F439094

General Info

Members Datasets Scaffolds Average Seq Length
417 172 834 168

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10175893|Ga0307405_101758933
Length 196
Sequence MARLRYALRNATYFRQSVSKRNCYFSIACVRISLVSHSSPDIDAFRAAALRCPLPQAIELIGEKWAFLILRGALNGLQHFEQFQAGLGIARNILSNRLARMVDGGILARSPDPLDGRKVIYSLTQKGEALLPVVIALRQWGEAWGHGSHDILLADQRDGKPVRPIRVLAEDGRELELHDLMWVNRASGAAQKRSGA

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
61 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
130 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
131 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
161 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
162 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
163 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
164 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
172 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 2.4
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10175893 3300031731 Bacteria 1531
2 JGI24746J21847_1019471 3300001977 Bacteria 956
3 JGI24740J21852_10003084 3300001979 Bacteria 7358
4 JGI24749J21850_1011805 3300002076 Bacteria 1226
5 JGI24751J29686_10081289 3300002459 Bacteria 671
6 Ga0065715_10002336 3300005293 Bacteria 9950
7 Ga0065715_10104650 3300005293 Bacteria 2946
8 Ga0065715_10742496 3300005293 Bacteria 634
9 Ga0070676_10050460 3300005328 Bacteria 2439
10 Ga0070683_100016431 3300005329 Bacteria 6529
11 Ga0070670_100003772 3300005331 Bacteria 12620
12 Ga0070670_100014993 3300005331 Bacteria 6651
13 Ga0070670_100066768 3300005331 Bacteria 3087
14 Ga0070670_100104991 3300005331 Bacteria 2434
15 Ga0070670_100274734 3300005331 Bacteria 1471
16 Ga0070677_10000942 3300005333 Bacteria 9456
17 Ga0070677_10417096 3300005333 Bacteria 711
18 Ga0068869_100289433 3300005334 Bacteria 1319
19 Ga0068869_100356924 3300005334 Bacteria 1193
20 Ga0070666_10021260 3300005335 Bacteria 4203
21 Ga0070660_100035088 3300005339 Bacteria 3794
22 Ga0070689_100244204 3300005340 Bacteria 1480
23 Ga0070661_100139763 3300005344 Bacteria 1824
24 Ga0070661_100240141 3300005344 Bacteria 1395
25 Ga0070692_10347816 3300005345 Bacteria 920
26 Ga0070668_100007897 3300005347 Bacteria 7900
27 Ga0070668_100058494 3300005347 Bacteria 2982
28 Ga0070668_100579269 3300005347 Bacteria 980
29 Ga0070669_100005378 3300005353 Bacteria 9240
30 Ga0070669_100032707 3300005353 Bacteria 3757
31 Ga0070675_100002232 3300005354 Bacteria 14371
32 Ga0070675_100279894 3300005354 Bacteria 1465
33 Ga0070671_100001973 3300005355 Bacteria 15747
34 Ga0070671_100017182 3300005355 Bacteria 5856
35 Ga0070671_100045212 3300005355 Bacteria 3660
36 Ga0070671_100129407 3300005355 Bacteria 2126
37 Ga0070674_100002401 3300005356 Bacteria 10353
38 Ga0070673_100332357 3300005364 Bacteria 1345
39 Ga0070659_100015627 3300005366 Bacteria 5685
40 Ga0070659_100134968 3300005366 Bacteria 2006
41 Ga0070667_100012065 3300005367 Bacteria 7152
42 Ga0070667_100013975 3300005367 Bacteria 6635
43 Ga0070667_100355184 3300005367 Bacteria 1327
44 Ga0070667_100527533 3300005367 Bacteria 1084
45 Ga0070667_100884770 3300005367 Bacteria 831
46 Ga0070694_100020393 3300005444 Bacteria 4225
47 Ga0070663_100019341 3300005455 Bacteria 4485
48 Ga0070663_100032975 3300005455 Bacteria 3575
49 Ga0070663_100036212 3300005455 Bacteria 3428
50 Ga0070662_100005777 3300005457 Bacteria 7926
51 Ga0070662_100095568 3300005457 Bacteria 2240
52 Ga0070662_100149129 3300005457 Bacteria 1819
53 Ga0070662_100652871 3300005457 Bacteria 887
54 Ga0070681_10246157 3300005458 Bacteria 1701
55 Ga0068867_100037845 3300005459 Bacteria 3508
56 Ga0068867_101644558 3300005459 Bacteria 601
57 Ga0070685_10089475 3300005466 Bacteria 1861
58 Ga0070685_10106288 3300005466 Bacteria 1722
59 Ga0070706_100251491 3300005467 Bacteria 1650
60 Ga0070684_100099746 3300005535 Bacteria 2592
61 Ga0068853_100352219 3300005539 Bacteria 1370
62 Ga0068853_100706899 3300005539 Bacteria 962
63 Ga0070672_100015765 3300005543 Bacteria 5396
