035695 Bacteria 4608
196 Ga0373937_0033351 3300036401 Bacteria 4675
197 Ga0373925_0014200 3300037068 Bacteria 5763
198 Ga0395899_0070154 3300037312 Bacteria 2565
199 Ga0395899_0099103 3300037312 Bacteria 2105
200 Ga0395899_0151690 3300037312 Bacteria 1642
201 Ga0395900_0023887 3300037418 Bacteria 6256
202 Ga0395900_0042534 3300037418 Bacteria 4682
203 Ga0395900_0071165 3300037418 Bacteria 3575
204 Ga0395900_0092788 3300037418 Bacteria 3102
205 Ga0395900_0118512 3300037418 Bacteria 2716
206 Ga0395900_0200842 3300037418 Unclassified 2017
207 Ga0395898_0002058 3300037466 Bacteria 25043
208 Ga0395898_0054388 3300037466 Bacteria 3906
209 Ga0395898_0058312 3300037466 Bacteria 3759
210 Ga0395898_0181653 3300037466 Bacteria 2010
211 Ga0395905_0058680 3300037471 Bacteria 3598
212 Ga0395905_0235066 3300037471 Bacteria 1713
213 Ga0395901_0003418 3300038443 Bacteria 15999
214 Ga0395901_0018903 3300038443 Bacteria 7044
215 Ga0395901_0020356 3300038443 Bacteria 6792
216 Ga0395901_0066894 3300038443 Bacteria 3742
217 Ga0395901_0096371 3300038443 Bacteria 3100
218 Ga0395901_0224584 3300038443 Bacteria 1962
219 Ga0395901_0473221 3300038443 Unclassified 1279
220 Ga0436365_0435272 3300039437 Bacteria 2713
221 Ga0436363_0976355 3300039450 Bacteria 4207
222 Ga0451853_0776811 3300041512 Bacteria 810
223 Ga0439448_0019376 3300042005 Bacteria 2094
224 Ga0466965_0077876 3300044683 Bacteria 1674
225 Ga0466966_0015118 3300044684 Bacteria 5106
226 Ga0466966_0038386 3300044684 Bacteria 3086
227 Ga0466961_0015582 3300044693 Bacteria 4877
228 Ga0466961_0128345 3300044693 Bacteria 1590
229 Ga0466963_0001066 3300044694 Bacteria 14288
230 Ga0466963_0005130 3300044694 Bacteria 7650
231 Ga0466963_0017763 3300044694 Bacteria 4437
232 Ga0466963_0032451 3300044694 Bacteria 3382
233 Ga0466963_0254685 3300044694 Unclassified 1232
234 Ga0466963_0305784 3300044694 Bacteria 1118
235 Ga0466963_0489172 3300044694 Bacteria 869
236 Ga0466964_0024661 3300044706 Bacteria 2344
237 Ga0466964_0055071 3300044706 Bacteria 1641
238 Ga0466971_0002047 3300044719 Bacteria 8537
239 Ga0466971_0019742 3300044719 Bacteria 2994
240 Ga0466968_0060425 3300044735 Bacteria 1634
241 Ga0466970_0020055 3300044765 Bacteria 3470
242 Ga0466970_0265812 3300044765 Bacteria 963
243 Ga0466957_0061769 3300044842 Bacteria 2300
244 Ga0466957_0064293 3300044842 Bacteria 2257
245 Ga0466957_0339307 3300044842 Bacteria 1017
246 Ga0466959_0018388 3300045049 Bacteria 5129
247 Ga0466959_0063461 3300045049 Bacteria 2682
248 Ga0466959_0120338 3300045049 Bacteria 1867
249 Ga0466959_0321429 3300045049 Bacteria 1058
250 Ga0466959_0369573 3300045049 Bacteria 977
251 Ga0466958_0004000 3300045836 Bacteria 7727
252 Ga0466958_0012267 3300045836 Bacteria 4851
253 Ga0466958_0072426 3300045836 Bacteria 2110
254 Ga0466967_0000905 3300045976 Bacteria 15884
255 Ga0466967_0002717 3300045976 Bacteria 11184
