F439098

General Info

Members Datasets Scaffolds Average Seq Length
417 246 372 262

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0091512|Ga0373937_0091512_451_1308
Length 285
Sequence MFLYHNLLRITTWSTYLEAKMNTMIKDNEAIHKMKVAGKLTAMVLDMIGEHVKAGVSTETLDAICHDYIVNELQGIPAPLNYRGFPKSVCTSVNHVVCHGIPGPKVLKNGDIINIDVSVIKDEYHGDSSKMFYVGEPSIRAKRLVEVTQECLYKGILEVKPGSTLKAIARVIEAHAKASGMTVVHEYCGHGIGTRFHEEPQVLHYVDPFSPDLTLEPGMTFTIEPMINAGKRDIKLLPDQWTVVTKDHSLSAQWEHTLLVTPTGVEVLTLRDEETQLKALLGYTP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
5 2506520008 Serratia plymuthica AS12 Isolate Unclassified
6 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2547132512 Azospira oryzae 6a3 Isolate Unclassified
9 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
10 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
11 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
12 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
13 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
14 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
15 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
16 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
17 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
18 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
19 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
20 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
21 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
22 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
23 2847085930 Erwinia persicina B64 Isolate Bulb
24 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
25 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
26 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
27 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
28 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
29 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
30 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
31 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
32 2919150387 Rahnella aceris 1817 Isolate Unclassified
33 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
34 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
35 2927143783 Rahnella sp. 2050 Isolate Unclassified
36 2932406140 Serratia sp. 2723 Isolate Rhizosphere
37 2937967321 Serratia sp. YC16 Isolate Unclassified
38 2939577877 Serratia sp. 509 Isolate Rhizosphere
39 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
40 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
41 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
42 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
43 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
44 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
45 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
49 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
50 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
51 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
59 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
60 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
63 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
159 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 640753048 Serratia proteamaculans 568 Isolate Endosphere
242 8004592986 Serratia sp. S119 Isolate Unclassified
243 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
244 8052494512 Pseudomonas putida LD6 Isolate Unclassified
245 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
246 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.21
Metatranscriptomes 0
Isolates 10.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.24
Endosphere 9.59
Nodule 2.16
Rhizoplane 2.64
Rhizosphere 73.62
Stem 0
Stem Tuber 0
Unclassified 11.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_163 2124908027 Bacteria 31412
2 SwRhRL2b_contig_1021101 2162886007 Bacteria 892
3 SwRhRL2b_contig_667037 2162886007 Bacteria 1195
4 MBSR1b_contig_14367964 2162886012 Bacteria 1355
5 JGI25162J39368_1000010 3300002737 Bacteria 389629
6 JGI25162J39368_1000893 3300002737 Bacteria 19438
7 JGI25163J39215_1000005 3300002771 Bacteria 128851
8 JGI25164J39214_1000003 3300002772 Bacteria 389390
9 JGI25152J39213_1000607 3300002773 Bacteria 19288
10 rootL2_10073820 3300003322 Bacteria 3511
11 Ga0055538_1000009 3300003751 Bacteria 389629
12 Ga0055539_1000013 3300003752 Bacteria 389629
13 Ga0055533_1000017 3300003756 Bacteria 389629
14 Ga0055532_1001248 3300003758 Bacteria 7458
15 Ga0055525_1000019 3300003759 Bacteria 389629
16 Ga0055536_1000037 3300003781 Bacteria 138437
17 Ga0055530_10000674 3300003791 Bacteria 29086
18 Ga0055540_1000025 3300003792 Bacteria 197801
19 Ga0055531_10000301 3300003794 Bacteria 49074
20 Ga0055541_1000010 3300003841 Bacteria 389629
21 Ga0058692_1000110 3300003856 Bacteria 54130
22 Ga0058692_1000411 3300003856 Bacteria 19901
23 Ga0065703_1019097 3300005272 Bacteria 4002
24 Ga0065714_10000081 3300005288 Bacteria 12068
25 Ga0065714_10076528 3300005288 Bacteria 2781
26 Ga0065704_10000634 3300005289 Bacteria 55231
27 Ga0065704_10005427 3300005289 Bacteria 3798
28 Ga0065704_10185361 3300005289 Bacteria 1194
29 Ga0065712_10003209 3300005290 Bacteria 8346
30 Ga0065715_10114620 3300005293 Bacteria 2444
31 Ga0065707_10150707 3300005295 Bacteria 1661
32 Ga0065707_10260304 3300005295 Bacteria 1099
33 Ga0070689_100057213 3300005340 Bacteria 3026
34 Ga0070687_100344673 3300005343 Bacteria 960
35 Ga0070669_100016153 3300005353 Bacteria 5325
36 Ga0070688_100072990 3300005365 Bacteria 2200
37 Ga0070667_100277851 3300005367 Bacteria 1503
38 Ga0070706_100563899 3300005467 Bacteria 1059
39 Ga0068857_100244065 3300005577 Bacteria 1645
40 Ga0068859_100077581 3300005617 Bacteria 3363
41 Ga0068859_100128144 3300005617 Bacteria 2608
42 Ga0068863_100026287 3300005841 Bacteria 5553
43 Ga0068863_100183501 3300005841 Bacteria 2009
44 Ga0068862_100093172 3300005844 Bacteria 2627
45 Ga0068862_100230327 3300005844 Bacteria 1681
46 Ga0075432_10053293 3300006058 Bacteria 1430