64 Ga0070672_100481031 3300005543 Bacteria 1072
65 Ga0070686_100594100 3300005544 Bacteria 871
66 Ga0070665_100266884 3300005548 Bacteria 1713
67 Ga0070665_101027625 3300005548 Bacteria 836
68 Ga0068855_101171971 3300005563 Bacteria 800
69 Ga0070664_100007164 3300005564 Bacteria 8988
70 Ga0070664_100035434 3300005564 Bacteria 4189
71 Ga0068857_100007451 3300005577 Bacteria 9418
72 Ga0068857_100248867 3300005577 Bacteria 1629
73 Ga0068859_100008201 3300005617 Bacteria 10596
74 Ga0068859_100075359 3300005617 Bacteria 3414
75 Ga0068859_101322048 3300005617 Bacteria 794
76 Ga0068864_100006349 3300005618 Bacteria 9695
77 Ga0068864_100472335 3300005618 Bacteria 1202
78 Ga0068861_100034027 3300005719 Bacteria 3765
79 Ga0068861_100196420 3300005719 Bacteria 1690
80 Ga0068863_100015102 3300005841 Bacteria 7419
81 Ga0068863_100054224 3300005841 Bacteria 3799
82 Ga0068858_100050336 3300005842 Bacteria 3856
83 Ga0068860_100001606 3300005843 Bacteria 24269
84 Ga0068860_100482561 3300005843 Bacteria 1236
85 Ga0068860_100550865 3300005843 Bacteria 1155
86 Ga0068862_100002465 3300005844 Bacteria 16400
87 Ga0068862_100014713 3300005844 Bacteria 6498
88 Ga0068862_100016569 3300005844 Bacteria 6137
89 Ga0068862_100059042 3300005844 Bacteria 3292
90 Ga0068862_100430144 3300005844 Bacteria 1240
91 Ga0097621_100880377 3300006237 Bacteria 833
92 Ga0075370_10508559 3300006353 Bacteria 727
93 Ga0068871_100352195 3300006358 Bacteria 1302
94 Ga0068871_100515704 3300006358 Bacteria 1079
95 Ga0075431_100026284 3300006847 Bacteria 5971
96 Ga0075433_10401834 3300006852 Bacteria 1209
97 Ga0075434_100698513 3300006871 Bacteria 1032
98 Ga0097620_100008201 3300006931 Bacteria 10596
99 Ga0097620_100075364 3300006931 Bacteria 3414
100 Ga0097620_101322043 3300006931 Bacteria 794
101 Ga0111539_10048620 3300009094 Bacteria 5063
102 Ga0111539_10068144 3300009094 Bacteria 4201
103 Ga0111539_11002538 3300009094 Bacteria 971
104 Ga0105245_10103167 3300009098 Bacteria 2642
105 Ga0114129_10428553 3300009147 Bacteria 1738
106 Ga0114129_10837463 3300009147 Bacteria 1171
107 Ga0105248_10021046 3300009177 Bacteria 7227
108 Ga0105248_10064517 3300009177 Bacteria 4112
109 Ga0105248_10166663 3300009177 Bacteria 2483
110 Ga0105248_10317063 3300009177 Bacteria 1756
111 Ga0105248_10371567 3300009177 Bacteria 1610
112 Ga0105248_10451122 3300009177 Bacteria 1449
113 Ga0105238_11391108 3300009551 Unclassified 729
114 Ga0105249_10020574 3300009553 Bacteria 5900
115 Ga0105249_10033751 3300009553 Bacteria 4634
116 Ga0105249_10667898 3300009553 Bacteria 1098
117 Ga0157315_1014954 3300012508 Bacteria 750
118 Ga0157327_1000763 3300012512 Bacteria 1829
119 Ga0157373_10019788 3300013100 Bacteria 4896
120 Ga0157373_10185359 3300013100 Bacteria 1466
121 Ga0157369_11031170 3300013105 Bacteria 842
122 Ga0163162_11318228 3300013306 Unclassified 820
123 Ga0157375_10020928 3300013308 Bacteria 5987
124 Ga0157375_10101823 3300013308 Bacteria 2956
125 Ga0163163_10331433 3300014325 Bacteria 1576
126 Ga0163163_10447416 3300014325 Bacteria 1352
127 Ga0157380_10006945 3300014326 Bacteria 8012
128 Ga0157380_10024053 3300014326 Bacteria 4605
129 Ga0157380_10041983 3300014326 Bacteria 3573
130 Ga0157380_10175458 3300014326 Bacteria 1877
131 Ga0157380_11510359 3300014326 Bacteria 725
132 Ga0157380_11934881 3300014326 Bacteria 651
133 Ga0157377_10743747 3300014745 Bacteria 717
134 Ga0163161_10032124 3300017792 Bacteria 3746
135 Ga0163161_10543113 3300017792 Bacteria 952
136 Ga0207666_1034790 3300025271 Bacteria 779
137 Ga0207697_10012021 3300025315 Bacteria 3643
138 Ga0207682_10000177 3300025893 Bacteria 28884
139 Ga0207688_10022710 3300025901 Bacteria 3434
140 Ga0207645_10401825 3300025907 Bacteria 921
141 Ga0207684_10505172 3300025910 Bacteria 1036
142 Ga0207662_10069186 3300025918 Bacteria 2133
143 Ga0207681_10005272 3300025923 Bacteria 7941
144 Ga0207681_10438363 3300025923 Bacteria 1061
145 Ga0207681_10713086 3300025923 Bacteria 834
146 Ga0207650_10002036 3300025925 Bacteria 14153
147 Ga0207650_10003253 3300025925 Bacteria 11192
