F439101

General Info

Members Datasets Scaffolds Average Seq Length
417 217 834 149

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0000042|Ga0373925_0000042_4591_5103
Length 170
Sequence MVVQPAHAPLCPSGNCGKVGKMKHNRSVPPATVVPVLSYPDVRAAVAWLGAAFGFAERTRIGESHRAQMSIGADGAVIVAERRGGKPSADDAVTHLIRVRVEDVRAQFERARAHGAPVLEPPTDREYGERDCTVEDLAGHRWQFAETVRDVAPEDFGCMTVAPWPGRPGA

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0
Rhizoplane 9.83
Rhizosphere 86.33
Stem 0
Stem Tuber 0
Unclassified 22.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0000042 3300037068 Bacteria 135547
2 Ga0070658_10293623 3300005327 Bacteria 1385
3 Ga0070658_11313615 3300005327 Unclassified 628
4 Ga0070683_100032655 3300005329 Bacteria 4741
5 Ga0070680_100667404 3300005336 Unclassified 894
6 Ga0070660_100607692 3300005339 Bacteria 914
7 Ga0070689_100378093 3300005340 Archaea 1193
8 Ga0070691_10192544 3300005341 Archaea 1067
9 Ga0070692_10315831 3300005345 Bacteria 959
10 Ga0070671_100734817 3300005355 Bacteria 857
11 Ga0070674_100099459 3300005356 Bacteria 2116
12 Ga0070688_100334886 3300005365 Archaea 1103
13 Ga0070709_10121722 3300005434 Bacteria 1770
14 Ga0070714_100424452 3300005435 Unclassified 1260
15 Ga0070714_100598204 3300005435 Bacteria 1059
16 Ga0070713_100009594 3300005436 Bacteria 6943
17 Ga0070713_100022095 3300005436 Bacteria 4910
18 Ga0070710_10000865 3300005437 Bacteria 14521
19 Ga0070710_10576874 3300005437 Bacteria 780
20 Ga0070711_100001298 3300005439 Bacteria 13594
21 Ga0070700_100393074 3300005441 Archaea 1040
22 Ga0070708_100413814 3300005445 Unclassified 1271
23 Ga0070708_102104167 3300005445 Unclassified 522
24 Ga0070678_100256849 3300005456 Unclassified 1468
25 Ga0070678_101462984 3300005456 Bacteria 639
26 Ga0068867_100008142 3300005459 Bacteria 7408
27 Ga0070706_100030428 3300005467 Bacteria 4974
28 Ga0070706_100527639 3300005467 Bacteria 1098
29 Ga0070707_100125829 3300005468 Unclassified 2490
30 Ga0070698_100208698 3300005471 Bacteria 1888
31 Ga0070698_100453412 3300005471 Unclassified 1218
32 Ga0070698_100554266 3300005471 Unclassified 1089
33 Ga0070699_100431900 3300005518 Unclassified 1193
34 Ga0070699_101591649 3300005518 Bacteria 599
35 Ga0070679_100853371 3300005530 Bacteria 854
36 Ga0070684_100350613 3300005535 Bacteria 1358
37 Ga0070684_100651711 3300005535 Bacteria 980
38 Ga0070697_100612806 3300005536 Unclassified 957
39 Ga0070686_100260452 3300005544 Archaea 1271
40 Ga0068855_100070839 3300005563 Bacteria 4055
41 Ga0068855_100493868 3300005563 Unclassified 1331
42 Ga0068855_100974457 3300005563 Bacteria 892
43 Ga0070664_100467748 3300005564 Unclassified 1159
44 Ga0068857_101215222 3300005577 Bacteria 730
45 Ga0068856_100180681 3300005614 Bacteria 2123
46 Ga0070702_100070700 3300005615 Bacteria 2061
47 Ga0070702_100096734 3300005615 Bacteria 1802
48 Ga0068859_102042324 3300005617 Unclassified 633
49 Ga0068866_10014040 3300005718 Unclassified 3527
50 Ga0068866_10651989 3300005718 Bacteria 717
51 Ga0068866_11022440 3300005718 Bacteria 588
52 Ga0068863_100227185 3300005841 Bacteria 1800
53 Ga0068863_100462758 3300005841 Bacteria 1246
54 Ga0068858_100498179 3300005842 Unclassified 1177
55 Ga0081455_10009972 3300005937 Bacteria 9711
56 Ga0081455_10018860 3300005937 Bacteria 6545
57 Ga0081455_10033684 3300005937 Bacteria 4600
58 Ga0081455_10037511 3300005937 Bacteria 4303
59 Ga0081455_10046775 3300005937 Bacteria 3751
60 Ga0081540_1231145 3300005983 Bacteria 653
61 Ga0070717_10005881 3300006028 Bacteria 8982
62 Ga0070717_10026251 3300006028 Bacteria 4646
63 Ga0070717_10060542 3300006028 Unclassified 3135
64 Ga0075363_100000456 3300006048 Bacteria 12812
65 Ga0075363_100264382 3300006048 Bacteria 993
66 Ga0075364_10002490 3300006051 Bacteria 10316
67 Ga0070715_10226029 3300006163 Bacteria 965
68 Ga0070716_100000451 3300006173 Bacteria 16997
69 Ga0070716_100991386 3300006173 Unclassified 664
70 Ga0070712_100006299 3300006175 Bacteria 7354