47 Ga0075362_10058002 3300006177 Bacteria 1746
48 Ga0075367_10028727 3300006178 Bacteria 3175
49 Ga0075436_100189665 3300006914 Bacteria 1454
50 Ga0097620_100077576 3300006931 Bacteria 3363
51 Ga0097620_100128142 3300006931 Bacteria 2608
52 Ga0099823_1022967 3300006944 Bacteria 5742
53 Ga0099823_1067284 3300006944 Bacteria 1681
54 Ga0079104_1000734 3300006946 Bacteria 29048
55 Ga0079104_1008724 3300006946 Bacteria 3507
56 Ga0105251_10000262 3300009011 Bacteria 52352
57 Ga0105251_10007265 3300009011 Bacteria 6865
58 Ga0105251_10013215 3300009011 Bacteria 4628
59 Ga0105251_10043837 3300009011 Bacteria 2164
60 Ga0105251_10060938 3300009011 Bacteria 1775
61 Ga0105251_10081380 3300009011 Bacteria 1496
62 Ga0105251_10089943 3300009011 Bacteria 1411
63 Ga0105244_10000039 3300009036 Bacteria 158304
64 Ga0105244_10000826 3300009036 Bacteria 26183
65 Ga0105244_10001374 3300009036 Bacteria 19782
66 Ga0105244_10004422 3300009036 Bacteria 9670
67 Ga0105244_10015538 3300009036 Bacteria 4362
68 Ga0105244_10034245 3300009036 Bacteria 2676
69 Ga0105244_10052073 3300009036 Bacteria 2085
70 Ga0105244_10095602 3300009036 Bacteria 1458
71 Ga0105244_10130289 3300009036 Bacteria 1214
72 Ga0105250_10000363 3300009092 Bacteria 34077
73 Ga0105250_10002959 3300009092 Bacteria 8270
74 Ga0105250_10060560 3300009092 Bacteria 1521
75 Ga0105250_10088074 3300009092 Bacteria 1261
76 Ga0105250_10109433 3300009092 Bacteria 1131
77 Ga0111539_10624979 3300009094 Bacteria 1254
78 Ga0105247_10000018 3300009101 Bacteria 259335
79 Ga0105243_10067248 3300009148 Bacteria 2884
80 Ga0105241_10000004 3300009174 Bacteria 803007
81 Ga0105248_10066802 3300009177 Bacteria 4037
82 Ga0105249_10576278 3300009553 Bacteria 1178
83 Ga0105239_10006132 3300010375 Bacteria 13989
84 Ga0105246_10252502 3300011119 Bacteria 1400
85 Ga0157373_10051228 3300013100 Bacteria 2941
86 Ga0157373_10095140 3300013100 Bacteria 2097
87 Ga0157371_10000252 3300013102 Bacteria 74966
88 Ga0157370_10038426 3300013104 Bacteria 4630
89 Ga0157370_10070850 3300013104 Bacteria 3290
90 Ga0157369_10038528 3300013105 Bacteria 5226
91 Ga0157372_10034560 3300013307 Bacteria 5558
92 Ga0157372_10053417 3300013307 Bacteria 4503
93 Ga0163163_10000197 3300014325 Bacteria 62158
94 Ga0182008_10001389 3300014497 Bacteria 16370
95 Ga0182008_10050116 3300014497 Bacteria 2072
96 Ga0182008_10052792 3300014497 Bacteria 2014
97 Ga0182006_1000047 3300015261 Bacteria 187006
98 Ga0182006_1042010 3300015261 Bacteria 1793
99 Ga0163161_10000001 3300017792 Bacteria 2041488
100 Ga0163161_10047275 3300017792 Bacteria 3108
101 Ga0209760_100008 3300025207 Bacteria 211332
102 Ga0209784_100012 3300025224 Bacteria 535823
103 Ga0209566_100010 3300025225 Bacteria 535823
104 Ga0209674_100023 3300025226 Bacteria 535823
105 Ga0209563_100027 3300025230 Bacteria 535823
106 Ga0207427_100017 3300025231 Bacteria 535823
107 Ga0209437_100029 3300025233 Bacteria 535823
108 Ga0209437_100117 3300025233 Bacteria 209271
109 Ga0209677_100014 3300025253 Bacteria 535823
110 Ga0209233_1001710 3300025261 Bacteria 8487
111 Ga0209565_1042813 3300025263 Bacteria 838
112 Ga0209675_1012906 3300025291 Bacteria 2654
113 Ga0209676_1000002 3300025292 Bacteria 1732948
114 Ga0209676_1000803 3300025292 Bacteria 41332
115 Ga0209676_1019300 3300025292 Bacteria 2348
116 Ga0209050_1000006 3300025298 Bacteria 1359702
117 Ga0209050_1000148 3300025298 Bacteria 164093
118 Ga0209051_1000001 3300025303 Bacteria 1732974
119 Ga0209051_1014695 3300025303 Bacteria 3639
120 Ga0209257_1000056 3300025304 Bacteria 403132
121 Ga0207696_1000001 3300025711 Bacteria 2579611
122 Ga0207696_1000144 3300025711 Bacteria 122345
123 Ga0207696_1000488 3300025711 Bacteria 33415
124 Ga0207696_1003166 3300025711 Bacteria 7635
125 Ga0207696_1039253 3300025711 Bacteria 1394
126 Ga0207696_1064682 3300025711 Bacteria 1024
127 Ga0207655_1000011 3300025728 Bacteria 643321
128 Ga0207655_1000030 3300025728 Bacteria 413221
129 Ga0207655_1000090 3300025728 Bacteria 203398
130 Ga0207655_1000183 3300025728 Bacteria 112295
131 Ga0207655_1000501 3300025728 Bacteria 50226
132 Ga0207655_1000786 3300025728 Bacteria 34726
133 Ga0207655_1008146 3300025728 Bacteria 6699
134 Ga0207655_1008755 3300025728 Bacteria 6373
135 Ga0207655_1023928 3300025728 Bacteria 3011
136 Ga0207655_1077289 3300025728 Bacteria 1214
137 Ga0207713_1000024 3300025735 Bacteria 339156
138 Ga0207713_1000026 3300025735 Bacteria 319032
139 Ga0207713_1000459 3300025735 Bacteria 42687
140 Ga0207713_1000551 3300025735 Bacteria 37432
141 Ga0207713_1000698 3300025735 Bacteria 31417
142 Ga0207713_1005272 3300025735 Bacteria 8137
143 Ga0207713_1007651 3300025735 Bacteria 6324
144 Ga0207713_1037535 3300025735 Bacteria 2065
145 Ga0207710_10000049 3300025900 Bacteria 186492
146 Ga0207654_10000006 3300025911 Bacteria 815027
147 Ga0207662_10084362 3300025918 Bacteria 1943
148 Ga0207709_10039717 3300025935 Bacteria 2813
149 Ga0207711_10040887 3300025941 Bacteria 3946
150 Ga0207712_10023211 3300025961 Bacteria 4092
151 Ga0207641_10044681 3300026088 Bacteria 3726
152 Ga0207674_10182188 3300026116 Bacteria 2052
153 Ga0209281_1000008 3300027111 Bacteria 867470
154 Ga0209281_1011282 3300027111 Bacteria 2006
155 Ga0209389_1000031 3300027296 Bacteria 138036
156 Ga0209389_1077353 3300027296 Bacteria 1677
157 Ga0209371_1000017 3300027312 Bacteria 625776
158 Ga0209371_1000033 3300027312 Bacteria 381084
159 Ga0209371_1000265 3300027312 Bacteria 61290
160 Ga0209371_1001738 3300027312 Bacteria 13726
161 Ga0207428_10096153 3300027907 Bacteria 2294
162 Ga0268265_10037074 3300028380 Bacteria 3575
163 Ga0268265_10169920 3300028380 Bacteria 1862
164 Ga0265334_10000014 3300028573 Bacteria 154345
165 Ga0265324_10000205 3300029957 Bacteria 45035
166 Ga0268256_1000091 3300030500 Bacteria 148069
167 Ga0268256_1000276 3300030500 Bacteria 53239
168 Ga0268256_1001121 3300030500 Bacteria 17424
169 Ga0265325_10086477 3300031241 Bacteria 1551
170 Ga0265327_10000471 3300031251 Bacteria 71254
171 Ga0265316_10303790 3300031344 Bacteria 1162