256 Ga0466967_0006063 3300045976 Bacteria 8498
257 Ga0466967_0027981 3300045976 Bacteria 4698
258 Ga0466967_0083876 3300045976 Bacteria 2882
259 Ga0466967_0085223 3300045976 Bacteria 2860
260 Ga0466967_0120719 3300045976 Bacteria 2421
261 Ga0466967_0128674 3300045976 Bacteria 2348
262 Ga0466967_0228854 3300045976 Bacteria 1769
263 Ga0466967_0565239 3300045976 Bacteria 1120
264 Ga0466967_0986914 3300045976 Bacteria 838
265 Ga0495592_0017729 3300046454 Bacteria 5411
266 Ga0495592_0192747 3300046454 Bacteria 1380
267 Ga0495629_0004127 3300046459 Bacteria 10893
268 Ga0495629_0201455 3300046459 Bacteria 1376
269 Ga0495629_0433204 3300046459 Bacteria 891
270 Ga0495641_0003032 3300046461 Bacteria 12847
271 Ga0495641_0043538 3300046461 Bacteria 2076
272 Ga0495651_0087054 3300046462 Bacteria 2349
273 Ga0495651_0122265 3300046462 Bacteria 1911
274 Ga0495653_0070345 3300046463 Bacteria 2619
275 Ga0495653_0120552 3300046463 Bacteria 1870
276 Ga0495582_0000050 3300046473 Bacteria 59164
277 Ga0495605_0048149 3300046474 Bacteria 2088
278 Ga0495639_0000657 3300046475 Bacteria 15977
279 Ga0495639_0027504 3300046475 Bacteria 2518
280 Ga0495662_0037416 3300046476 Bacteria 2343
281 Ga0495662_0040425 3300046476 Bacteria 2252
282 Ga0495664_0163941 3300046477 Bacteria 1348
283 Ga0495594_0052500 3300046499 Bacteria 2244
284 Ga0495608_0011046 3300046511 Bacteria 6293
285 Ga0495618_0061084 3300046514 Bacteria 2390
286 Ga0495618_0061786 3300046514 Bacteria 2376
287 Ga0495628_0023477 3300046516 Bacteria 5061
288 Ga0495628_0185924 3300046516 Bacteria 1570
289 Ga0495630_0043854 3300046517 Bacteria 3342
290 Ga0495630_0046991 3300046517 Bacteria 3227
291 Ga0495630_0101095 3300046517 Unclassified 2181
292 Ga0495630_0475010 3300046517 Bacteria 958
293 Ga0495652_0018011 3300046529 Bacteria 6301
294 Ga0495652_0169439 3300046529 Bacteria 1687
295 Ga0495652_0172237 3300046529 Bacteria 1669
296 Ga0495652_0236003 3300046529 Bacteria 1364
297 Ga0495665_0001845 3300046531 Bacteria 11447
298 Ga0495640_0004883 3300046533 Bacteria 10670
299 Ga0495640_0033014 3300046533 Bacteria 3681
300 Ga0495640_0072835 3300046533 Bacteria 2301
301 Ga0495640_0172009 3300046533 Bacteria 1383
302 Ga0495586_0176962 3300046535 Bacteria 1206
303 Ga0495587_0011929 3300046536 Bacteria 5493
304 Ga0495587_0027665 3300046536 Bacteria 3452
305 Ga0495587_0098034 3300046536 Bacteria 1690
306 Ga0495645_0043585 3300046543 Bacteria 3273
307 Ga0495645_0069556 3300046543 Bacteria 2541
308 Ga0495645_0153457 3300046543 Bacteria 1598
309 Ga0495667_0005529 3300046559 Bacteria 8545
310 Ga0495667_0025202 3300046559 Bacteria 4009
311 Ga0495667_0057567 3300046559 Bacteria 2554
312 Ga0495634_0007348 3300046642 Bacteria 8290
313 Ga0495635_0004530 3300046663 Bacteria 9633
314 Ga0495635_0024186 3300046663 Bacteria 4236
315 Ga0495635_0039891 3300046663 Bacteria 3247
316 Ga0495635_0186601 3300046663 Bacteria 1408