148 Ga0207650_10075640 3300025925 Bacteria 2542
149 Ga0207650_10620458 3300025925 Bacteria 910
150 Ga0207650_10708399 3300025925 Bacteria 851
151 Ga0207650_10759173 3300025925 Bacteria 821
152 Ga0207650_11168937 3300025925 Bacteria 655
153 Ga0207659_10032626 3300025926 Bacteria 3576
154 Ga0207659_10087255 3300025926 Bacteria 2322
155 Ga0207644_10009781 3300025931 Bacteria 6305
156 Ga0207644_10049364 3300025931 Bacteria 3012
157 Ga0207644_10096181 3300025931 Bacteria 2216
158 Ga0207644_10615625 3300025931 Bacteria 902
159 Ga0207690_10085685 3300025932 Bacteria 2212
160 Ga0207690_10375030 3300025932 Bacteria 1129
161 Ga0207706_10000489 3300025933 Bacteria 42307
162 Ga0207669_10205625 3300025937 Bacteria 1433
163 Ga0207691_10000784 3300025940 Bacteria 31530
164 Ga0207691_10592946 3300025940 Bacteria 938
165 Ga0207711_10003449 3300025941 Bacteria 13681
166 Ga0207711_10370033 3300025941 Bacteria 1329
167 Ga0207711_10485080 3300025941 Bacteria 1151
168 Ga0207689_10062637 3300025942 Bacteria 3059
169 Ga0207679_10055821 3300025945 Bacteria 2913
170 Ga0207679_10138352 3300025945 Bacteria 1964
171 Ga0207651_10063327 3300025960 Bacteria 2582
172 Ga0207651_10321174 3300025960 Bacteria 1294
173 Ga0207712_10010191 3300025961 Bacteria 5961
174 Ga0207668_10005131 3300025972 Bacteria 7703
175 Ga0207668_10109757 3300025972 Bacteria 2067
176 Ga0207668_10174703 3300025972 Bacteria 1688
177 Ga0207668_10341361 3300025972 Bacteria 1249
178 Ga0207668_11408695 3300025972 Bacteria 628
179 Ga0207640_10082546 3300025981 Bacteria 2201
180 Ga0207640_10093845 3300025981 Bacteria 2086
181 Ga0207640_10215401 3300025981 Bacteria 1466
182 Ga0207658_10002652 3300025986 Bacteria 12965
183 Ga0207658_10284949 3300025986 Bacteria 1418
184 Ga0207703_10075084 3300026035 Bacteria 2800
185 Ga0207639_10257505 3300026041 Bacteria 1525
186 Ga0207639_10272435 3300026041 Bacteria 1485
187 Ga0207678_10002271 3300026067 Bacteria 17395
188 Ga0207678_10048703 3300026067 Bacteria 3662
189 Ga0207641_10001862 3300026088 Bacteria 20270
190 Ga0207641_10085820 3300026088 Bacteria 2743
191 Ga0207648_10053642 3300026089 Bacteria 3523
192 Ga0207648_10554580 3300026089 Bacteria 1056
193 Ga0207648_11633934 3300026089 Bacteria 605
194 Ga0207676_10001070 3300026095 Bacteria 20850
195 Ga0207676_10452044 3300026095 Bacteria 1211
196 Ga0207676_10913480 3300026095 Bacteria 862
197 Ga0207674_10005045 3300026116 Bacteria 15754
198 Ga0207675_100014870 3300026118 Bacteria 7264
199 Ga0207675_100126455 3300026118 Bacteria 2421
200 Ga0207675_100290215 3300026118 Bacteria 1591
201 Ga0207698_10169592 3300026142 Bacteria 1920
202 Ga0209999_1036452 3300027543 Bacteria 918
203 Ga0209983_1012465 3300027665 Bacteria 1745
204 Ga0209971_1049544 3300027682 Bacteria 1014
205 Ga0209974_10004062 3300027876 Bacteria 5228
206 Ga0209974_10144509 3300027876 Bacteria 855
207 Ga0268266_10095008 3300028379 Bacteria 2618
208 Ga0268265_10001950 3300028380 Bacteria 16391
209 Ga0268265_10008920 3300028380 Bacteria 6778
210 Ga0268265_10192403 3300028380 Bacteria 1763
211 Ga0268265_10236319 3300028380 Bacteria 1609
212 Ga0268264_10051606 3300028381 Bacteria 3427
213 Ga0268264_10075703 3300028381 Bacteria 2862
214 Ga0268264_10173462 3300028381 Bacteria 1952
215 Ga0268264_10234129 3300028381 Bacteria 1698
216 Ga0268264_10514701 3300028381 Bacteria 1169
217 Ga0316177_1161192 3300030731 Bacteria 1061
218 Ga0316182_1161147 3300030745 Bacteria 1724
219 Ga0307408_100006534 3300031548 Bacteria 7725
220 Ga0307408_100015329 3300031548 Bacteria 5102
221 Ga0307408_100037216 3300031548 Bacteria 3426
222 Ga0307408_100156215 3300031548 Bacteria 1806
223 Ga0307408_100170649 3300031548 Bacteria 1736
224 Ga0307408_100178523 3300031548 Bacteria 1701
225 Ga0307408_100636348 3300031548 Bacteria 952
226 Ga0307408_100947596 3300031548 Bacteria 790
227 Ga0307408_101052898 3300031548 Bacteria 752
228 Ga0307405_10001698 3300031731 Bacteria 9398
229 Ga0307405_10034296 3300031731 Bacteria 3019
230 Ga0307405_10050580 3300031731 Bacteria 2574