172 Ga0316575_10014678 3300031665 Bacteria 2945
173 Ga0265314_10000740 3300031711 Bacteria 39277
174 Ga0316574_0053339 3300035398 Bacteria 2524
175 Ga0373927_0000003 3300035695 Bacteria 480348
176 Ga0373937_0091512 3300036401 Bacteria 2819
177 Ga0373937_0312681 3300036401 Bacteria 1486
178 Ga0316582_0001889 3300036647 Bacteria 9523
179 Ga0395899_0000992 3300037312 Bacteria 26097
180 Ga0395900_0008351 3300037418 Bacteria 10657
181 Ga0395905_0000148 3300037471 Bacteria 116301
182 Ga0395905_0000382 3300037471 Bacteria 63066
183 Ga0395905_0011410 3300037471 Bacteria 8585
184 Ga0395905_0271571 3300037471 Bacteria 1581
185 Ga0395905_0311945 3300037471 Bacteria 1461
186 Ga0395905_0495659 3300037471 Bacteria 1121
187 Ga0395901_0004739 3300038443 Bacteria 13727
188 Ga0395901_0024783 3300038443 Bacteria 6159
189 Ga0439438_002381 3300041405 Bacteria 8017
190 Ga0439439_0060599 3300041406 Bacteria 1004
191 Ga0439447_000475 3300041407 Bacteria 14959
192 Ga0439466_0000127 3300041411 Bacteria 29566
193 Ga0439441_002458 3300042001 Bacteria 2614
194 Ga0439432_000437 3300042006 Bacteria 15500
195 Ga0439449_0022142 3300042007 Bacteria 2378
196 Ga0439451_001062 3300042009 Bacteria 5351
197 Ga0439452_016746 3300042010 Bacteria 1984
198 Ga0450907_000001 3300042146 Bacteria 236562
199 Ga0450909_000028 3300042185 Bacteria 11174
200 Ga0439434_0000001 3300042435 Bacteria 86314
201 Ga0450901_001068 3300042533 Bacteria 3180
202 Ga0439440_0006387 3300042993 Bacteria 2369
203 Ga0466961_0017663 3300044693 Bacteria 4583
204 Ga0495617_002511 3300046452 Bacteria 7264
205 Ga0495617_009243 3300046452 Bacteria 3384
206 Ga0495627_000028 3300046453 Bacteria 234737
207 Ga0495627_007667 3300046453 Bacteria 4119
208 Ga0495627_009686 3300046453 Bacteria 3536
209 Ga0495603_0020661 3300046455 Bacteria 3988
210 Ga0495591_000278 3300046458 Bacteria 47734
211 Ga0495591_000489 3300046458 Bacteria 31345
212 Ga0495591_003441 3300046458 Bacteria 8177
213 Ga0495591_022781 3300046458 Bacteria 2018
214 Ga0495638_0062725 3300046460 Bacteria 2293
215 Ga0495638_0155651 3300046460 Bacteria 1322
216 Ga0495650_0000052 3300046471 Bacteria 318176
217 Ga0495650_0003829 3300046471 Bacteria 10688
218 Ga0495650_0022298 3300046471 Bacteria 3040
219 Ga0495605_0003170 3300046474 Bacteria 9885
220 Ga0495605_0105235 3300046474 Bacteria 1292
221 Ga0495639_0048998 3300046475 Bacteria 1917
222 Ga0495584_0001788 3300046491 Bacteria 12501
223 Ga0495585_0005306 3300046492 Bacteria 8136
224 Ga0495594_0004492 3300046499 Bacteria 7173
225 Ga0495596_0000105 3300046500 Bacteria 59665
226 Ga0495607_0000812 3300046501 Bacteria 29512
227 Ga0495607_0001096 3300046501 Bacteria 24697
228 Ga0495607_0004786 3300046501 Bacteria 9883
229 Ga0495607_0008073 3300046501 Bacteria 7225
230 Ga0495583_0000518 3300046506 Bacteria 54833
231 Ga0495583_0009055 3300046506 Bacteria 5997
232 Ga0495606_0000238 3300046507 Bacteria 96877
233 Ga0495606_0037354 3300046507 Bacteria 3299
234 Ga0495608_0232467 3300046511 Bacteria 1154
235 Ga0495610_0007437 3300046512 Bacteria 7286
236 Ga0495610_0011746 3300046512 Bacteria 5322
237 Ga0495610_0062607 3300046512 Bacteria 1764
238 Ga0495610_0085343 3300046512 Bacteria 1441
239 Ga0495616_0006414 3300046513 Bacteria 7112
240 Ga0495616_0057950 3300046513 Bacteria 1908
241 Ga0495620_0000003 3300046515 Bacteria 345923
242 Ga0495620_0001333 3300046515 Bacteria 14988
243 Ga0495632_0000186 3300046519 Bacteria 63352
244 Ga0495632_0006295 3300046519 Bacteria 7665
245 Ga0495632_0041656 3300046519 Bacteria 2306
246 Ga0495632_0130717 3300046519 Bacteria 1168
247 Ga0495637_0000079 3300046520 Bacteria 74961
248 Ga0495637_0000168 3300046520 Bacteria 50579
249 Ga0495637_0016527 3300046520 Bacteria 3448
250 Ga0495643_0000319 3300046522 Bacteria 66471
251 Ga0495643_0000847 3300046522 Bacteria 33152
252 Ga0495644_0001134 3300046523 Bacteria 10925
253 Ga0495644_0004683 3300046523 Bacteria 5374
254 Ga0495644_0032223 3300046523 Bacteria 1980
255 Ga0495648_0000869 3300046524 Bacteria 31890
256 Ga0495648_0010454 3300046524 Bacteria 7066
257 Ga0495648_0044481 3300046524 Bacteria 2771
258 Ga0495648_0092426 3300046524 Bacteria 1689
259 Ga0495642_0001429 3300046528 Bacteria 10696
260 Ga0495654_0002037 3300046530 Bacteria 13265
261 Ga0495654_0005494 3300046530 Bacteria 7344
262 Ga0495654_0074943 3300046530 Bacteria 1597
263 Ga0495609_0000211 3300046538 Bacteria 58163
264 Ga0495621_0026045 3300046539 Bacteria 1969
265 Ga0495597_0004162 3300046542 Bacteria 8025
266 Ga0495597_0014427 3300046542 Bacteria 3764
267 Ga0495597_0041828 3300046542 Bacteria 2045
268 Ga0495597_0071833 3300046542 Bacteria 1489
269 Ga0495622_0000950 3300046557 Bacteria 15527
270 Ga0495622_0001653 3300046557 Bacteria 11021
271 Ga0495656_0022259 3300046615 Bacteria 2480
272 Ga0495668_0000379 3300046616 Bacteria 58955
273 Ga0495634_0127426 3300046642 Bacteria 1626
274 Ga0495625_0010604 3300046660 Bacteria 7603
275 Ga0495625_0057932 3300046660 Bacteria 2753
276 Ga0495625_0121762 3300046660 Bacteria 1774
277 Ga0495659_0010559 3300046664 Bacteria 2966
278 Ga0495661_0044355 3300046665 Bacteria 2726
279 Ga0495661_0106629 3300046665 Bacteria 1567
280 Ga0495661_0159001 3300046665 Bacteria 1214
281 Ga0495588_0021450 3300046674 Bacteria 3182
282 Ga0495670_0005984 3300046691 Bacteria 5955
283 Ga0495670_0009663 3300046691 Bacteria 4740
284 Ga0495670_0198707 3300046691 Bacteria 1061
285 Ga0495671_0005830 3300046692 Bacteria 7174
286 Ga0495671_0040098 3300046692 Bacteria 2362
287 Ga0495671_0056755 3300046692 Bacteria 1938
288 Ga0495649_0031644 3300046694 Bacteria 2916
289 Ga0495589_0000002 3300046794 Bacteria 758846
290 Ga0495660_0000006 3300046810 Bacteria 571713
291 Ga0495660_0001337 3300046810 Bacteria 16979
292 Ga0495660_0006140 3300046810 Bacteria 7132
293 Ga0495660_0007880 3300046810 Bacteria 6255
294 Ga0495660_0008972 3300046810 Bacteria 5842
295 Ga0495660_0025741 3300046810 Bacteria 3339
296 Ga0495672_0003101 3300047320 Bacteria 14516
297 Ga0495672_0045407 3300047320 Bacteria 2628
298 Ga0495683_0000006 3300047323 Bacteria 272409