71 Ga0070712_100237688 3300006175 Bacteria 1450
72 Ga0070712_100981242 3300006175 Unclassified 731
73 Ga0075367_10425218 3300006178 Bacteria 841
74 Ga0075369_10018306 3300006186 Bacteria 2851
75 Ga0097621_100219257 3300006237 Unclassified 1657
76 Ga0097621_100379428 3300006237 Archaea 1262
77 Ga0097621_100812524 3300006237 Bacteria 867
78 Ga0075370_10023329 3300006353 Bacteria 3407
79 Ga0068871_100084156 3300006358 Archaea 2639
80 Ga0068871_100799930 3300006358 Bacteria 869
81 Ga0068865_100178851 3300006881 Archaea 1632
82 Ga0068865_100234533 3300006881 Bacteria 1441
83 Ga0097620_102042115 3300006931 Unclassified 633
84 Ga0075435_100723975 3300007076 Bacteria 865
85 Ga0099794_10632351 3300007265 Bacteria 568
86 Ga0105240_10775523 3300009093 Bacteria 1040
87 Ga0111539_10246286 3300009094 Bacteria 2081
88 Ga0111539_11057997 3300009094 Bacteria 943
89 Ga0105245_10080826 3300009098 Bacteria 2970
90 Ga0105245_10640718 3300009098 Bacteria 1092
91 Ga0105247_10659398 3300009101 Bacteria 783
92 Ga0105243_10039773 3300009148 Bacteria 3669
93 Ga0105243_10319834 3300009148 Bacteria 1413
94 Ga0105243_10824047 3300009148 Unclassified 917
95 Ga0105242_10168316 3300009176 Archaea 1924
96 Ga0105248_10111882 3300009177 Bacteria 3080
97 Ga0105248_10683322 3300009177 Archaea 1158
98 Ga0105237_10647491 3300009545 Bacteria 1063
99 Ga0157370_10031575 3300013104 Bacteria 5179
100 Ga0157378_10169719 3300013297 Bacteria 2045
101 Ga0157378_10842048 3300013297 Bacteria 945
102 Ga0163162_10496263 3300013306 Archaea 1351
103 Ga0157375_10077861 3300013308 Bacteria 3347
104 Ga0157375_10245756 3300013308 Bacteria 1950
105 Ga0157375_10938876 3300013308 Bacteria 1007
106 Ga0157375_11902800 3300013308 Bacteria 706
107 Ga0163163_10039365 3300014325 Bacteria 4614
108 Ga0163163_10231934 3300014325 Unclassified 1895
109 Ga0163163_12482956 3300014325 Bacteria 576
110 Ga0157380_10722960 3300014326 Unclassified 1003
111 Ga0157379_10067809 3300014968 Bacteria 3189
112 Ga0157379_10882791 3300014968 Bacteria 847
113 Ga0157376_10235483 3300014969 Unclassified 1703
114 Ga0157376_11159093 3300014969 Bacteria 800
115 Ga0163161_10295315 3300017792 Archaea 1275
116 Ga0213873_10065852 3300021358 Unclassified 990
117 Ga0213876_10007598 3300021384 Bacteria 5884
118 Ga0213875_10055105 3300021388 Bacteria 1862
119 Ga0207692_10000952 3300025898 Bacteria 10522
120 Ga0207692_10690057 3300025898 Bacteria 662
121 Ga0207642_10086225 3300025899 Archaea 1538
122 Ga0207685_10112711 3300025905 Bacteria 1181
123 Ga0207699_10000719 3300025906 Bacteria 15825
124 Ga0207699_10239282 3300025906 Unclassified 1246
125 Ga0207684_10039915 3300025910 Bacteria 3979
126 Ga0207684_10048135 3300025910 Unclassified 3616
127 Ga0207671_10324082 3300025914 Bacteria 1219
128 Ga0207693_10003769 3300025915 Bacteria 12921
129 Ga0207693_10310639 3300025915 Bacteria 1234
130 Ga0207663_10001616 3300025916 Bacteria 10610
131 Ga0207660_11210836 3300025917 Unclassified 614
132 Ga0207662_10171603 3300025918 Unclassified 1391
133 Ga0207646_10054926 3300025922 Unclassified 3562
134 Ga0207646_10362268 3300025922 Bacteria 1310
135 Ga0207687_10395131 3300025927 Bacteria 1136
136 Ga0207700_10007189 3300025928 Bacteria 6788
137 Ga0207700_10202102 3300025928 Bacteria 1675
138 Ga0207700_10439820 3300025928 Bacteria 1148
139 Ga0207700_11894591 3300025928 Unclassified 522
140 Ga0207664_10009069 3300025929 Bacteria 6968
141 Ga0207664_10830506 3300025929 Bacteria 831
142 Ga0207664_11186835 3300025929 Bacteria 681
143 Ga0207686_10186715 3300025934 Archaea 1474
144 Ga0207709_10537652 3300025935 Unclassified 917
145 Ga0207709_11198481 3300025935 Archaea 626
146 Ga0207670_10226860 3300025936 Bacteria 1433
147 Ga0207669_10695182 3300025937 Archaea 835
148 Ga0207704_10151824 3300025938 Bacteria 1635
149 Ga0207665_10000320 3300025939 Bacteria 33314
150 Ga0207665_10017843 3300025939 Bacteria 4665
151 Ga0207661_10058306 3300025944 Bacteria 3107