231 Ga0307405_10058635 3300031731 Bacteria 2423
232 Ga0307405_10077908 3300031731 Bacteria 2155
233 Ga0307405_10078253 3300031731 Bacteria 2151
234 Ga0307405_10184903 3300031731 Bacteria 1499
235 Ga0307405_10251920 3300031731 Bacteria 1314
236 Ga0307405_10425139 3300031731 Bacteria 1047
237 Ga0307413_10000129 3300031824 Bacteria 19750
238 Ga0307413_10011676 3300031824 Bacteria 4335
239 Ga0307413_10020038 3300031824 Bacteria 3548
240 Ga0307413_10061889 3300031824 Bacteria 2312
241 Ga0307413_10114069 3300031824 Bacteria 1815
242 Ga0307413_10122117 3300031824 Bacteria 1766
243 Ga0307413_10408662 3300031824 Bacteria 1066
244 Ga0307410_10019663 3300031852 Bacteria 4113
245 Ga0307410_10025625 3300031852 Bacteria 3702
246 Ga0307410_10043129 3300031852 Bacteria 2987
247 Ga0307410_10047731 3300031852 Bacteria 2863
248 Ga0307410_10057363 3300031852 Bacteria 2651
249 Ga0307410_10074913 3300031852 Bacteria 2358
250 Ga0307410_10104170 3300031852 Bacteria 2039
251 Ga0307410_10174182 3300031852 Bacteria 1624
252 Ga0307410_10874645 3300031852 Bacteria 768
253 Ga0307410_11337663 3300031852 Unclassified 627
254 Ga0307406_10085694 3300031901 Bacteria 2107
255 Ga0307406_10098866 3300031901 Bacteria 1982
256 Ga0307406_10114923 3300031901 Bacteria 1860
257 Ga0307406_10118372 3300031901 Bacteria 1836
258 Ga0307406_10264958 3300031901 Bacteria 1302
259 Ga0307406_10342337 3300031901 Bacteria 1165
260 Ga0307406_10495328 3300031901 Bacteria 990
261 Ga0307407_10001015 3300031903 Bacteria 9662
262 Ga0307407_10013464 3300031903 Bacteria 3971
263 Ga0307407_10050718 3300031903 Bacteria 2375
264 Ga0307407_10061716 3300031903 Bacteria 2192
265 Ga0307407_10140924 3300031903 Bacteria 1555
266 Ga0307407_10163111 3300031903 Bacteria 1460
267 Ga0307407_10267029 3300031903 Bacteria 1179
268 Ga0307407_10516838 3300031903 Bacteria 877
269 Ga0307407_10519427 3300031903 Bacteria 875
270 Ga0307412_10017170 3300031911 Bacteria 4328
271 Ga0307412_10038187 3300031911 Bacteria 3090
272 Ga0307412_10071333 3300031911 Bacteria 2371
273 Ga0307412_10090665 3300031911 Bacteria 2137
274 Ga0307412_10145487 3300031911 Bacteria 1741
275 Ga0307412_10241679 3300031911 Bacteria 1397
276 Ga0307412_10386739 3300031911 Bacteria 1134
277 Ga0307412_10575789 3300031911 Bacteria 949
278 Ga0307412_10837172 3300031911 Bacteria 802
279 Ga0307412_11066160 3300031911 Bacteria 717
280 Ga0307409_100005212 3300031995 Bacteria 7442
281 Ga0307409_100006861 3300031995 Bacteria 6748
282 Ga0307409_100020074 3300031995 Bacteria 4544
283 Ga0307409_100023773 3300031995 Bacteria 4256
284 Ga0307409_100059123 3300031995 Bacteria 2981
285 Ga0307409_100103664 3300031995 Bacteria 2367
286 Ga0307409_100255980 3300031995 Bacteria 1603
287 Ga0307409_100256288 3300031995 Bacteria 1602
288 Ga0307409_100515947 3300031995 Bacteria 1167
289 Ga0307416_100010125 3300032002 Bacteria 6213
290 Ga0307416_100029037 3300032002 Bacteria 4124
291 Ga0307416_100040393 3300032002 Bacteria 3623
292 Ga0307416_100046930 3300032002 Bacteria 3414
293 Ga0307416_100066201 3300032002 Bacteria 2974
294 Ga0307416_100089701 3300032002 Bacteria 2633
295 Ga0307416_100205518 3300032002 Bacteria 1873
296 Ga0307416_100351657 3300032002 Bacteria 1491
297 Ga0307416_100456440 3300032002 Bacteria 1332
298 Ga0307416_100865451 3300032002 Bacteria 1002
299 Ga0307416_101815425 3300032002 Bacteria 714
300 Ga0307414_10001158 3300032004 Bacteria 13531
301 Ga0307414_10038049 3300032004 Bacteria 3226
302 Ga0307414_10042544 3300032004 Bacteria 3087
303 Ga0307414_10084263 3300032004 Bacteria 2337
304 Ga0307414_10095062 3300032004 Bacteria 2226
305 Ga0307414_10098220 3300032004 Bacteria 2196
306 Ga0307414_10112516 3300032004 Bacteria 2075
307 Ga0307414_10131637 3300032004 Bacteria 1942
308 Ga0307414_10155122 3300032004 Bacteria 1811
309 Ga0307414_10160922 3300032004 Bacteria 1783
310 Ga0307414_10163431 3300032004 Bacteria 1771
311 Ga0307414_10333567 3300032004 Bacteria 1296
312 Ga0307414_10466679 3300032004 Unclassified 1110