299 Ga0495683_0004073 3300047323 Bacteria 8373
300 Ga0495683_0010515 3300047323 Bacteria 4885
301 Ga0495683_0011994 3300047323 Bacteria 4554
302 Ga0495679_003203 3300047446 Bacteria 7960
303 Ga0495673_0000429 3300047469 Bacteria 47646
304 Ga0495673_0012195 3300047469 Bacteria 4573
305 Ga0495673_0031708 3300047469 Bacteria 2472
306 Ga0495673_0032001 3300047469 Bacteria 2457
307 Ga0495673_0040817 3300047469 Bacteria 2092
308 Ga0495673_0041288 3300047469 Bacteria 2077
309 Ga0495681_0000628 3300047470 Bacteria 26907
310 Ga0495681_0012310 3300047470 Bacteria 5035
311 Ga0495681_0023969 3300047470 Bacteria 3226
312 Ga0495681_0081043 3300047470 Bacteria 1449
313 Ga0495686_0023469 3300047472 Bacteria 4067
314 Ga0495686_0109329 3300047472 Bacteria 1659
315 Ga0495593_0071543 3300047673 Bacteria 1801
316 Ga0495626_0000112 3300048091 Bacteria 105221
317 Ga0495626_0000302 3300048091 Bacteria 52509
318 Ga0496100_0395904 3300048903 Bacteria 1051
319 Ga0496104_0031273 3300048907 Bacteria 4949
320 Ga0496104_0287270 3300048907 Bacteria 1557
321 Ga0496110_0139045 3300048913 Bacteria 2195
322 Ga0496110_0520920 3300048913 Bacteria 1081
323 Ga0496114_0022202 3300048917 Bacteria 5170
324 Ga0496114_0090444 3300048917 Bacteria 2598
325 Ga0496116_0000020 3300048919 Bacteria 501307
326 Ga0496116_0000023 3300048919 Bacteria 475792
327 Ga0496117_0001008 3300048920 Bacteria 43122
328 Ga0496117_0004528 3300048920 Bacteria 15243
329 Ga0496117_0055276 3300048920 Bacteria 2774
330 Ga0496117_0069704 3300048920 Bacteria 2366
331 Ga0496118_0000048 3300048921 Bacteria 253404
332 Ga0496118_0007922 3300048921 Bacteria 11117
333 Ga0496118_0017181 3300048921 Bacteria 6599
334 Ga0496118_0068804 3300048921 Bacteria 2568
335 Ga0496118_0140518 3300048921 Bacteria 1531
336 Ga0496118_0197286 3300048921 Bacteria 1196
337 Ga0496119_0000444 3300048922 Bacteria 56759
338 Ga0496119_0004637 3300048922 Bacteria 13561
339 Ga0496120_0000084 3300048923 Bacteria 156678
340 Ga0496120_0000114 3300048923 Bacteria 136671
341 Ga0496120_0000427 3300048923 Bacteria 66859
342 Ga0496120_0001654 3300048923 Bacteria 25753
343 Ga0496120_0036800 3300048923 Bacteria 2908
344 Ga0496122_0000010 3300048925 Bacteria 547417
345 Ga0496122_0001805 3300048925 Bacteria 32793
346 Ga0496123_0000025 3300048926 Bacteria 323956
347 Ga0496124_0000017 3300048927 Bacteria 444389
348 Ga0496124_0000042 3300048927 Bacteria 301126
349 Ga0496124_0002470 3300048927 Bacteria 24168
350 Ga0496124_0005746 3300048927 Bacteria 13807
351 Ga0496124_0108248 3300048927 Bacteria 2241
352 Ga0496124_0321980 3300048927 Bacteria 1106
353 Ga0496125_0000900 3300048928 Bacteria 46994
354 Ga0496125_0003996 3300048928 Bacteria 17343
355 Ga0496125_0025869 3300048928 Bacteria 5363
356 Ga0496126_0000743 3300048929 Bacteria 59032
357 Ga0496126_0474474 3300048929 Bacteria 1003
358 Ga0495678_047627 3300049459 Bacteria 1677
359 Ga0495682_0012611 3300049460 Bacteria 3237
360 Ga0495682_0020529 3300049460 Bacteria 2479
361 Ga0501036_0034729 3300049572 Bacteria 4266
362 Ga0501047_0004504 3300049581 Bacteria 13108
363 Ga0501080_0164724 3300049742 Bacteria 2046
364 Ga0501080_0180383 3300049742 Bacteria 1943
365 Ga0501241_000050 3300049758 Bacteria 32501
366 Ga0501035_0096716 3300049822 Bacteria 2594
367 Ga0501044_0012817 3300049823 Bacteria 9078
368 nmdc:mga06r32_104372_c1 3300050510 Bacteria 2783
369 nmdc:mga08y16_95113_c1 3300050511 Bacteria 3103
370 nmdc:mga08x19_118094_c1 3300050514 Bacteria 1775
371 Ga0500659_0003591 3300053135 Bacteria 9032
372 Ga0500616_0041857 3300053153 Bacteria 2456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0000847 Ga0495643_0000847_15082_15852 222
2 3300046539 Ga0495621_0026045 Ga0495621_0026045_1102_1872 228
3 3300048903 Ga0496100_0395904 Ga0496100_0395904_297_1001 229
4 3300009553 Ga0105249_10576278 Ga0105249_105762781 231
5 3300048921 Ga0496118_0068804 Ga0496118_0068804_1835_2548 231
6 3300048921 Ga0496118_0140518 Ga0496118_0140518_798_1511 231
7 3300046665 Ga0495661_0159001 Ga0495661_0159001_487_1197 235
8 3300005365 Ga0070688_100072990 Ga0070688_1000729902 236
9 3300005577 Ga0068857_100244065 Ga0068857_1002440652 236
10 3300005617 Ga0068859_100128144 Ga0068859_1001281442 236
11 3300006931 Ga0097620_100128142 Ga0097620_1001281422 236
12 3300006944 Ga0099823_1067284 Ga0099823_10672841 236
13 3300009094 Ga0111539_10624979 Ga0111539_106249792 236
14 3300025918 Ga0207662_10084362 Ga0207662_100843622 236
15 3300026116 Ga0207674_10182188 Ga0207674_101821882 236
16 3300027296 Ga0209389_1077353 Ga0209389_10773533 236
17 3300035398 Ga0316574_0053339 Ga0316574_0053339_1773_2501 237
18 3300005343 Ga0070687_100344673 Ga0070687_1003446731 238
19 3300049742 Ga0501080_0180383 Ga0501080_0180383_1156_1905 238
20 3300049823 Ga0501044_0012817 Ga0501044_0012817_8304_9053 238
21 3300050511 nmdc:mga08y16_95113_c1 nmdc:mga08y16_95113_c1_347_1219 238
22 3300031251 Ga0265327_10000471 Ga0265327_100004717 239
23 3300029957 Ga0265324_10000205 Ga0265324_100002052 240
24 3300031711 Ga0265314_10000740 Ga0265314_1000074011 240
25 3300049572 Ga0501036_0034729 Ga0501036_0034729_23_748 240
26 3300046810 Ga0495660_0007880 Ga0495660_0007880_5184_5918 242
27 3300003322 rootL2_10073820 rootL2_100738204 246
28 iso_pu_bacteria 8056137416 8056138806 247
29 iso_pu_bacteria 3007803356 3007806455 248
30 3300006178 Ga0075367_10028727 Ga0075367_100287274 249
31 3300048929 Ga0496126_0474474 Ga0496126_0474474_37_789 249
32 3300009036 Ga0105244_10004422 Ga0105244_100044225 250
33 3300009036 Ga0105244_10130289 Ga0105244_101302891 250
34 3300025728 Ga0207655_1000501 Ga0207655_10005016 250
35 3300025728 Ga0207655_1077289 Ga0207655_10772891 250
36 3300048917 Ga0496114_0022202 Ga0496114_0022202_82_852 250
37 3300048921 Ga0496118_0197286 Ga0496118_0197286_162_932 250
38 3300048927 Ga0496124_0321980 Ga0496124_0321980_201_971 250
39 3300048928 Ga0496125_0025869 Ga0496125_0025869_4386_5156 250
40 2162886012 MBSR1b_contig_14367964 MBSR1b_0889.00004930 251
41 3300005295 Ga0065707_10150707 Ga0065707_101507072 251