152 Ga0207667_10221400 3300025949 Bacteria 1939
153 Ga0207667_10642388 3300025949 Bacteria 1067
154 Ga0207677_10060920 3300026023 Bacteria 2611
155 Ga0207677_10215088 3300026023 Unclassified 1538
156 Ga0207708_10219248 3300026075 Archaea 1524
157 Ga0207702_10104870 3300026078 Bacteria 2503
158 Ga0207648_10022867 3300026089 Bacteria 5608
159 Ga0207674_10773648 3300026116 Bacteria 927
160 Ga0207683_10101900 3300026121 Unclassified 2563
161 Ga0207683_10175964 3300026121 Bacteria 1939
162 Ga0207428_10174774 3300027907 Bacteria 1625
163 Ga0265338_10155410 3300028800 Bacteria 1772
164 Ga0265338_10274225 3300028800 Unclassified 1235
165 Ga0265320_10188578 3300031240 Bacteria 923
166 Ga0265327_10044946 3300031251 Unclassified 2350
167 Ga0307413_10848207 3300031824 Unclassified 772
168 Ga0307415_101413061 3300032126 Bacteria 663
169 Ga0373926_0111503 3300035083 Bacteria 1028
170 Ga0373926_0283777 3300035083 Unclassified 645
171 Ga0373934_0001033 3300035086 Bacteria 10029
172 Ga0373923_0017958 3300035111 Bacteria 2714
173 Ga0373936_0147651 3300035113 Bacteria 1018
174 Ga0373945_0075431 3300035116 Unclassified 1284
175 Ga0373953_0023479 3300035117 Bacteria 2334
176 Ga0373954_0138274 3300035118 Unclassified 1187
177 Ga0373954_0274038 3300035118 Bacteria 832
178 Ga0373954_0288624 3300035118 Unclassified 809
179 Ga0373956_0042435 3300035119 Unclassified 2022
180 Ga0373956_0415897 3300035119 Bacteria 642
181 Ga0373957_0007650 3300035120 Bacteria 3465
182 Ga0373946_0040065 3300035171 Bacteria 1915
183 Ga0373946_0105085 3300035171 Unclassified 1271
184 Ga0373946_0370142 3300035171 Unclassified 719
185 Ga0373955_0000634 3300035172 Bacteria 15009
186 Ga0373955_0115129 3300035172 Bacteria 1558
187 Ga0373955_0165674 3300035172 Unclassified 1306
188 Ga0373955_0234811 3300035172 Bacteria 1098
189 Ga0373924_0096902 3300035410 Unclassified 1266
190 Ga0373924_0186033 3300035410 Unclassified 914
191 Ga0373935_0004801 3300035692 Bacteria 7947
192 Ga0373935_0075397 3300035692 Bacteria 2182
193 Ga0373935_0518785 3300035692 Bacteria 866
194 Ga0373927_0034341 3300035695 Bacteria 3300
195 Ga0373933_0000088 3300035724 Bacteria 58311
196 Ga0373933_0025142 3300035724 Bacteria 3413
197 Ga0373933_0109262 3300035724 Unclassified 1724
198 Ga0373933_0231701 3300035724 Bacteria 1186
199 Ga0373947_0009582 3300035725 Bacteria 5559
200 Ga0373947_0054245 3300035725 Bacteria 2419
201 Ga0373947_0282933 3300035725 Bacteria 1103
202 Ga0373937_0000039 3300036401 Bacteria 109668
203 Ga0373937_0031479 3300036401 Bacteria 4807
204 Ga0373937_0472997 3300036401 Bacteria 1190
205 Ga0373937_0513612 3300036401 Unclassified 1138
206 Ga0373937_0553778 3300036401 Bacteria 1092
207 Ga0373925_0024572 3300037068 Bacteria 4399
208 Ga0373925_0130041 3300037068 Bacteria 1962
209 Ga0373925_0165990 3300037068 Bacteria 1741
210 Ga0395899_0020271 3300037312 Bacteria 5045
211 Ga0395899_0067823 3300037312 Unclassified 2617
212 Ga0395899_0201558 3300037312 Bacteria 1387
213 Ga0395900_0111938 3300037418 Unclassified 2803
214 Ga0395900_0223885 3300037418 Bacteria 1895
215 Ga0395898_0051326 3300037466 Bacteria 4033
216 Ga0395898_0256822 3300037466 Bacteria 1666
217 Ga0395905_0604474 3300037471 Bacteria 998
218 Ga0395905_1678022 3300037471 Unclassified 540
219 Ga0436364_0202900 3300037853 Bacteria 2646
220 Ga0395901_0157451 3300038443 Bacteria 2385
221 Ga0395901_0245694 3300038443 Unclassified 1865
222 Ga0395901_0261154 3300038443 Bacteria 1802
223 Ga0436365_1236729 3300039437 Bacteria 5239
224 Ga0436360_0383680 3300039438 Unclassified 955
225 Ga0436361_0367732 3300039447 Bacteria 1602
226 Ga0451800_0051258 3300041459 Bacteria 671
227 Ga0466971_0048347 3300044719 Bacteria 1912
228 Ga0466971_0214147 3300044719 Bacteria 912
229 Ga0466957_1071553 3300044842 Bacteria 580
230 Ga0466960_0215920 3300044901 Bacteria 1053
231 Ga0466959_0620161 3300045049 Bacteria 727
232 Ga0451576_1507077 3300045051 Bacteria 699