317 Ga0495588_0120382 3300046674 Bacteria 1384
318 Ga0495599_0011033 3300046678 Bacteria 5547
319 Ga0495599_0058010 3300046678 Bacteria 2422
320 Ga0495623_0070577 3300046679 Bacteria 2176
321 Ga0495623_0112271 3300046679 Bacteria 1650
322 Ga0495646_0014165 3300046680 Bacteria 5070
323 Ga0495647_0000524 3300046681 Bacteria 11225
324 Ga0495658_0000020 3300046683 Bacteria 87200
325 Ga0495613_0008021 3300046689 Bacteria 7855
326 Ga0495613_0034245 3300046689 Bacteria 3773
327 Ga0495624_0012360 3300046690 Bacteria 5839
328 Ga0495600_0002842 3300046809 Bacteria 10072
329 Ga0495581_0003771 3300047315 Bacteria 8725
330 Ga0495581_0280354 3300047315 Bacteria 974
331 Ga0495604_0004326 3300047317 Bacteria 11243
332 Ga0495604_0085632 3300047317 Bacteria 2351
333 Ga0495604_0160020 3300047317 Unclassified 1592
334 Ga0495674_0001037 3300047319 Bacteria 26704
335 Ga0495674_0102696 3300047319 Bacteria 2431
336 Ga0495674_0102810 3300047319 Bacteria 2430
337 Ga0495674_0118407 3300047319 Bacteria 2239
338 Ga0495674_0616433 3300047319 Unclassified 858
339 Ga0495680_0002190 3300047322 Bacteria 20224
340 Ga0495680_0004639 3300047322 Bacteria 13093
341 Ga0495680_0037945 3300047322 Bacteria 3855
342 Ga0495675_0026729 3300047444 Bacteria 3680
343 Ga0495684_0023930 3300047471 Bacteria 4697
344 Ga0495684_0029738 3300047471 Bacteria 4192
345 Ga0495593_0003418 3300047673 Bacteria 9502
346 Ga0495602_0060679 3300048088 Bacteria 3293
347 Ga0495602_0069454 3300048088 Bacteria 3020
348 Ga0495602_0385317 3300048088 Unclassified 1003
349 Ga0496100_0008056 3300048903 Bacteria 5856
350 Ga0496100_0156911 3300048903 Bacteria 1628
351 Ga0496101_0001926 3300048904 Bacteria 12561
352 Ga0496101_0003457 3300048904 Bacteria 9853
353 Ga0496102_0131621 3300048905 Bacteria 2342
354 Ga0496103_0084849 3300048906 Bacteria 1995
355 Ga0496104_0022976 3300048907 Bacteria 5731
356 Ga0496104_0131069 3300048907 Bacteria 2408
357 Ga0496105_0029531 3300048908 Bacteria 4488
358 Ga0496105_0036085 3300048908 Bacteria 4071
359 Ga0496105_0091709 3300048908 Bacteria 2509
360 Ga0496105_0192550 3300048908 Bacteria 1667
361 Ga0496106_0002271 3300048909 Bacteria 14332
362 Ga0496106_0191081 3300048909 Bacteria 1628
363 Ga0496107_0044972 3300048910 Unclassified 3175
364 Ga0496107_0048543 3300048910 Bacteria 3058
365 Ga0496107_0050584 3300048910 Bacteria 2996
366 Ga0496107_0262502 3300048910 Bacteria 1285
367 Ga0496108_0128670 3300048911 Bacteria 2176
368 Ga0496110_0100468 3300048913 Bacteria 2593
369 Ga0496112_0011715 3300048915 Bacteria 8025
370 Ga0496112_0017815 3300048915 Bacteria 6684
371 Ga0496112_0085145 3300048915 Bacteria 3128
372 Ga0496112_0439349 3300048915 Bacteria 1243
373 Ga0496112_0615881 3300048915 Bacteria 1017
374 Ga0496114_0006389 3300048917 Bacteria 9281
375 Ga0496114_0008687 3300048917 Bacteria 8050
376 Ga0496114_0116406 3300048917 Bacteria 2295