42 3300005367 Ga0070667_100277851 Ga0070667_1002778511 251
43 3300005617 Ga0068859_100077581 Ga0068859_1000775813 251
44 3300005841 Ga0068863_100026287 Ga0068863_1000262873 251
45 3300005844 Ga0068862_100093172 Ga0068862_1000931722 251
46 3300005844 Ga0068862_100230327 Ga0068862_1002303272 251
47 3300006931 Ga0097620_100077576 Ga0097620_1000775763 251
48 3300009177 Ga0105248_10066802 Ga0105248_100668024 251
49 3300025735 Ga0207713_1005272 Ga0207713_10052729 251
50 3300025941 Ga0207711_10040887 Ga0207711_100408874 251
51 3300025961 Ga0207712_10023211 Ga0207712_100232112 251
52 3300026088 Ga0207641_10044681 Ga0207641_100446812 251
53 3300028380 Ga0268265_10037074 Ga0268265_100370742 251
54 3300028380 Ga0268265_10169920 Ga0268265_101699202 251
55 3300028573 Ga0265334_10000014 Ga0265334_10000014110 251
56 3300046511 Ga0495608_0232467 Ga0495608_0232467_204_995 251
57 3300046642 Ga0495634_0127426 Ga0495634_0127426_105_896 251
58 3300049581 Ga0501047_0004504 Ga0501047_0004504_8446_9234 251
59 3300049822 Ga0501035_0096716 Ga0501035_0096716_561_1349 251
60 iso_pu_bacteria 8056115690 8056117638 251
61 2162886007 SwRhRL2b_contig_1021101 SwRhRL2b_0384.00005090 252
62 2162886007 SwRhRL2b_contig_667037 SwRhRL2b_0931.00003300 252
63 3300005289 Ga0065704_10185361 Ga0065704_101853611 252
64 3300006177 Ga0075362_10058002 Ga0075362_100580022 252
65 3300006944 Ga0099823_1022967 Ga0099823_10229671 252
66 3300009036 Ga0105244_10052073 Ga0105244_100520732 252
67 3300009036 Ga0105244_10095602 Ga0105244_100956022 252
68 3300009092 Ga0105250_10088074 Ga0105250_100880741 252
69 3300009148 Ga0105243_10067248 Ga0105243_100672481 252
70 3300013104 Ga0157370_10038426 Ga0157370_100384262 252
71 3300025292 Ga0209676_1000803 Ga0209676_10008031 252
72 3300025711 Ga0207696_1000144 Ga0207696_100014469 252
73 3300025711 Ga0207696_1039253 Ga0207696_10392532 252
74 3300025728 Ga0207655_1023928 Ga0207655_10239282 252
75 3300025935 Ga0207709_10039717 Ga0207709_100397172 252
76 3300027296 Ga0209389_1000031 Ga0209389_100003168 252
77 3300041406 Ga0439439_0060599 Ga0439439_0060599_78_881 252
78 3300042006 Ga0439432_000437 Ga0439432_000437_78_854 252
79 3300042007 Ga0439449_0022142 Ga0439449_0022142_986_1789 252
80 3300046512 Ga0495610_0062607 Ga0495610_0062607_245_1006 252
81 3300046515 Ga0495620_0000003 Ga0495620_0000003_262642_263418 252
82 3300046519 Ga0495632_0000186 Ga0495632_0000186_23916_24692 252
83 3300046522 Ga0495643_0000319 Ga0495643_0000319_57535_58311 252
84 3300046524 Ga0495648_0000869 Ga0495648_0000869_7061_7837 252
85 3300047469 Ga0495673_0000429 Ga0495673_0000429_25874_26668 252
86 3300048920 Ga0496117_0001008 Ga0496117_0001008_7646_8422 252
87 3300048925 Ga0496122_0001805 Ga0496122_0001805_31600_32376 252
88 3300048927 Ga0496124_0108248 Ga0496124_0108248_812_1588 252
89 3300053135 Ga0500659_0003591 Ga0500659_0003591_6676_7452 252
90 3300025728 Ga0207655_1000183 Ga0207655_100018373 253
91 3300031241 Ga0265325_10086477 Ga0265325_100864771 253
92 3300037471 Ga0395905_0495659 Ga0395905_0495659_210_1016 253
93 3300049742 Ga0501080_0164724 Ga0501080_0164724_453_1217 253
94 iso_pu_bacteria 2554235231 2555244793 253
95 iso_pu_bacteria 2847085930 2847090816 253
96 iso_pu_bacteria 8052494512 8052495888 253
97 3300005340 Ga0070689_100057213 Ga0070689_1000572132 254
98 3300005841 Ga0068863_100183501 Ga0068863_1001835012 254
99 3300014325 Ga0163163_10000197 Ga0163163_1000019714 254
100 iso_pu_bacteria 2506520007 2506577392 254
101 iso_pu_bacteria 2506520008 2506582530 254
102 iso_pu_bacteria 2508501071 2508851340 254
103 iso_pu_bacteria 2654587920 2656278309 254
104 iso_pu_bacteria 2687453601 2689443869 254
105 iso_pu_bacteria 2772190666 2772437906 254
106 iso_pu_bacteria 2806310673 2807179067 254
107 iso_pu_bacteria 2869551831 2869553255 254
108 iso_pu_bacteria 2881927736 2881928337 254
109 iso_pu_bacteria 2884086401 2884090335 254
110 iso_pu_bacteria 2888366609 2888367905 254
111 iso_pu_bacteria 2919688452 2919691601 254
112 iso_pu_bacteria 2932406140 2932408584 254
113 iso_pu_bacteria 2937967321 2937969638 254
114 iso_pu_bacteria 2939577877 2939578976 254
115 iso_pu_bacteria 3000376612 3000380387 254
116 iso_pu_bacteria 3007872151 3007876380 254
117 iso_pu_bacteria 640753048 640936897 254
118 iso_pu_bacteria 8004592986 8004594890 254
119 iso_pu_bacteria 8015394850 8015399437 254
120 3300006946 Ga0079104_1000734 Ga0079104_10007349 255
121 3300014497 Ga0182008_10052792 Ga0182008_100527922 255
122 3300027111 Ga0209281_1000008 Ga0209281_1000008264 255
123 3300035695 Ga0373927_0000003 Ga0373927_0000003_28748_29515 255
124 3300036401 Ga0373937_0312681 Ga0373937_0312681_311_1078 255
125 3300041405 Ga0439438_002381 Ga0439438_002381_6881_7675 255
126 3300048913 Ga0496110_0520920 Ga0496110_0520920_140_934 255
127 3300050510 nmdc:mga06r32_104372_c1 nmdc:mga06r32_104372_c1_289_1086 255
128 3300002737 JGI25162J39368_1000010 JGI25162J39368_1000010237 256
129 3300002771 JGI25163J39215_1000005 JGI25163J39215_10000059 256
130 3300002772 JGI25164J39214_1000003 JGI25164J39214_1000003128 256
131 3300003751 Ga0055538_1000009 Ga0055538_1000009237 256
132 3300003752 Ga0055539_1000013 Ga0055539_1000013237 256
133 3300003756 Ga0055533_1000017 Ga0055533_1000017237 256
134 3300003759 Ga0055525_1000019 Ga0055525_1000019237 256
135 3300003841 Ga0055541_1000010 Ga0055541_1000010237 256
136 3300005289 Ga0065704_10000634 Ga0065704_100006349 256
137 3300005295 Ga0065707_10260304 Ga0065707_102603041 256
138 3300005467 Ga0070706_100563899 Ga0070706_1005638992 256
139 3300009011 Ga0105251_10081380 Ga0105251_100813802 256
140 3300009092 Ga0105250_10000363 Ga0105250_1000036322 256
141 3300010375 Ga0105239_10006132 Ga0105239_1000613210 256
142 3300013102 Ga0157371_10000252 Ga0157371_1000025212 256
143 3300013105 Ga0157369_10038528 Ga0157369_100385282 256
144 3300025207 Ga0209760_100008 Ga0209760_10000832 256
145 3300025224 Ga0209784_100012 Ga0209784_100012234 256
146 3300025225 Ga0209566_100010 Ga0209566_100010234 256