233 Ga0466958_0243736 3300045836 Bacteria 1149
234 Ga0466958_0746320 3300045836 Unclassified 638
235 Ga0466967_0028092 3300045976 Bacteria 4691
236 Ga0466967_0323878 3300045976 Unclassified 1487
237 Ga0466967_1139141 3300045976 Unclassified 777
238 Ga0466967_1769069 3300045976 Bacteria 615
239 Ga0495592_0000244 3300046454 Bacteria 46497
240 Ga0495592_0042415 3300046454 Bacteria 3407
241 Ga0495603_0081197 3300046455 Bacteria 1900
242 Ga0495629_0028262 3300046459 Bacteria 3981
243 Ga0495629_0144242 3300046459 Unclassified 1656
244 Ga0495629_0221557 3300046459 Bacteria 1305
245 Ga0495641_0011979 3300046461 Bacteria 4888
246 Ga0495641_0234356 3300046461 Unclassified 824
247 Ga0495651_0000013 3300046462 Bacteria 137933
248 Ga0495651_0027062 3300046462 Bacteria 4466
249 Ga0495651_0115736 3300046462 Bacteria 1976
250 Ga0495651_0484842 3300046462 Unclassified 794
251 Ga0495651_0890202 3300046462 Unclassified 545
252 Ga0495653_0012784 3300046463 Bacteria 6854
253 Ga0495653_0024951 3300046463 Bacteria 4811
254 Ga0495653_0139026 3300046463 Bacteria 1710
255 Ga0495580_0036716 3300046472 Bacteria 3517
256 Ga0495582_0005069 3300046473 Bacteria 7378
257 Ga0495582_0153675 3300046473 Bacteria 1307
258 Ga0495639_0030410 3300046475 Bacteria 2400
259 Ga0495662_0006360 3300046476 Bacteria 5903
260 Ga0495662_0145504 3300046476 Unclassified 1167
261 Ga0495662_0146118 3300046476 Unclassified 1164
262 Ga0495594_0018288 3300046499 Bacteria 3711
263 Ga0495608_0000639 3300046511 Bacteria 24124
264 Ga0495608_0086545 3300046511 Bacteria 2030
265 Ga0495608_0573253 3300046511 Bacteria 679
266 Ga0495608_0699658 3300046511 Unclassified 603
267 Ga0495618_0012060 3300046514 Bacteria 5244
268 Ga0495618_0109124 3300046514 Bacteria 1772
269 Ga0495628_0012663 3300046516 Bacteria 7104
270 Ga0495628_0440535 3300046516 Unclassified 947
271 Ga0495630_0005428 3300046517 Bacteria 9000
272 Ga0495630_0196351 3300046517 Bacteria 1540
273 Ga0495630_0726799 3300046517 Bacteria 759
274 Ga0495630_0769860 3300046517 Unclassified 735
275 Ga0495630_1120797 3300046517 Bacteria 596
276 Ga0495666_0126839 3300046526 Bacteria 1193
277 Ga0495652_0040079 3300046529 Bacteria 4048
278 Ga0495652_0041541 3300046529 Bacteria 3969
279 Ga0495652_0069571 3300046529 Bacteria 2946
280 Ga0495652_0193460 3300046529 Bacteria 1550
281 Ga0495665_0168035 3300046531 Unclassified 1142
282 Ga0495665_0212776 3300046531 Bacteria 1001
283 Ga0495640_0004348 3300046533 Bacteria 11310
284 Ga0495640_0034974 3300046533 Bacteria 3558
285 Ga0495587_0000349 3300046536 Bacteria 32970
286 Ga0495587_0036605 3300046536 Bacteria 2951
287 Ga0495587_0100506 3300046536 Bacteria 1667
288 Ga0495587_0450442 3300046536 Unclassified 713
289 Ga0495645_0036932 3300046543 Bacteria 3560
290 Ga0495645_0047275 3300046543 Bacteria 3135
291 Ga0495645_0211399 3300046543 Bacteria 1310
292 Ga0495645_0515450 3300046543 Bacteria 746
293 Ga0495667_0000049 3300046559 Bacteria 115812
294 Ga0495667_0017679 3300046559 Bacteria 4816
295 Ga0495667_0041205 3300046559 Bacteria 3063
296 Ga0495667_0304553 3300046559 Unclassified 1009
297 Ga0495634_0006249 3300046642 Bacteria 9069
298 Ga0495634_0014584 3300046642 Bacteria 5662
299 Ga0495635_0005925 3300046663 Bacteria 8529
300 Ga0495635_0033231 3300046663 Bacteria 3577
301 Ga0495635_0329642 3300046663 Unclassified 1021
302 Ga0495635_0698998 3300046663 Bacteria 657
303 Ga0495635_1098868 3300046663 Unclassified 503
304 Ga0495588_0033663 3300046674 Bacteria 2589
305 Ga0495657_0001055 3300046675 Bacteria 24098
306 Ga0495657_0030284 3300046675 Bacteria 3792
307 Ga0495657_0031351 3300046675 Bacteria 3716
308 Ga0495599_0002698 3300046678 Bacteria 10364
309 Ga0495599_0022181 3300046678 Bacteria 3963
310 Ga0495599_0168713 3300046678 Bacteria 1351
311 Ga0495623_0004378 3300046679 Bacteria 9281
312 Ga0495623_0102625 3300046679 Bacteria 1741
313 Ga0495623_0225309 3300046679 Unclassified 1066
314 Ga0495646_0007029 3300046680 Bacteria 7148