377 Ga0496114_0155331 3300048917 Unclassified 1986
378 Ga0496114_0575101 3300048917 Bacteria 994
379 Ga0496115_0011785 3300048918 Bacteria 6565
380 Ga0496115_0033161 3300048918 Bacteria 4076
381 Ga0501040_0063116 3300049576 Bacteria 2549
382 Ga0501046_0164724 3300049580 Bacteria 1666
383 Ga0501047_0072341 3300049581 Bacteria 3319
384 Ga0501047_0259669 3300049581 Bacteria 1585
385 Ga0501067_0002759 3300049583 Bacteria 9667
386 Ga0501068_0147986 3300049584 Bacteria 1475
387 Ga0501069_0000719 3300049585 Bacteria 15415
388 Ga0501070_0347504 3300049586 Bacteria 1204
389 Ga0501070_0391417 3300049586 Bacteria 1125
390 Ga0501071_0668522 3300049587 Bacteria 799
391 Ga0501072_0183351 3300049588 Bacteria 1670
392 Ga0501072_0290422 3300049588 Bacteria 1300
393 Ga0501074_0039418 3300049590 Bacteria 3422
394 Ga0501074_0257041 3300049590 Bacteria 1242
395 Ga0501075_0201483 3300049591 Bacteria 1518
396 Ga0501077_0015811 3300049593 Bacteria 4753
397 Ga0501077_0458107 3300049593 Bacteria 817
398 Ga0501079_0250601 3300049741 Bacteria 1384
399 Ga0501079_0430463 3300049741 Bacteria 1036
400 Ga0501080_0037795 3300049742 Bacteria 4508
401 Ga0501080_0120179 3300049742 Bacteria 2435
402 Ga0501080_0404194 3300049742 Bacteria 1228
403 Ga0501035_0190027 3300049822 Bacteria 1766
404 Ga0501035_0412617 3300049822 Bacteria 1122
405 Ga0501045_0393541 3300049824 Bacteria 1031
406 nmdc:mga0n895_16474_c1 3300050512 Bacteria 6783
407 nmdc:mga08x19_55502_c1 3300050514 Bacteria 2553
408 Ga0495601_0021140 3300053077 Bacteria 3982
409 Ga0495612_0034045 3300053078 Bacteria 2062
410 Ga0495612_0095973 3300053078 Unclassified 1259
411 Ga0495655_0012089 3300053083 Bacteria 1751
412 Ga0495595_0005798 3300053084 Bacteria 5000
413 Ga0495619_0009058 3300053085 Bacteria 6280
414 Ga0495619_0027086 3300053085 Bacteria 3692
415 Ga0466962_0042652 3300061719 Bacteria 2171
416 Ga0466962_0100434 3300061719 Bacteria 1389
417 Ga0530510_0033455 3300061734 Bacteria 3701
418 Ga0466963_0043047
419 rootH1_10153720
420 Ga0070658_10006698
421 Ga0070658_10138258
422 Ga0070658_10218709
423 Ga0070658_10672458
424 Ga0070683_100036299
425 Ga0070683_100091121
426 Ga0070683_100244283
427 Ga0070683_100379647
428 Ga0070680_100042965
429 Ga0070680_100066058
430 Ga0070680_100080681
431 Ga0070660_100002536
432 Ga0070660_100002588
433 Ga0070660_100002791
434 Ga0070660_100283483
435 Ga0070661_100028456
436 Ga0070661_100038162
437 Ga0070661_100076059
438 Ga0070661_100169669
439 Ga0070661_100390746
440 Ga0070671_100503402
441 Ga0070674_100297097
442 Ga0070659_100032546
443 Ga0070659_100109674
444 Ga0070667_100052920
445 Ga0070709_10191543
446 Ga0070714_100074280
447 Ga0070714_100084082
448 Ga0070714_100636572
449 Ga0070713_100077959
450 Ga0070710_10153952
451 Ga0070711_100077320
452 Ga0070694_100102220
453 Ga0070708_100115341
454 Ga0070663_100140626
455 Ga0070678_100324328
456 Ga0070681_10006341