313 Ga0307414_10518519 3300032004 Bacteria 1057
314 Ga0307414_10554821 3300032004 Bacteria 1024
315 Ga0307414_11176639 3300032004 Bacteria 709
316 Ga0307411_10000313 3300032005 Bacteria 16232
317 Ga0307411_10003286 3300032005 Bacteria 7466
318 Ga0307411_10009698 3300032005 Bacteria 5082
319 Ga0307411_10017028 3300032005 Bacteria 4128
320 Ga0307411_10017161 3300032005 Bacteria 4115
321 Ga0307411_10026458 3300032005 Bacteria 3494
322 Ga0307411_10034432 3300032005 Bacteria 3152
323 Ga0307411_10187311 3300032005 Bacteria 1576
324 Ga0307411_10295370 3300032005 Bacteria 1297
325 Ga0307411_10436096 3300032005 Bacteria 1092
326 Ga0307411_10465935 3300032005 Bacteria 1060
327 Ga0307411_10557516 3300032005 Bacteria 978
328 Ga0307411_10636423 3300032005 Bacteria 921
329 Ga0307415_100021070 3300032126 Bacteria 3997
330 Ga0307415_100159764 3300032126 Bacteria 1745
331 Ga0307415_100173644 3300032126 Bacteria 1683
332 Ga0307415_100299313 3300032126 Bacteria 1332
333 Ga0307415_100303533 3300032126 Bacteria 1323
334 Ga0307415_100336888 3300032126 Bacteria 1264
335 Ga0307415_100461853 3300032126 Bacteria 1100
336 Ga0307415_100547592 3300032126 Bacteria 1020
337 Ga0307415_101073660 3300032126 Unclassified 752
338 Ga0307415_101226639 3300032126 Bacteria 708
339 Ga0307415_101340293 3300032126 Bacteria 679
340 Ga0373928_0108965 3300035084 Bacteria 731
341 Ga0395899_0117655 3300037312 Bacteria 1906
342 Ga0395900_0054345 3300037418 Bacteria 4124
343 Ga0395900_0079008 3300037418 Bacteria 3380
344 Ga0395898_0097154 3300037466 Bacteria 2829
345 Ga0395905_0020248 3300037471 Bacteria 6302
346 Ga0395905_0041701 3300037471 Bacteria 4308
347 Ga0395905_0102863 3300037471 Bacteria 2682
348 Ga0395905_0121386 3300037471 Bacteria 2456
349 Ga0395905_0156990 3300037471 Bacteria 2139
350 Ga0395901_0034780 3300038443 Bacteria 5204
351 Ga0395901_0109304 3300038443 Bacteria 2903
352 Ga0395901_0124432 3300038443 Bacteria 2709
353 Ga0395901_0151417 3300038443 Bacteria 2437
354 Ga0395901_0261602 3300038443 Bacteria 1801
355 Ga0439432_086885 3300042006 Bacteria 943
356 Ga0450890_002443 3300042127 Bacteria 2558
357 Ga0450905_001590 3300042142 Bacteria 2894
358 Ga0450889_000027 3300042144 Bacteria 12498
359 Ga0439435_0017417 3300042436 Bacteria 1816
360 Ga0439464_0084539 3300042439 Bacteria 951
361 Ga0495663_0007988 3300046525 Bacteria 2925
362 Ga0495663_0025322 3300046525 Bacteria 1729
363 Ga0495642_0160546 3300046528 Unclassified 974
364 Ga0495654_0207214 3300046530 Bacteria 836
365 Ga0495598_0049535 3300046537 Bacteria 1260
366 Ga0495598_0056888 3300046537 Bacteria 1195
367 Ga0495621_0006300 3300046539 Bacteria 3455
368 Ga0495621_0017747 3300046539 Bacteria 2304
369 Ga0495621_0045167 3300046539 Bacteria 1559
370 Ga0495633_0026704 3300046558 Bacteria 2830
371 Ga0495656_0200150 3300046615 Bacteria 991
372 Ga0495668_0034948 3300046616 Bacteria 2817
373 Ga0495659_0047273 3300046664 Bacteria 1556
374 Ga0495659_0171006 3300046664 Bacteria 881
375 Ga0495661_0213322 3300046665 Bacteria 1004
376 Ga0495669_0000276 3300046684 Bacteria 29327
377 Ga0495669_0013633 3300046684 Bacteria 3468
378 Ga0495669_0039834 3300046684 Bacteria 2081
379 Ga0495669_0047920 3300046684 Bacteria 1910
380 Ga0495669_0055759 3300046684 Bacteria 1780
381 Ga0495669_0152310 3300046684 Bacteria 1095
382 Ga0495669_0233888 3300046684 Bacteria 882
383 Ga0495670_0029610 3300046691 Bacteria 2718
384 Ga0495670_0156999 3300046691 Unclassified 1194
385 Ga0495670_0213647 3300046691 Bacteria 1023
386 Ga0495670_0493866 3300046691 Bacteria 664
387 Ga0495670_0500895 3300046691 Bacteria 659
388 Ga0495636_0100916 3300047318 Bacteria 1262
389 Ga0495677_0017008 3300047445 Bacteria 2637
390 Ga0495677_0062707 3300047445 Bacteria 1380
391 Ga0495677_0084050 3300047445 Bacteria 1195
392 Ga0495685_235734 3300047447 Bacteria 582
393 Ga0495681_0042155 3300047470 Bacteria 2211
394 Ga0496100_0277370 3300048903 Bacteria 1248
395 Ga0496102_0067128 3300048905 Bacteria 3289
396 Ga0496104_0595111 3300048907 Bacteria 1016