315 Ga0495646_0020156 3300046680 Bacteria 4216
316 Ga0495658_0097965 3300046683 Bacteria 1746
317 Ga0495658_0192652 3300046683 Bacteria 1268
318 Ga0495613_0015912 3300046689 Bacteria 5600
319 Ga0495624_0015807 3300046690 Bacteria 5082
320 Ga0495624_0232129 3300046690 Bacteria 1117
321 Ga0495600_0009786 3300046809 Bacteria 5927
322 Ga0495600_0045037 3300046809 Unclassified 2878
323 Ga0495600_0106350 3300046809 Bacteria 1828
324 Ga0495600_0112916 3300046809 Bacteria 1769
325 Ga0495581_0006367 3300047315 Bacteria 6848
326 Ga0495581_0037864 3300047315 Bacteria 2791
327 Ga0495581_0365958 3300047315 Unclassified 842
328 Ga0495604_0000032 3300047317 Bacteria 137882
329 Ga0495604_0050271 3300047317 Bacteria 3237
330 Ga0495604_0365325 3300047317 Unclassified 956
331 Ga0495604_0496485 3300047317 Bacteria 792
332 Ga0495674_0081297 3300047319 Bacteria 2779
333 Ga0495674_0094516 3300047319 Bacteria 2550
334 Ga0495674_0309648 3300047319 Unclassified 1289
335 Ga0495674_0469097 3300047319 Unclassified 1010
336 Ga0495674_1181587 3300047319 Unclassified 579
337 Ga0495676_0023842 3300047321 Bacteria 5303
338 Ga0495676_0822264 3300047321 Bacteria 597
339 Ga0495680_0001613 3300047322 Bacteria 23986
340 Ga0495680_0008691 3300047322 Bacteria 9210
341 Ga0495680_0026168 3300047322 Bacteria 4814
342 Ga0495680_0176195 3300047322 Bacteria 1546
343 Ga0495675_0010689 3300047444 Bacteria 5742
344 Ga0495675_0034072 3300047444 Bacteria 3250
345 Ga0495684_0006029 3300047471 Bacteria 9422
346 Ga0495684_0024275 3300047471 Bacteria 4666
347 Ga0495684_0361692 3300047471 Bacteria 1028
348 Ga0495593_0013287 3300047673 Bacteria 4699
349 Ga0495602_0000242 3300048088 Bacteria 51007
350 Ga0495602_0032074 3300048088 Bacteria 4953
351 Ga0495602_0196594 3300048088 Unclassified 1542
352 Ga0495614_0088480 3300048089 Bacteria 1346
353 Ga0496100_0208883 3300048903 Bacteria 1427
354 Ga0496100_0215061 3300048903 Archaea 1408
355 Ga0496100_0628483 3300048903 Bacteria 835
356 Ga0496100_1580034 3300048903 Unclassified 518
357 Ga0496101_0085450 3300048904 Unclassified 2338
358 Ga0496101_0104582 3300048904 Bacteria 2124
359 Ga0496101_1463032 3300048904 Bacteria 532
360 Ga0496102_0031683 3300048905 Bacteria 4745
361 Ga0496102_0070185 3300048905 Bacteria 3217
362 Ga0496103_0601443 3300048906 Archaea 700
363 Ga0496104_0032383 3300048907 Bacteria 4865
364 Ga0496104_0040624 3300048907 Bacteria 4361
365 Ga0496104_0046726 3300048907 Bacteria 4078
366 Ga0496104_0078767 3300048907 Bacteria 3140
367 Ga0496105_0029786 3300048908 Bacteria 4469
368 Ga0496105_0162542 3300048908 Bacteria 1833
369 Ga0496105_0222733 3300048908 Bacteria 1535
370 Ga0496106_0723103 3300048909 Unclassified 793
371 Ga0496106_1177586 3300048909 Archaea 598
372 Ga0496107_0240098 3300048910 Archaea 1348
373 Ga0496108_0014951 3300048911 Bacteria 6335
374 Ga0496108_0038995 3300048911 Bacteria 3959
375 Ga0496108_0850602 3300048911 Archaea 785
376 Ga0496109_0024972 3300048912 Bacteria 5319
377 Ga0496109_0987939 3300048912 Archaea 779
378 Ga0496110_0108775 3300048913 Unclassified 2489
379 Ga0496110_0111891 3300048913 Bacteria 2455
380 Ga0496110_0568670 3300048913 Bacteria 1029
381 Ga0496111_0012761 3300048914 Bacteria 5698
382 Ga0496111_0256888 3300048914 Archaea 1296
383 Ga0496112_0007773 3300048915 Bacteria 9541
384 Ga0496112_0493756 3300048915 Unclassified 1160
385 Ga0496112_0646377 3300048915 Unclassified 987
386 Ga0496112_1927529 3300048915 Unclassified 502
387 Ga0496113_0003128 3300048916 Bacteria 9848
388 Ga0496113_0018854 3300048916 Bacteria 4814
389 Ga0496114_0010618 3300048917 Bacteria 7326
390 Ga0496114_0042923 3300048917 Bacteria 3749
391 Ga0496114_0186108 3300048917 Bacteria 1815
392 Ga0496115_0155921 3300048918 Unclassified 1887
393 Ga0501067_0018755 3300049583 Bacteria 3830
394 Ga0501069_0051285 3300049585 Bacteria 2296
395 Ga0501076_0558454 3300049592 Bacteria 944
396 Ga0501079_0953564 3300049741 Bacteria 676