457 Ga0070681_10062653
458 Ga0070681_10109813
459 Ga0070681_10112606
460 Ga0070681_10174107
461 Ga0070681_10247870
462 Ga0070681_10339161
463 Ga0070706_100329428
464 Ga0070707_100306993
465 Ga0070679_100004917
466 Ga0070679_100008887
467 Ga0070679_100030937
468 Ga0070679_100045772
469 Ga0070679_100091018
470 Ga0070679_100650848
471 Ga0070679_100698984
472 Ga0070684_100050984
473 Ga0070684_100061661
474 Ga0070684_100244293
475 Ga0068853_100577995
476 Ga0070696_100027459
477 Ga0070665_100100147
478 Ga0068855_100071887
479 Ga0068855_100172808
480 Ga0068857_100025458
481 Ga0068857_100056650
482 Ga0068857_100237206
483 Ga0068856_100478034
484 Ga0068852_100077723
485 Ga0068852_100158072
486 Ga0081455_10060567
487 Ga0070717_10166366
488 Ga0070717_10843085
489 Ga0070712_100354563
490 Ga0068871_100621508
491 Ga0075434_100138680
492 Ga0105240_10059608
493 Ga0105240_10493746
494 Ga0105240_11166927
495 Ga0105245_10440969
496 Ga0105243_10290189
497 Ga0105243_10604573
498 Ga0105241_10135168
499 Ga0105242_10028750
500 Ga0105237_10186806
501 Ga0105238_10129618
502 Ga0105238_10505017
503 Ga0105239_10154403
504 Ga0157370_10005691
505 Ga0157370_10013717
506 Ga0157370_10039933
507 Ga0157370_10048958
508 Ga0157370_10051021
509 Ga0157370_10514403
510 Ga0157369_10001416
511 Ga0157369_10036208
512 Ga0157369_10463777
513 Ga0157369_10479226
514 Ga0157374_10059938
515 Ga0157372_10138846
516 Ga0157372_10185653
517 Ga0157372_10230783
518 Ga0157375_10096200
519 Ga0182008_10068736
520 Ga0197907_10556612
521 Ga0206356_10329673
522 Ga0206356_11357368
523 Ga0206356_11822134
524 Ga0206354_10165242
525 Ga0206354_10941924
526 Ga0206354_10947822
527 Ga0206354_10967026
528 Ga0206353_11209468
529 Ga0206353_11342297
530 Ga0206353_11537554
531 Ga0206353_11764618
532 Ga0207647_10052707
533 Ga0207699_10315015
534 Ga0207705_10024153
535 Ga0207705_10174143
536 Ga0207705_10374627
537 Ga0207684_10162750
538 Ga0207707_10002474
539 Ga0207707_10110068
540 Ga0207707_10139621
541 Ga0207707_10311003
542 Ga0207707_10465360
543 Ga0207695_10128443
544 Ga0207695_10502399
545 Ga0207671_10047037
546 Ga0207671_10136428
547 Ga0207693_10128467
548 Ga0207663_10192260
549 Ga0207660_10030221
550 Ga0207660_10045772
551 Ga0207660_10056508
552 Ga0207657_10000331
553 Ga0207657_10083251
554 Ga0207657_10155001
555 Ga0207649_10018667
556 Ga0207649_10040813
557 Ga0207652_10015667
558 Ga0207652_10032453
559 Ga0207652_10051503
560 Ga0207652_10064311
561 Ga0207652_10079320
562 Ga0207652_10108440
563 Ga0207646_10038543
564 Ga0207646_10262277
565 Ga0207694_10017446
566 Ga0207687_10298248
567 Ga0207664_10068062
568 Ga0207644_10443164
569 Ga0207690_10398258
570 Ga0207709_10263863
571 Ga0207661_10054522
572 Ga0207661_10060608
573 Ga0207661_10109915
574 Ga0207661_10136751
575 Ga0207661_10167212
576 Ga0207679_10126191
577 Ga0207667_10028354
578 Ga0207667_10102088
579 Ga0207667_10105212