397 Ga0496108_0968999 3300048911 Bacteria 727
398 Ga0496109_0800176 3300048912 Bacteria 881
399 Ga0496110_0068209 3300048913 Bacteria 3148
400 Ga0496111_0020659 3300048914 Bacteria 4587
401 Ga0496112_0256951 3300048915 Bacteria 1697
402 Ga0496114_0057860 3300048917 Bacteria 3237
403 Ga0496115_0002889 3300048918 Bacteria 12383
404 Ga0501207_048315 3300049654 Unclassified 755
405 Ga0501247_071946 3300049677 Bacteria 547
406 Ga0501265_095855 3300049762 Bacteria 536
407 Ga0501268_007068 3300049765 Bacteria 1666
408 Ga0501273_003801 3300049770 Bacteria 1628
409 nmdc:mga05p37_449327_c1 3300050507 Bacteria 1492
410 nmdc:mga06r32_7686_c1 3300050510 Bacteria 9698
411 nmdc:mga08y16_108534_c1 3300050511 Bacteria 2889
412 nmdc:mga08y16_505129_c1 3300050511 Bacteria 1228
413 nmdc:mga0n895_690342_c1 3300050512 Bacteria 1017
414 nmdc:mga0a205_366034_c1 3300050515 Bacteria 1308
415 Ga0500658_0000150 3300053134 Bacteria 33225
416 Ga0500604_0233909 3300053151 Bacteria 635
417 2896431625 2896429255 Bacteria 2557483
418 Ga0307405_10175893
419 JGI24746J21847_1019471
420 JGI24740J21852_10003084
421 JGI24749J21850_1011805
422 JGI24751J29686_10081289
423 Ga0065715_10002336
424 Ga0065715_10104650
425 Ga0065715_10742496
426 Ga0070676_10050460
427 Ga0070683_100016431
428 Ga0070670_100003772
429 Ga0070670_100014993
430 Ga0070670_100066768
431 Ga0070670_100104991
432 Ga0070670_100274734
433 Ga0070677_10000942
434 Ga0070677_10417096
435 Ga0068869_100289433
436 Ga0068869_100356924
437 Ga0070666_10021260
438 Ga0070660_100035088
439 Ga0070689_100244204
440 Ga0070661_100139763
441 Ga0070661_100240141
442 Ga0070692_10347816
443 Ga0070668_100007897
444 Ga0070668_100058494
445 Ga0070668_100579269
446 Ga0070669_100005378
447 Ga0070669_100032707
448 Ga0070675_100002232
449 Ga0070675_100279894
450 Ga0070671_100001973
451 Ga0070671_100017182
452 Ga0070671_100045212
453 Ga0070671_100129407
454 Ga0070674_100002401
455 Ga0070673_100332357
456 Ga0070659_100015627
457 Ga0070659_100134968
458 Ga0070667_100012065
459 Ga0070667_100013975
460 Ga0070667_100355184
461 Ga0070667_100527533
462 Ga0070667_100884770
463 Ga0070694_100020393
464 Ga0070663_100019341
465 Ga0070663_100032975
466 Ga0070663_100036212
467 Ga0070662_100005777
468 Ga0070662_100095568
469 Ga0070662_100149129
470 Ga0070662_100652871
471 Ga0070681_10246157
472 Ga0068867_100037845
473 Ga0068867_101644558
474 Ga0070685_10089475
475 Ga0070685_10106288
476 Ga0070706_100251491
477 Ga0070684_100099746
478 Ga0068853_100352219
479 Ga0068853_100706899
480 Ga0070672_100015765
481 Ga0070672_100481031
482 Ga0070686_100594100
483 Ga0070665_100266884
484 Ga0070665_101027625
485 Ga0068855_101171971
486 Ga0070664_100007164
487 Ga0070664_100035434
488 Ga0068857_100007451
489 Ga0068857_100248867
490 Ga0068859_100008201
491 Ga0068859_100075359
492 Ga0068859_101322048
493 Ga0068864_100006349
494 Ga0068864_100472335
495 Ga0068861_100034027
496 Ga0068861_100196420
497 Ga0068863_100015102
498 Ga0068863_100054224
499 Ga0068858_100050336
500 Ga0068860_100001606
501 Ga0068860_100482561
502 Ga0068860_100550865
503 Ga0068862_100002465
504 Ga0068862_100014713
505 Ga0068862_100016569
506 Ga0068862_100059042
507 Ga0068862_100430144
508 Ga0097621_100880377
509 Ga0075370_10508559
510 Ga0068871_100352195
511 Ga0068871_100515704
512 Ga0075431_100026284
513 Ga0075433_10401834
514 Ga0075434_100698513
515 Ga0097620_100008201
516 Ga0097620_100075364
517 Ga0097620_101322043
518 Ga0111539_10048620
519 Ga0111539_10068144
520 Ga0111539_11002538
521 Ga0105245_10103167
522 Ga0114129_10428553
523 Ga0114129_10837463
524 Ga0105248_10021046
525 Ga0105248_10064517
526 Ga0105248_10166663
527 Ga0105248_10317063
528 Ga0105248_10371567
529 Ga0105248_10451122
530 Ga0105238_11391108
531 Ga0105249_10020574
532 Ga0105249_10033751
533 Ga0105249_10667898
534 Ga0157315_1014954
535 Ga0157327_1000763
536 Ga0157373_10019788
537 Ga0157373_10185359
538 Ga0157369_11031170
539 Ga0163162_11318228
540 Ga0157375_10020928
541 Ga0157375_10101823
542 Ga0163163_10331433