397 nmdc:mga03n38_1062_c1 3300050490 Bacteria 7574
398 nmdc:mga00v17_5347_c1 3300050491 Bacteria 6762
399 nmdc:mga06z11_403503_c1 3300050494 Bacteria 823
400 nmdc:mga07m45_9331_c1 3300050496 Bacteria 5085
401 nmdc:mga08y16_149390_c1 3300050511 Bacteria 2429
402 Ga0495601_0013686 3300053077 Bacteria 4880
403 Ga0495601_0719625 3300053077 Unclassified 636
404 Ga0495601_0769743 3300053077 Unclassified 612
405 Ga0495601_0897083 3300053077 Unclassified 560
406 Ga0495612_0101269 3300053078 Bacteria 1227
407 Ga0495595_0002549 3300053084 Bacteria 7151
408 Ga0495595_0308169 3300053084 Bacteria 797
409 Ga0495595_0320632 3300053084 Unclassified 780
410 Ga0495595_0397529 3300053084 Bacteria 698
411 Ga0495595_0659986 3300053084 Unclassified 535
412 Ga0495619_0019009 3300053085 Bacteria 4364
413 Ga0495619_0026447 3300053085 Bacteria 3733
414 Ga0495619_0478645 3300053085 Unclassified 857
415 Ga0500644_0000024 3300053088 Bacteria 97034
416 Ga0500642_0406345 3300053130 Bacteria 593
417 Ga0466962_0063297 3300061719 Bacteria 1766
418 Ga0373925_0000042
419 Ga0070658_10293623
420 Ga0070658_11313615
421 Ga0070683_100032655
422 Ga0070680_100667404
423 Ga0070660_100607692
424 Ga0070689_100378093
425 Ga0070691_10192544
426 Ga0070692_10315831
427 Ga0070671_100734817
428 Ga0070674_100099459
429 Ga0070688_100334886
430 Ga0070709_10121722
431 Ga0070714_100424452
432 Ga0070714_100598204
433 Ga0070713_100009594
434 Ga0070713_100022095
435 Ga0070710_10000865
436 Ga0070710_10576874
437 Ga0070711_100001298
438 Ga0070700_100393074
439 Ga0070708_100413814
440 Ga0070708_102104167
441 Ga0070678_100256849
442 Ga0070678_101462984
443 Ga0068867_100008142
444 Ga0070706_100030428
445 Ga0070706_100527639
446 Ga0070707_100125829
447 Ga0070698_100208698
448 Ga0070698_100453412
449 Ga0070698_100554266
450 Ga0070699_100431900
451 Ga0070699_101591649
452 Ga0070679_100853371
453 Ga0070684_100350613
454 Ga0070684_100651711
455 Ga0070697_100612806
456 Ga0070686_100260452
457 Ga0068855_100070839
458 Ga0068855_100493868
459 Ga0068855_100974457
460 Ga0070664_100467748
461 Ga0068857_101215222
462 Ga0068856_100180681
463 Ga0070702_100070700
464 Ga0070702_100096734
465 Ga0068859_102042324
466 Ga0068866_10014040
467 Ga0068866_10651989
468 Ga0068866_11022440
469 Ga0068863_100227185
470 Ga0068863_100462758
471 Ga0068858_100498179
472 Ga0081455_10009972
473 Ga0081455_10018860
474 Ga0081455_10033684
475 Ga0081455_10037511
476 Ga0081455_10046775
477 Ga0081540_1231145
478 Ga0070717_10005881
479 Ga0070717_10026251
480 Ga0070717_10060542
481 Ga0075363_100000456
482 Ga0075363_100264382
483 Ga0075364_10002490
484 Ga0070715_10226029
485 Ga0070716_100000451
486 Ga0070716_100991386
487 Ga0070712_100006299
488 Ga0070712_100237688
489 Ga0070712_100981242
490 Ga0075367_10425218
491 Ga0075369_10018306
492 Ga0097621_100219257
493 Ga0097621_100379428
494 Ga0097621_100812524
495 Ga0075370_10023329
496 Ga0068871_100084156
497 Ga0068871_100799930
498 Ga0068865_100178851
499 Ga0068865_100234533
500 Ga0097620_102042115
501 Ga0075435_100723975
502 Ga0099794_10632351
503 Ga0105240_10775523
504 Ga0111539_10246286
505 Ga0111539_11057997
506 Ga0105245_10080826
507 Ga0105245_10640718
508 Ga0105247_10659398
509 Ga0105243_10039773
510 Ga0105243_10319834
511 Ga0105243_10824047
512 Ga0105242_10168316
513 Ga0105248_10111882
514 Ga0105248_10683322
515 Ga0105237_10647491
516 Ga0157370_10031575
517 Ga0157378_10169719
518 Ga0157378_10842048
519 Ga0163162_10496263
520 Ga0157375_10077861
521 Ga0157375_10245756
522 Ga0157375_10938876
523 Ga0157375_11902800
524 Ga0163163_10039365
525 Ga0163163_10231934
526 Ga0163163_12482956
527 Ga0157380_10722960
528 Ga0157379_10067809
529 Ga0157379_10882791
530 Ga0157376_10235483
531 Ga0157376_11159093
532 Ga0163161_10295315
533 Ga0213873_10065852
534 Ga0213876_10007598
535 Ga0213875_10055105
536 Ga0207692_10000952
537 Ga0207692_10690057
538 Ga0207642_10086225
539 Ga0207685_10112711
540 Ga0207699_10000719