580 Ga0207667_10264734
581 Ga0207667_10273827
582 Ga0207640_10457573
583 Ga0207658_10011476
584 Ga0207639_10311861
585 Ga0207678_10104130
586 Ga0207678_10455047
587 Ga0207702_10497339
588 Ga0207702_10879669
589 Ga0207674_10015292
590 Ga0207674_10058906
591 Ga0207674_10133174
592 Ga0207683_10023548
593 Ga0207683_10504220
594 Ga0207698_10177098
595 Ga0265334_10075098
596 Ga0265318_10112698
597 Ga0265336_10042134
598 Ga0265338_10009330
599 Ga0265330_10020944
600 Ga0265325_10020520
601 Ga0265339_10056365
602 Ga0265331_10029383
603 Ga0265327_10007969
604 Ga0265316_10034284
605 Ga0265314_10004860
606 Ga0373934_0075532
607 Ga0373943_0000896
608 Ga0373946_0006600
609 Ga0373955_0201408
610 Ga0373924_0025143
611 Ga0373935_0019317
612 Ga0373927_0018279
613 Ga0373937_0033351
614 Ga0373925_0014200
615 Ga0395899_0070154
616 Ga0395899_0099103
617 Ga0395899_0151690
618 Ga0395900_0023887
619 Ga0395900_0042534
620 Ga0395900_0071165
621 Ga0395900_0092788
622 Ga0395900_0118512
623 Ga0395900_0200842
624 Ga0395898_0002058
625 Ga0395898_0054388
626 Ga0395898_0058312
627 Ga0395898_0181653
628 Ga0395905_0058680
629 Ga0395905_0235066
630 Ga0395901_0003418
631 Ga0395901_0018903
632 Ga0395901_0020356
633 Ga0395901_0066894
634 Ga0395901_0096371
635 Ga0395901_0224584
636 Ga0395901_0473221
637 Ga0436365_0435272
638 Ga0436363_0976355
639 Ga0451853_0776811
640 Ga0439448_0019376
641 Ga0466965_0077876
642 Ga0466966_0015118
643 Ga0466966_0038386
644 Ga0466961_0015582
645 Ga0466961_0128345
646 Ga0466963_0001066
647 Ga0466963_0005130
648 Ga0466963_0017763
649 Ga0466963_0032451
650 Ga0466963_0254685
651 Ga0466963_0305784
652 Ga0466963_0489172
653 Ga0466964_0024661
654 Ga0466964_0055071
655 Ga0466971_0002047
656 Ga0466971_0019742
657 Ga0466968_0060425
658 Ga0466970_0020055
659 Ga0466970_0265812
660 Ga0466957_0061769
661 Ga0466957_0064293
662 Ga0466957_0339307
663 Ga0466959_0018388
664 Ga0466959_0063461
665 Ga0466959_0120338
666 Ga0466959_0321429
667 Ga0466959_0369573
668 Ga0466958_0004000
669 Ga0466958_0012267
670 Ga0466958_0072426
671 Ga0466967_0000905
672 Ga0466967_0002717
673 Ga0466967_0006063
674 Ga0466967_0027981
675 Ga0466967_0083876
676 Ga0466967_0085223
677 Ga0466967_0120719
678 Ga0466967_0128674
679 Ga0466967_0228854
680 Ga0466967_0565239
681 Ga0466967_0986914
682 Ga0495592_0017729
683 Ga0495592_0192747
684 Ga0495629_0004127
685 Ga0495629_0201455
686 Ga0495629_0433204
687 Ga0495641_0003032
688 Ga0495641_0043538
689 Ga0495651_0087054
690 Ga0495651_0122265
691 Ga0495653_0070345
692 Ga0495653_0120552
693 Ga0495582_0000050
694 Ga0495605_0048149
695 Ga0495639_0000657
696 Ga0495639_0027504
697 Ga0495662_0037416
698 Ga0495662_0040425
699 Ga0495664_0163941
700 Ga0495594_0052500
701 Ga0495608_0011046
702 Ga0495618_0061084
703 Ga0495618_0061786
704 Ga0495628_0023477
705 Ga0495628_0185924
706 Ga0495630_0043854
707 Ga0495630_0046991
708 Ga0495630_0101095