543 Ga0163163_10447416
544 Ga0157380_10006945
545 Ga0157380_10024053
546 Ga0157380_10041983
547 Ga0157380_10175458
548 Ga0157380_11510359
549 Ga0157380_11934881
550 Ga0157377_10743747
551 Ga0163161_10032124
552 Ga0163161_10543113
553 Ga0207666_1034790
554 Ga0207697_10012021
555 Ga0207682_10000177
556 Ga0207688_10022710
557 Ga0207645_10401825
558 Ga0207684_10505172
559 Ga0207662_10069186
560 Ga0207681_10005272
561 Ga0207681_10438363
562 Ga0207681_10713086
563 Ga0207650_10002036
564 Ga0207650_10003253
565 Ga0207650_10075640
566 Ga0207650_10620458
567 Ga0207650_10708399
568 Ga0207650_10759173
569 Ga0207650_11168937
570 Ga0207659_10032626
571 Ga0207659_10087255
572 Ga0207644_10009781
573 Ga0207644_10049364
574 Ga0207644_10096181
575 Ga0207644_10615625
576 Ga0207690_10085685
577 Ga0207690_10375030
578 Ga0207706_10000489
579 Ga0207669_10205625
580 Ga0207691_10000784
581 Ga0207691_10592946
582 Ga0207711_10003449
583 Ga0207711_10370033
584 Ga0207711_10485080
585 Ga0207689_10062637
586 Ga0207679_10055821
587 Ga0207679_10138352
588 Ga0207651_10063327
589 Ga0207651_10321174
590 Ga0207712_10010191
591 Ga0207668_10005131
592 Ga0207668_10109757
593 Ga0207668_10174703
594 Ga0207668_10341361
595 Ga0207668_11408695
596 Ga0207640_10082546
597 Ga0207640_10093845
598 Ga0207640_10215401
599 Ga0207658_10002652
600 Ga0207658_10284949
601 Ga0207703_10075084
602 Ga0207639_10257505
603 Ga0207639_10272435
604 Ga0207678_10002271
605 Ga0207678_10048703
606 Ga0207641_10001862
607 Ga0207641_10085820
608 Ga0207648_10053642
609 Ga0207648_10554580
610 Ga0207648_11633934
611 Ga0207676_10001070
612 Ga0207676_10452044
613 Ga0207676_10913480
614 Ga0207674_10005045
615 Ga0207675_100014870
616 Ga0207675_100126455
617 Ga0207675_100290215
618 Ga0207698_10169592
619 Ga0209999_1036452
620 Ga0209983_1012465
621 Ga0209971_1049544
622 Ga0209974_10004062
623 Ga0209974_10144509
624 Ga0268266_10095008
625 Ga0268265_10001950
626 Ga0268265_10008920
627 Ga0268265_10192403
628 Ga0268265_10236319
629 Ga0268264_10051606
630 Ga0268264_10075703
631 Ga0268264_10173462
632 Ga0268264_10234129
633 Ga0268264_10514701
634 Ga0316177_1161192
635 Ga0316182_1161147
636 Ga0307408_100006534
637 Ga0307408_100015329
638 Ga0307408_100037216
639 Ga0307408_100156215
640 Ga0307408_100170649
641 Ga0307408_100178523
642 Ga0307408_100636348
643 Ga0307408_100947596
644 Ga0307408_101052898
645 Ga0307405_10001698
646 Ga0307405_10034296
647 Ga0307405_10050580
648 Ga0307405_10058635
649 Ga0307405_10077908
650 Ga0307405_10078253
651 Ga0307405_10184903
652 Ga0307405_10251920
653 Ga0307405_10425139
654 Ga0307413_10000129
655 Ga0307413_10011676
656 Ga0307413_10020038
657 Ga0307413_10061889
658 Ga0307413_10114069
659 Ga0307413_10122117
660 Ga0307413_10408662
661 Ga0307410_10019663
662 Ga0307410_10025625
663 Ga0307410_10043129
664 Ga0307410_10047731
665 Ga0307410_10057363
666 Ga0307410_10074913
667 Ga0307410_10104170
668 Ga0307410_10174182
669 Ga0307410_10874645
670 Ga0307410_11337663
671 Ga0307406_10085694
672 Ga0307406_10098866
673 Ga0307406_10114923
674 Ga0307406_10118372
675 Ga0307406_10264958
676 Ga0307406_10342337
677 Ga0307406_10495328
678 Ga0307407_10001015
679 Ga0307407_10013464
680 Ga0307407_10050718
681 Ga0307407_10061716
682 Ga0307407_10140924
683 Ga0307407_10163111
684 Ga0307407_10267029
685 Ga0307407_10516838
686 Ga0307407_10519427
687 Ga0307412_10017170
688 Ga0307412_10038187
689 Ga0307412_10071333
690 Ga0307412_10090665
691 Ga0307412_10145487
692 Ga0307412_10241679
693 Ga0307412_10386739
694 Ga0307412_10575789
695 Ga0307412_10837172
696 Ga0307412_11066160
697 Ga0307409_100005212
698 Ga0307409_100006861
699 Ga0307409_100020074
700 Ga0307409_100023773
701 Ga0307409_100059123
702 Ga0307409_100103664
703 Ga0307409_100255980
704 Ga0307409_100256288
705 Ga0307409_100515947
706 Ga0307416_100010125
707 Ga0307416_100029037
708 Ga0307416_100040393
709 Ga0307416_100046930
710 Ga0307416_100066201
711 Ga0307416_100089701
712 Ga0307416_100205518
713 Ga0307416_100351657
714 Ga0307416_100456440