541 Ga0207699_10239282
542 Ga0207684_10039915
543 Ga0207684_10048135
544 Ga0207671_10324082
545 Ga0207693_10003769
546 Ga0207693_10310639
547 Ga0207663_10001616
548 Ga0207660_11210836
549 Ga0207662_10171603
550 Ga0207646_10054926
551 Ga0207646_10362268
552 Ga0207687_10395131
553 Ga0207700_10007189
554 Ga0207700_10202102
555 Ga0207700_10439820
556 Ga0207700_11894591
557 Ga0207664_10009069
558 Ga0207664_10830506
559 Ga0207664_11186835
560 Ga0207686_10186715
561 Ga0207709_10537652
562 Ga0207709_11198481
563 Ga0207670_10226860
564 Ga0207669_10695182
565 Ga0207704_10151824
566 Ga0207665_10000320
567 Ga0207665_10017843
568 Ga0207661_10058306
569 Ga0207667_10221400
570 Ga0207667_10642388
571 Ga0207677_10060920
572 Ga0207677_10215088
573 Ga0207708_10219248
574 Ga0207702_10104870
575 Ga0207648_10022867
576 Ga0207674_10773648
577 Ga0207683_10101900
578 Ga0207683_10175964
579 Ga0207428_10174774
580 Ga0265338_10155410
581 Ga0265338_10274225
582 Ga0265320_10188578
583 Ga0265327_10044946
584 Ga0307413_10848207
585 Ga0307415_101413061
586 Ga0373926_0111503
587 Ga0373926_0283777
588 Ga0373934_0001033
589 Ga0373923_0017958
590 Ga0373936_0147651
591 Ga0373945_0075431
592 Ga0373953_0023479
593 Ga0373954_0138274
594 Ga0373954_0274038
595 Ga0373954_0288624
596 Ga0373956_0042435
597 Ga0373956_0415897
598 Ga0373957_0007650
599 Ga0373946_0040065
600 Ga0373946_0105085
601 Ga0373946_0370142
602 Ga0373955_0000634
603 Ga0373955_0115129
604 Ga0373955_0165674
605 Ga0373955_0234811
606 Ga0373924_0096902
607 Ga0373924_0186033
608 Ga0373935_0004801
609 Ga0373935_0075397
610 Ga0373935_0518785
611 Ga0373927_0034341
612 Ga0373933_0000088
613 Ga0373933_0025142
614 Ga0373933_0109262
615 Ga0373933_0231701
616 Ga0373947_0009582
617 Ga0373947_0054245
618 Ga0373947_0282933
619 Ga0373937_0000039
620 Ga0373937_0031479
621 Ga0373937_0472997
622 Ga0373937_0513612
623 Ga0373937_0553778
624 Ga0373925_0024572
625 Ga0373925_0130041
626 Ga0373925_0165990
627 Ga0395899_0020271
628 Ga0395899_0067823
629 Ga0395899_0201558
630 Ga0395900_0111938
631 Ga0395900_0223885
632 Ga0395898_0051326
633 Ga0395898_0256822
634 Ga0395905_0604474
635 Ga0395905_1678022
636 Ga0436364_0202900
637 Ga0395901_0157451
638 Ga0395901_0245694
639 Ga0395901_0261154
640 Ga0436365_1236729
641 Ga0436360_0383680
642 Ga0436361_0367732
643 Ga0451800_0051258
644 Ga0466971_0048347
645 Ga0466971_0214147
646 Ga0466957_1071553
647 Ga0466960_0215920
648 Ga0466959_0620161
649 Ga0451576_1507077
650 Ga0466958_0243736
651 Ga0466958_0746320
652 Ga0466967_0028092
653 Ga0466967_0323878
654 Ga0466967_1139141
655 Ga0466967_1769069
656 Ga0495592_0000244
657 Ga0495592_0042415
658 Ga0495603_0081197
659 Ga0495629_0028262
660 Ga0495629_0144242
661 Ga0495629_0221557
662 Ga0495641_0011979
663 Ga0495641_0234356
664 Ga0495651_0000013
665 Ga0495651_0027062
666 Ga0495651_0115736
667 Ga0495651_0484842
668 Ga0495651_0890202
669 Ga0495653_0012784
670 Ga0495653_0024951
671 Ga0495653_0139026
672 Ga0495580_0036716
673 Ga0495582_0005069
674 Ga0495582_0153675
675 Ga0495639_0030410
676 Ga0495662_0006360
677 Ga0495662_0145504
678 Ga0495662_0146118
679 Ga0495594_0018288
680 Ga0495608_0000639
681 Ga0495608_0086545
682 Ga0495608_0573253
683 Ga0495608_0699658
684 Ga0495618_0012060
685 Ga0495618_0109124
686 Ga0495628_0012663
687 Ga0495628_0440535
688 Ga0495630_0005428
689 Ga0495630_0196351
690 Ga0495630_0726799
691 Ga0495630_0769860
692 Ga0495630_1120797
693 Ga0495666_0126839
694 Ga0495652_0040079
695 Ga0495652_0041541
696 Ga0495652_0069571
697 Ga0495652_0193460
698 Ga0495665_0168035
699 Ga0495665_0212776
700 Ga0495640_0004348
701 Ga0495640_0034974
702 Ga0495587_0000349
703 Ga0495587_0036605
704 Ga0495587_0100506
705 Ga0495587_0450442
706 Ga0495645_0036932
707 Ga0495645_0047275
708 Ga0495645_0211399
709 Ga0495645_0515450
710 Ga0495667_0000049
711 Ga0495667_0017679
712 Ga0495667_0041205
713 Ga0495667_0304553
714 Ga0495634_0006249
715 Ga0495634_0014584