709 Ga0495630_0475010
710 Ga0495652_0018011
711 Ga0495652_0169439
712 Ga0495652_0172237
713 Ga0495652_0236003
714 Ga0495665_0001845
715 Ga0495640_0004883
716 Ga0495640_0033014
717 Ga0495640_0072835
718 Ga0495640_0172009
719 Ga0495586_0176962
720 Ga0495587_0011929
721 Ga0495587_0027665
722 Ga0495587_0098034
723 Ga0495645_0043585
724 Ga0495645_0069556
725 Ga0495645_0153457
726 Ga0495667_0005529
727 Ga0495667_0025202
728 Ga0495667_0057567
729 Ga0495634_0007348
730 Ga0495635_0004530
731 Ga0495635_0024186
732 Ga0495635_0039891
733 Ga0495635_0186601
734 Ga0495588_0120382
735 Ga0495599_0011033
736 Ga0495599_0058010
737 Ga0495623_0070577
738 Ga0495623_0112271
739 Ga0495646_0014165
740 Ga0495647_0000524
741 Ga0495658_0000020
742 Ga0495613_0008021
743 Ga0495613_0034245
744 Ga0495624_0012360
745 Ga0495600_0002842
746 Ga0495581_0003771
747 Ga0495581_0280354
748 Ga0495604_0004326
749 Ga0495604_0085632
750 Ga0495604_0160020
751 Ga0495674_0001037
752 Ga0495674_0102696
753 Ga0495674_0102810
754 Ga0495674_0118407
755 Ga0495674_0616433
756 Ga0495680_0002190
757 Ga0495680_0004639
758 Ga0495680_0037945
759 Ga0495675_0026729
760 Ga0495684_0023930
761 Ga0495684_0029738
762 Ga0495593_0003418
763 Ga0495602_0060679
764 Ga0495602_0069454
765 Ga0495602_0385317
766 Ga0496100_0008056
767 Ga0496100_0156911
768 Ga0496101_0001926
769 Ga0496101_0003457
770 Ga0496102_0131621
771 Ga0496103_0084849
772 Ga0496104_0022976
773 Ga0496104_0131069
774 Ga0496105_0029531
775 Ga0496105_0036085
776 Ga0496105_0091709
777 Ga0496105_0192550
778 Ga0496106_0002271
779 Ga0496106_0191081
780 Ga0496107_0044972
781 Ga0496107_0048543
782 Ga0496107_0050584
783 Ga0496107_0262502
784 Ga0496108_0128670
785 Ga0496110_0100468
786 Ga0496112_0011715
787 Ga0496112_0017815
788 Ga0496112_0085145
789 Ga0496112_0439349
790 Ga0496112_0615881
791 Ga0496114_0006389
792 Ga0496114_0008687
793 Ga0496114_0116406
794 Ga0496114_0155331
795 Ga0496114_0575101
796 Ga0496115_0011785
797 Ga0496115_0033161
798 Ga0501040_0063116
799 Ga0501046_0164724
800 Ga0501047_0072341
801 Ga0501047_0259669
802 Ga0501067_0002759
803 Ga0501068_0147986
804 Ga0501069_0000719
805 Ga0501070_0347504
806 Ga0501070_0391417
807 Ga0501071_0668522
808 Ga0501072_0183351
809 Ga0501072_0290422
810 Ga0501074_0039418
811 Ga0501074_0257041
812 Ga0501075_0201483
813 Ga0501077_0015811
814 Ga0501077_0458107
815 Ga0501079_0250601
816 Ga0501079_0430463
817 Ga0501080_0037795
818 Ga0501080_0120179
819 Ga0501080_0404194
820 Ga0501035_0190027
821 Ga0501035_0412617
822 Ga0501045_0393541
823 nmdc:mga0n895_16474_c1
824 nmdc:mga08x19_55502_c1
825 Ga0495601_0021140
826 Ga0495612_0034045
827 Ga0495612_0095973
828 Ga0495655_0012089
829 Ga0495595_0005798
830 Ga0495619_0009058
831 Ga0495619_0027086
832 Ga0466962_0042652
833 Ga0466962_0100434
834 Ga0530510_0033455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

53

226

0.83

Map