715 Ga0307416_100865451
716 Ga0307416_101815425
717 Ga0307414_10001158
718 Ga0307414_10038049
719 Ga0307414_10042544
720 Ga0307414_10084263
721 Ga0307414_10095062
722 Ga0307414_10098220
723 Ga0307414_10112516
724 Ga0307414_10131637
725 Ga0307414_10155122
726 Ga0307414_10160922
727 Ga0307414_10163431
728 Ga0307414_10333567
729 Ga0307414_10466679
730 Ga0307414_10518519
731 Ga0307414_10554821
732 Ga0307414_11176639
733 Ga0307411_10000313
734 Ga0307411_10003286
735 Ga0307411_10009698
736 Ga0307411_10017028
737 Ga0307411_10017161
738 Ga0307411_10026458
739 Ga0307411_10034432
740 Ga0307411_10187311
741 Ga0307411_10295370
742 Ga0307411_10436096
743 Ga0307411_10465935
744 Ga0307411_10557516
745 Ga0307411_10636423
746 Ga0307415_100021070
747 Ga0307415_100159764
748 Ga0307415_100173644
749 Ga0307415_100299313
750 Ga0307415_100303533
751 Ga0307415_100336888
752 Ga0307415_100461853
753 Ga0307415_100547592
754 Ga0307415_101073660
755 Ga0307415_101226639
756 Ga0307415_101340293
757 Ga0373928_0108965
758 Ga0395899_0117655
759 Ga0395900_0054345
760 Ga0395900_0079008
761 Ga0395898_0097154
762 Ga0395905_0020248
763 Ga0395905_0041701
764 Ga0395905_0102863
765 Ga0395905_0121386
766 Ga0395905_0156990
767 Ga0395901_0034780
768 Ga0395901_0109304
769 Ga0395901_0124432
770 Ga0395901_0151417
771 Ga0395901_0261602
772 Ga0439432_086885
773 Ga0450890_002443
774 Ga0450905_001590
775 Ga0450889_000027
776 Ga0439435_0017417
777 Ga0439464_0084539
778 Ga0495663_0007988
779 Ga0495663_0025322
780 Ga0495642_0160546
781 Ga0495654_0207214
782 Ga0495598_0049535
783 Ga0495598_0056888
784 Ga0495621_0006300
785 Ga0495621_0017747
786 Ga0495621_0045167
787 Ga0495633_0026704
788 Ga0495656_0200150
789 Ga0495668_0034948
790 Ga0495659_0047273
791 Ga0495659_0171006
792 Ga0495661_0213322
793 Ga0495669_0000276
794 Ga0495669_0013633
795 Ga0495669_0039834
796 Ga0495669_0047920
797 Ga0495669_0055759
798 Ga0495669_0152310
799 Ga0495669_0233888
800 Ga0495670_0029610
801 Ga0495670_0156999
802 Ga0495670_0213647
803 Ga0495670_0493866
804 Ga0495670_0500895
805 Ga0495636_0100916
806 Ga0495677_0017008
807 Ga0495677_0062707
808 Ga0495677_0084050
809 Ga0495685_235734
810 Ga0495681_0042155
811 Ga0496100_0277370
812 Ga0496102_0067128
813 Ga0496104_0595111
814 Ga0496108_0968999
815 Ga0496109_0800176
816 Ga0496110_0068209
817 Ga0496111_0020659
818 Ga0496112_0256951
819 Ga0496114_0057860
820 Ga0496115_0002889
821 Ga0501207_048315
822 Ga0501247_071946
823 Ga0501265_095855
824 Ga0501268_007068
825 Ga0501273_003801
826 nmdc:mga05p37_449327_c1
827 nmdc:mga06r32_7686_c1
828 nmdc:mga08y16_108534_c1
829 nmdc:mga08y16_505129_c1
830 nmdc:mga0n895_690342_c1
831 nmdc:mga0a205_366034_c1
832 Ga0500658_0000150
833 Ga0500604_0233909
834 2896431625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

60

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9011 39 95
5k5o-assembly1.cif.gz_B structure of aspa-26mer dna complex 0.894 37 111
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8804 52 95
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8724 44 94
5k5q-assembly1.cif.gz_C structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.8662 38 114
ID Description Score Start End Superfamily
af_I1L271_42_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9196 60 96 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9065 30 96 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9011 39 95 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8857 34 102 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8804 52 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0W1QR90-F1-model_v4 Transcriptional regulator 0.9049 23 157 GO:0003677
AF-A0A520J8J2-F1-model_v4 Transcriptional regulator 0.9045 21 158 GO:0003677
AF-A0A2T6LV19-F1-model_v4 HxlR family transcriptional regulator 0.9029 22 156 GO:0003677
AF-A0A6H2DN87-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9005 13 157 GO:0003677
AF-A0A839Z1V1-F1-model_v4 DNA-binding HxlR family transcriptional regulator 0.8973 10 163 GO:0003677

Map