147 3300025226 Ga0209674_100023 Ga0209674_100023234 256
148 3300025230 Ga0209563_100027 Ga0209563_100027234 256
149 3300025231 Ga0207427_100017 Ga0207427_100017234 256
150 3300025233 Ga0209437_100029 Ga0209437_100029234 256
151 3300025253 Ga0209677_100014 Ga0209677_100014234 256
152 3300025261 Ga0209233_1001710 Ga0209233_10017105 256
153 3300025711 Ga0207696_1000488 Ga0207696_10004889 256
154 3300025728 Ga0207655_1000786 Ga0207655_100078626 256
155 3300031344 Ga0265316_10303790 Ga0265316_103037902 256
156 3300036647 Ga0316582_0001889 Ga0316582_0001889_6927_7751 256
157 3300037312 Ga0395899_0000992 Ga0395899_0000992_24987_25790 256
158 3300037418 Ga0395900_0008351 Ga0395900_0008351_8358_9161 256
159 3300037471 Ga0395905_0000148 Ga0395905_0000148_57252_58055 256
160 3300037471 Ga0395905_0011410 Ga0395905_0011410_1992_2795 256
161 3300037471 Ga0395905_0311945 Ga0395905_0311945_373_1176 256
162 3300038443 Ga0395901_0004739 Ga0395901_0004739_7466_8269 256
163 3300038443 Ga0395901_0024783 Ga0395901_0024783_2584_3387 256
164 3300046471 Ga0495650_0000052 Ga0495650_0000052_231428_232228 256
165 3300046810 Ga0495660_0000006 Ga0495660_0000006_223645_224445 256
166 3300048907 Ga0496104_0031273 Ga0496104_0031273_48_848 256
167 3300048919 Ga0496116_0000020 Ga0496116_0000020_238599_239399 256
168 3300048920 Ga0496117_0055276 Ga0496117_0055276_364_1164 256
169 3300048920 Ga0496117_0069704 Ga0496117_0069704_1271_2071 256
170 3300048921 Ga0496118_0000048 Ga0496118_0000048_10960_11760 256
171 3300048921 Ga0496118_0017181 Ga0496118_0017181_4050_4850 256
172 3300048923 Ga0496120_0036800 Ga0496120_0036800_1093_1893 256
173 3300048925 Ga0496122_0000010 Ga0496122_0000010_465541_466341 256
174 3300048926 Ga0496123_0000025 Ga0496123_0000025_74166_74966 256
175 3300048927 Ga0496124_0000042 Ga0496124_0000042_253983_254783 256
176 3300048928 Ga0496125_0000900 Ga0496125_0000900_30106_30906 256
177 3300048929 Ga0496126_0000743 Ga0496126_0000743_10854_11654 256
178 iso_pu_bacteria 2585427591 2585827187 256
179 iso_pu_bacteria 2585427592 2585833242 256
180 iso_pu_bacteria 2667528173 2671107676 256
181 iso_pu_bacteria 2791355275 2793405680 256
182 iso_pu_bacteria 2904474040 2904476669 256
183 iso_pu_bacteria 2919150387 2919152838 256
184 iso_pu_bacteria 2919155634 2919159958 256
185 iso_pu_bacteria 2927143783 2927146799 256
186 3300002773 JGI25152J39213_1000607 JGI25152J39213_10006072 257
187 3300031665 Ga0316575_10014678 Ga0316575_100146782 257
188 3300037471 Ga0395905_0271571 Ga0395905_0271571_572_1378 257
189 3300042001 Ga0439441_002458 Ga0439441_002458_157_960 257
190 iso_pu_bacteria 2888373701 2888374439 257
191 iso_pu_bacteria 2939602548 2939603683 257
192 3300005272 Ga0065703_1019097 Ga0065703_10190975 258
193 3300005289 Ga0065704_10005427 Ga0065704_100054271 258
194 3300006946 Ga0079104_1008724 Ga0079104_10087243 258
195 3300009011 Ga0105251_10000262 Ga0105251_1000026232 258
196 3300009011 Ga0105251_10007265 Ga0105251_100072652 258
197 3300009011 Ga0105251_10013215 Ga0105251_100132153 258
198 3300009011 Ga0105251_10089943 Ga0105251_100899432 258
199 3300009036 Ga0105244_10000039 Ga0105244_100000392 258
200 3300009036 Ga0105244_10001374 Ga0105244_1000137413 258
201 3300009092 Ga0105250_10002959 Ga0105250_100029594 258
202 3300009101 Ga0105247_10000018 Ga0105247_10000018236 258
203 3300009174 Ga0105241_10000004 Ga0105241_10000004531 258
204 3300013100 Ga0157373_10051228 Ga0157373_100512283 258
205 3300014497 Ga0182008_10001389 Ga0182008_1000138916 258
206 3300017792 Ga0163161_10000001 Ga0163161_1000000199 258
207 3300025711 Ga0207696_1000001 Ga0207696_1000001151 258
208 3300025728 Ga0207655_1000011 Ga0207655_1000011412 258
209 3300025728 Ga0207655_1000090 Ga0207655_100009034 258
210 3300025735 Ga0207713_1000024 Ga0207713_100002478 258
211 3300025735 Ga0207713_1000026 Ga0207713_1000026255 258
212 3300025735 Ga0207713_1000459 Ga0207713_100045947 258
213 3300025900 Ga0207710_10000049 Ga0207710_1000004970 258
214 3300025911 Ga0207654_10000006 Ga0207654_10000006549 258
215 3300027111 Ga0209281_1011282 Ga0209281_10112822 258
216 3300037471 Ga0395905_0000382 Ga0395905_0000382_30659_31468 258
217 3300046453 Ga0495627_000028 Ga0495627_000028_116709_117503 258
218 3300046794 Ga0495589_0000002 Ga0495589_0000002_487326_488120 258
219 3300047470 Ga0495681_0081043 Ga0495681_0081043_424_1218 258
220 3300048907 Ga0496104_0287270 Ga0496104_0287270_280_1074 258
221 3300048919 Ga0496116_0000023 Ga0496116_0000023_83700_84494 258
222 3300048920 Ga0496117_0004528 Ga0496117_0004528_3508_4302 258
223 3300048921 Ga0496118_0007922 Ga0496118_0007922_9889_10683 258
224 3300048923 Ga0496120_0000084 Ga0496120_0000084_119891_120685 258
225 3300048923 Ga0496120_0000427 Ga0496120_0000427_29693_30487 258
226 3300048927 Ga0496124_0000017 Ga0496124_0000017_407172_407966 258
227 iso_pu_bacteria 2511231010 2511291530 259
228 iso_pu_bacteria 2600255318 2601796912 259
229 iso_pu_bacteria 2603880185 2606076362 259
230 iso_pu_bacteria 2603880199 2606131273 259
231 iso_pu_bacteria 2623620443 2624481198 259
232 iso_pu_bacteria 2713897149 2715755699 259
233 iso_pu_bacteria 2878029506 2878033147 259
234 iso_pu_bacteria 2919063839 2919067129 259
235 3300013307 Ga0157372_10053417 Ga0157372_100534172 260
236 3300015261 Ga0182006_1000047 Ga0182006_100004720 260
237 3300048922 Ga0496119_0000444 Ga0496119_0000444_20975_21775 260
238 3300048922 Ga0496119_0004637 Ga0496119_0004637_5694_6476 260
239 3300048923 Ga0496120_0000114 Ga0496120_0000114_49682_50464 260
240 3300048923 Ga0496120_0001654 Ga0496120_0001654_50_850 260
241 3300048927 Ga0496124_0002470 Ga0496124_0002470_3361_4143 260
242 3300003856 Ga0058692_1000110 Ga0058692_10001108 261
243 3300009036 Ga0105244_10000826 Ga0105244_100008265 261
244 3300013307 Ga0157372_10034560 Ga0157372_100345605 261
245 3300025728 Ga0207655_1000030 Ga0207655_1000030247 261
246 3300027312 Ga0209371_1000265 Ga0209371_100026554 261
247 3300030500 Ga0268256_1000276 Ga0268256_10002767 261