716 Ga0495635_0005925
717 Ga0495635_0033231
718 Ga0495635_0329642
719 Ga0495635_0698998
720 Ga0495635_1098868
721 Ga0495588_0033663
722 Ga0495657_0001055
723 Ga0495657_0030284
724 Ga0495657_0031351
725 Ga0495599_0002698
726 Ga0495599_0022181
727 Ga0495599_0168713
728 Ga0495623_0004378
729 Ga0495623_0102625
730 Ga0495623_0225309
731 Ga0495646_0007029
732 Ga0495646_0020156
733 Ga0495658_0097965
734 Ga0495658_0192652
735 Ga0495613_0015912
736 Ga0495624_0015807
737 Ga0495624_0232129
738 Ga0495600_0009786
739 Ga0495600_0045037
740 Ga0495600_0106350
741 Ga0495600_0112916
742 Ga0495581_0006367
743 Ga0495581_0037864
744 Ga0495581_0365958
745 Ga0495604_0000032
746 Ga0495604_0050271
747 Ga0495604_0365325
748 Ga0495604_0496485
749 Ga0495674_0081297
750 Ga0495674_0094516
751 Ga0495674_0309648
752 Ga0495674_0469097
753 Ga0495674_1181587
754 Ga0495676_0023842
755 Ga0495676_0822264
756 Ga0495680_0001613
757 Ga0495680_0008691
758 Ga0495680_0026168
759 Ga0495680_0176195
760 Ga0495675_0010689
761 Ga0495675_0034072
762 Ga0495684_0006029
763 Ga0495684_0024275
764 Ga0495684_0361692
765 Ga0495593_0013287
766 Ga0495602_0000242
767 Ga0495602_0032074
768 Ga0495602_0196594
769 Ga0495614_0088480
770 Ga0496100_0208883
771 Ga0496100_0215061
772 Ga0496100_0628483
773 Ga0496100_1580034
774 Ga0496101_0085450
775 Ga0496101_0104582
776 Ga0496101_1463032
777 Ga0496102_0031683
778 Ga0496102_0070185
779 Ga0496103_0601443
780 Ga0496104_0032383
781 Ga0496104_0040624
782 Ga0496104_0046726
783 Ga0496104_0078767
784 Ga0496105_0029786
785 Ga0496105_0162542
786 Ga0496105_0222733
787 Ga0496106_0723103
788 Ga0496106_1177586
789 Ga0496107_0240098
790 Ga0496108_0014951
791 Ga0496108_0038995
792 Ga0496108_0850602
793 Ga0496109_0024972
794 Ga0496109_0987939
795 Ga0496110_0108775
796 Ga0496110_0111891
797 Ga0496110_0568670
798 Ga0496111_0012761
799 Ga0496111_0256888
800 Ga0496112_0007773
801 Ga0496112_0493756
802 Ga0496112_0646377
803 Ga0496112_1927529
804 Ga0496113_0003128
805 Ga0496113_0018854
806 Ga0496114_0010618
807 Ga0496114_0042923
808 Ga0496114_0186108
809 Ga0496115_0155921
810 Ga0501067_0018755
811 Ga0501069_0051285
812 Ga0501076_0558454
813 Ga0501079_0953564
814 nmdc:mga03n38_1062_c1
815 nmdc:mga00v17_5347_c1
816 nmdc:mga06z11_403503_c1
817 nmdc:mga07m45_9331_c1
818 nmdc:mga08y16_149390_c1
819 Ga0495601_0013686
820 Ga0495601_0719625
821 Ga0495601_0769743
822 Ga0495601_0897083
823 Ga0495612_0101269
824 Ga0495595_0002549
825 Ga0495595_0308169
826 Ga0495595_0320632
827 Ga0495595_0397529
828 Ga0495595_0659986
829 Ga0495619_0019009
830 Ga0495619_0026447
831 Ga0495619_0478645
832 Ga0500644_0000024
833 Ga0500642_0406345
834 Ga0466962_0063297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

144

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

35

145

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8032 15 127
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8013 10 127
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.7998 10 131
2qnt-assembly1.cif.gz_A-2 crystal structure of protein of unknown function from agrobacterium tumefaciens str. c58 0.7835 7 127
6p29-assembly1.cif.gz_B n-demethylindolmycin synthase (plun2) in complex with n-demethylindolmycin 0.7805 7 127
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9201 75 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9088 75 127 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8803 74 136 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8645 76 125 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8501 75 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1Q9NVI6-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9684 77 128
AF-A0A257TG97-F1-model_v4 VOC domain-containing protein 0.9348 10 141
AF-W4M0U7-F1-model_v4 VOC domain-containing protein 0.92 66 133
AF-A0A7W0SQF2-F1-model_v4 VOC family protein 0.9178 9 127
AF-W0RTE0-F1-model_v4 Glyoxalase-like domain protein 0.9157 77 143

Map