248 3300036401 Ga0373937_0091512 Ga0373937_0091512_451_1308 261
249 3300053153 Ga0500616_0041857 Ga0500616_0041857_1468_2307 261
250 iso_pu_bacteria 2547132512 2548848558 261
251 3300003856 Ga0058692_1000411 Ga0058692_100041117 262
252 3300025292 Ga0209676_1019300 Ga0209676_10193003 262
253 3300025298 Ga0209050_1000148 Ga0209050_100014839 262
254 3300025303 Ga0209051_1014695 Ga0209051_10146955 262
255 3300027312 Ga0209371_1000017 Ga0209371_1000017543 262
256 3300027312 Ga0209371_1000033 Ga0209371_1000033338 262
257 3300027312 Ga0209371_1001738 Ga0209371_10017382 262
258 3300030500 Ga0268256_1000091 Ga0268256_1000091143 262
259 3300030500 Ga0268256_1001121 Ga0268256_100112112 262
260 3300042533 Ga0450901_001068 Ga0450901_001068_337_1125 262
261 3300048927 Ga0496124_0005746 Ga0496124_0005746_6261_7073 262
262 2124908027 MRS2a_Contig_163 MRS2a_00062840 263
263 3300002737 JGI25162J39368_1000893 JGI25162J39368_100089319 263
264 3300003758 Ga0055532_1001248 Ga0055532_10012487 263
265 3300003781 Ga0055536_1000037 Ga0055536_1000037134 263
266 3300003791 Ga0055530_10000674 Ga0055530_1000067411 263
267 3300003792 Ga0055540_1000025 Ga0055540_100002533 263
268 3300003794 Ga0055531_10000301 Ga0055531_1000030132 263
269 3300005288 Ga0065714_10000081 Ga0065714_100000813 263
270 3300005288 Ga0065714_10076528 Ga0065714_100765282 263
271 3300005290 Ga0065712_10003209 Ga0065712_100032095 263
272 3300005293 Ga0065715_10114620 Ga0065715_101146202 263
273 3300005353 Ga0070669_100016153 Ga0070669_1000161531 263
274 3300006058 Ga0075432_10053293 Ga0075432_100532932 263
275 3300006914 Ga0075436_100189665 Ga0075436_1001896652 263
276 3300009011 Ga0105251_10043837 Ga0105251_100438372 263
277 3300009011 Ga0105251_10060938 Ga0105251_100609381 263
278 3300009036 Ga0105244_10015538 Ga0105244_100155383 263
279 3300009036 Ga0105244_10034245 Ga0105244_100342452 263
280 3300009092 Ga0105250_10060560 Ga0105250_100605602 263
281 3300009092 Ga0105250_10109433 Ga0105250_101094332 263
282 3300011119 Ga0105246_10252502 Ga0105246_102525021 263
283 3300013100 Ga0157373_10095140 Ga0157373_100951402 263
284 3300013104 Ga0157370_10070850 Ga0157370_100708502 263
285 3300014497 Ga0182008_10050116 Ga0182008_100501162 263
286 3300015261 Ga0182006_1042010 Ga0182006_10420102 263
287 3300017792 Ga0163161_10047275 Ga0163161_100472752 263
288 3300025233 Ga0209437_100117 Ga0209437_10011788 263
289 3300025263 Ga0209565_1042813 Ga0209565_10428131 263
290 3300025291 Ga0209675_1012906 Ga0209675_10129063 263
291 3300025292 Ga0209676_1000002 Ga0209676_1000002680 263
292 3300025298 Ga0209050_1000006 Ga0209050_1000006890 263
293 3300025303 Ga0209051_1000001 Ga0209051_1000001680 263
294 3300025304 Ga0209257_1000056 Ga0209257_1000056349 263
295 3300025711 Ga0207696_1003166 Ga0207696_10031665 263
296 3300025711 Ga0207696_1064682 Ga0207696_10646821 263
297 3300025728 Ga0207655_1008146 Ga0207655_10081465 263
298 3300025728 Ga0207655_1008755 Ga0207655_10087555 263
299 3300025735 Ga0207713_1000551 Ga0207713_100055127 263
300 3300025735 Ga0207713_1000698 Ga0207713_100069832 263
301 3300025735 Ga0207713_1007651 Ga0207713_10076515 263
302 3300025735 Ga0207713_1037535 Ga0207713_10375352 263
303 3300027907 Ga0207428_10096153 Ga0207428_100961533 263
304 3300041407 Ga0439447_000475 Ga0439447_000475_12097_12888 263
305 3300041411 Ga0439466_0000127 Ga0439466_0000127_18517_19308 263
306 3300042009 Ga0439451_001062 Ga0439451_001062_4373_5164 263
307 3300042010 Ga0439452_016746 Ga0439452_016746_486_1277 263
308 3300042146 Ga0450907_000001 Ga0450907_000001_164123_164914 263
309 3300042185 Ga0450909_000028 Ga0450909_000028_3728_4519 263
310 3300042435 Ga0439434_0000001 Ga0439434_0000001_12884_13675 263
311 3300042993 Ga0439440_0006387 Ga0439440_0006387_192_983 263
312 3300044693 Ga0466961_0017663 Ga0466961_0017663_361_1191 263
313 3300046452 Ga0495617_002511 Ga0495617_002511_1580_2374 263
314 3300046452 Ga0495617_009243 Ga0495617_009243_375_1169 263
315 3300046453 Ga0495627_007667 Ga0495627_007667_2679_3473 263
316 3300046453 Ga0495627_009686 Ga0495627_009686_1324_2115 263
317 3300046455 Ga0495603_0020661 Ga0495603_0020661_602_1393 263
318 3300046458 Ga0495591_000278 Ga0495591_000278_30700_31494 263
319 3300046458 Ga0495591_000489 Ga0495591_000489_3872_4663 263
320 3300046458 Ga0495591_003441 Ga0495591_003441_2778_3569 263
321 3300046458 Ga0495591_022781 Ga0495591_022781_26_820 263
322 3300046460 Ga0495638_0062725 Ga0495638_0062725_1059_1850 263
323 3300046460 Ga0495638_0155651 Ga0495638_0155651_129_923 263
324 3300046471 Ga0495650_0003829 Ga0495650_0003829_4959_5753 263
325 3300046471 Ga0495650_0022298 Ga0495650_0022298_1589_2380 263
326 3300046474 Ga0495605_0003170 Ga0495605_0003170_5104_5895 263
327 3300046474 Ga0495605_0105235 Ga0495605_0105235_346_1140 263
328 3300046475 Ga0495639_0048998 Ga0495639_0048998_953_1744 263
329 3300046491 Ga0495584_0001788 Ga0495584_0001788_4324_5115 263
330 3300046492 Ga0495585_0005306 Ga0495585_0005306_1489_2283 263
331 3300046499 Ga0495594_0004492 Ga0495594_0004492_1653_2444 263
332 3300046500 Ga0495596_0000105 Ga0495596_0000105_39965_40759 263
333 3300046501 Ga0495607_0000812 Ga0495607_0000812_6830_7624 263
334 3300046501 Ga0495607_0001096 Ga0495607_0001096_14925_15716 263
335 3300046501 Ga0495607_0004786 Ga0495607_0004786_4104_4895 263
336 3300046501 Ga0495607_0008073 Ga0495607_0008073_3236_4030 263
337 3300046506 Ga0495583_0000518 Ga0495583_0000518_5709_6500 263
338 3300046506 Ga0495583_0009055 Ga0495583_0009055_948_1739 263
339 3300046507 Ga0495606_0000238 Ga0495606_0000238_41977_42768 263
340 3300046507 Ga0495606_0037354 Ga0495606_0037354_2018_2812 263
341 3300046512 Ga0495610_0007437 Ga0495610_0007437_4789_5580 263
342 3300046512 Ga0495610_0011746 Ga0495610_0011746_305_1099 263
343 3300046512 Ga0495610_0085343 Ga0495610_0085343_554_1345 263
344 3300046513 Ga0495616_0006414 Ga0495616_0006414_973_1764 263
345 3300046513 Ga0495616_0057950 Ga0495616_0057950_129_923 263
346 3300046515 Ga0495620_0001333 Ga0495620_0001333_11961_12752 263
347 3300046519 Ga0495632_0006295 Ga0495632_0006295_1565_2356 263
348 3300046519 Ga0495632_0041656 Ga0495632_0041656_1192_1986 263
349 3300046519 Ga0495632_0130717 Ga0495632_0130717_199_993 263
350 3300046520 Ga0495637_0000079 Ga0495637_0000079_1757_2548 263
351 3300046520 Ga0495637_0000168 Ga0495637_0000168_30569_31363 263
352 3300046520 Ga0495637_0016527 Ga0495637_0016527_1492_2283 263
353 3300046523 Ga0495644_0001134 Ga0495644_0001134_3039_3833 263
354 3300046523 Ga0495644_0004683 Ga0495644_0004683_128_922 263
355 3300046523 Ga0495644_0032223 Ga0495644_0032223_831_1622 263
356 3300046524 Ga0495648_0010454 Ga0495648_0010454_3866_4657 263
357 3300046524 Ga0495648_0044481 Ga0495648_0044481_534_1325 263
358 3300046524 Ga0495648_0092426 Ga0495648_0092426_630_1424 263
359 3300046528 Ga0495642_0001429 Ga0495642_0001429_3053_3844 263
360 3300046530 Ga0495654_0002037 Ga0495654_0002037_2880_3674 263
361 3300046530 Ga0495654_0005494 Ga0495654_0005494_84_875 263
362 3300046530 Ga0495654_0074943 Ga0495654_0074943_486_1280 263
363 3300046538 Ga0495609_0000211 Ga0495609_0000211_9016_9807 263
364 3300046542 Ga0495597_0004162 Ga0495597_0004162_400_1194 263
365 3300046542 Ga0495597_0014427 Ga0495597_0014427_2499_3293 263
366 3300046542 Ga0495597_0041828 Ga0495597_0041828_1073_1864 263
367 3300046542 Ga0495597_0071833 Ga0495597_0071833_406_1197 263
368 3300046557 Ga0495622_0000950 Ga0495622_0000950_4025_4816 263
369 3300046557 Ga0495622_0001653 Ga0495622_0001653_657_1448 263
370 3300046615 Ga0495656_0022259 Ga0495656_0022259_1184_1978 263
371 3300046616 Ga0495668_0000379 Ga0495668_0000379_50010_50804 263
372 3300046660 Ga0495625_0010604 Ga0495625_0010604_6207_7001 263
373 3300046660 Ga0495625_0057932 Ga0495625_0057932_380_1174 263
374 3300046660 Ga0495625_0121762 Ga0495625_0121762_77_868 263
375 3300046664 Ga0495659_0010559 Ga0495659_0010559_760_1551 263
376 3300046665 Ga0495661_0044355 Ga0495661_0044355_1060_1851 263
377 3300046665 Ga0495661_0106629 Ga0495661_0106629_645_1439 263
378 3300046674 Ga0495588_0021450 Ga0495588_0021450_1216_2007 263
379 3300046691 Ga0495670_0005984 Ga0495670_0005984_609_1400 263
380 3300046691 Ga0495670_0009663 Ga0495670_0009663_2627_3421 263
381 3300046691 Ga0495670_0198707 Ga0495670_0198707_220_1011 263
382 3300046692 Ga0495671_0005830 Ga0495671_0005830_1409_2203 263
383 3300046692 Ga0495671_0040098 Ga0495671_0040098_1097_1891 263
384 3300046692 Ga0495671_0056755 Ga0495671_0056755_876_1667 263
385 3300046694 Ga0495649_0031644 Ga0495649_0031644_652_1443 263
386 3300046810 Ga0495660_0001337 Ga0495660_0001337_13910_14701 263
387 3300046810 Ga0495660_0006140 Ga0495660_0006140_2317_3111 263
388 3300046810 Ga0495660_0008972 Ga0495660_0008972_4268_5059 263
389 3300046810 Ga0495660_0025741 Ga0495660_0025741_995_1789 263
390 3300047320 Ga0495672_0003101 Ga0495672_0003101_13616_14410 263
391 3300047320 Ga0495672_0045407 Ga0495672_0045407_220_1011 263
392 3300047323 Ga0495683_0000006 Ga0495683_0000006_191029_191820 263
393 3300047323 Ga0495683_0004073 Ga0495683_0004073_6664_7458 263
394 3300047323 Ga0495683_0010515 Ga0495683_0010515_1185_1979 263
395 3300047323 Ga0495683_0011994 Ga0495683_0011994_3725_4516 263
396 3300047446 Ga0495679_003203 Ga0495679_003203_3204_3995 263
397 3300047469 Ga0495673_0012195 Ga0495673_0012195_3571_4362 263
398 3300047469 Ga0495673_0031708 Ga0495673_0031708_128_922 263
399 3300047469 Ga0495673_0032001 Ga0495673_0032001_1447_2238 263
400 3300047469 Ga0495673_0040817 Ga0495673_0040817_1192_1986 263
401 3300047469 Ga0495673_0041288 Ga0495673_0041288_739_1530 263
402 3300047470 Ga0495681_0000628 Ga0495681_0000628_1887_2681 263
403 3300047470 Ga0495681_0012310 Ga0495681_0012310_445_1239 263
404 3300047470 Ga0495681_0023969 Ga0495681_0023969_1504_2295 263
405 3300047472 Ga0495686_0023469 Ga0495686_0023469_1551_2345 263
406 3300047472 Ga0495686_0109329 Ga0495686_0109329_794_1585 263
407 3300047673 Ga0495593_0071543 Ga0495593_0071543_330_1121 263
408 3300048091 Ga0495626_0000112 Ga0495626_0000112_30379_31170 263
409 3300048091 Ga0495626_0000302 Ga0495626_0000302_30561_31355 263
410 3300048913 Ga0496110_0139045 Ga0496110_0139045_1267_2058 263
411 3300048917 Ga0496114_0090444 Ga0496114_0090444_800_1594 263
412 3300048928 Ga0496125_0003996 Ga0496125_0003996_6088_6879 263
413 3300049459 Ga0495678_047627 Ga0495678_047627_543_1334 263
414 3300049460 Ga0495682_0012611 Ga0495682_0012611_200_991 263
415 3300049460 Ga0495682_0020529 Ga0495682_0020529_1527_2318 263
416 3300049758 Ga0501241_000050 Ga0501241_000050_30146_30937 263
417 3300050514 nmdc:mga08x19_118094_c1 nmdc:mga08x19_118094_c1_680_1474 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

32

262

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9892 5 251
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9873 4 260
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9812 5 251
5yoh-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine 0.9788 7 251
5yxf-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine 0.9787 7 251
ID Description Score Start End Superfamily
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9876 51 251 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9872 4 260 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9839 17 126 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9813 4 252 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9806 7 251 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A4Q6F1R4-F1-model_v4 deleted 1.001 39 251
AF-A0A3C0LYD4-F1-model_v4 deleted 1 106 206
AF-A0A534CML8-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9997 4 253 GO:0004239
GO:0006508
GO:0008773
GO:0008893
GO:0046872
GO:0070006
AF-A0A3M3I911-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9985 42 206 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A258LEB9-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9982 59 253 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
96.8 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map