F439067

General Info

Members Datasets Scaffolds Average Seq Length
417 234 834 215

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10131631|Ga0157375_101316312
Length 251
Sequence MLGLFCIERMAQFSGQDNKNAHFAALMGNVDIVNLLSHLIIYMVVLLLAISCHEAGHAWMSYKFGDDTAYMLGRVTLNPVAHTDPIGTLLIPIVNFLISAAGGAGGFFLIGWGKPTPVNPLRWRQKDLANVMVSIAGILANLLIATIAFTIIKVLRVTGLAYAIPDSLLEPVGLLLTNMLSMNISLAVFNLLPFPPLDGSKVLETFLPPSMQPLYEILEQYGFVILMVLMYMGVFSAIVSPILRVVYSFLR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
190 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
191 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
197 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
200 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
201 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
204 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
205 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
206 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
211 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
212 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
213 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
214 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
217 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
220 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
223 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
224 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
225 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.36
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 17.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10131631 3300013308 Bacteria 2621
2 SwRhRL2b_contig_1904902 2162886007 Bacteria 1722
3 MRS1b_contig_1754336 2162886011 Bacteria 961
4 CNAas_1000335 3300000532 Bacteria 4494
5 JGI24737J22298_10049178 3300001990 Bacteria 1283
6 JGI24742J22300_10011758 3300002244 Bacteria 1456
7 rootH2_10144893 3300003320 Bacteria 1359
8 Ga0065704_10092815 3300005289 Bacteria 2632
9 Ga0065704_10309908 3300005289 Unclassified 823
10 Ga0065712_10002216 3300005290 Bacteria 7608
11 Ga0065712_10093476 3300005290 Unclassified 2291
12 Ga0065715_10021285 3300005293 Bacteria 2141
13 Ga0065715_10091992 3300005293 Bacteria 5406
14 Ga0065715_10104002 3300005293 Bacteria 2992
15 Ga0065707_10003373 3300005295 Bacteria 7309
16 Ga0065707_10097403 3300005295 Unclassified 3178
17 Ga0070690_100109231 3300005330 Bacteria 1843
18 Ga0070670_100008804 3300005331 Bacteria 8615
19 Ga0070670_100149099 3300005331 Bacteria 2024
20 Ga0070670_100173231 3300005331 Unclassified 1872
21 Ga0070670_100299882 3300005331 Bacteria 1405
22 Ga0068869_100042560 3300005334 Bacteria 3256
23 Ga0068869_100057431 3300005334 Bacteria 2841
24 Ga0068869_100057757 3300005334 Bacteria 2834
25 Ga0068869_100326833 3300005334 Unclassified 1245
26 Ga0070666_10033572 3300005335 Bacteria 3396
27 Ga0070680_100321138 3300005336 Bacteria 1314
28 Ga0070682_100006339 3300005337 Bacteria 6641
29 Ga0068868_100115798 3300005338 Bacteria 2182
30 Ga0070689_100104530 3300005340 Bacteria 2245
31 Ga0070689_100474314 3300005340 Bacteria 1068
32 Ga0070687_100096679 3300005343 Bacteria 1645
33 Ga0070687_100283525 3300005343 Unclassified 1044
34 Ga0070692_10022205 3300005345 Bacteria 3097
35 Ga0070675_100351774 3300005354 Bacteria 1306
36 Ga0070671_100015022 3300005355 Bacteria 6253
37 Ga0070674_100013739 3300005356 Bacteria 5011
38 Ga0070673_100230422 3300005364 Bacteria 1607
39 Ga0070667_100037963 3300005367 Bacteria 4039
40 Ga0070703_10004100 3300005406 Unclassified 4113
41 Ga0070709_10068189 3300005434 Bacteria 2287
42 Ga0070701_10051511 3300005438 Bacteria 2136
43 Ga0070705_100001506 3300005440 Bacteria 12262
44 Ga0070705_100073144 3300005440 Bacteria 2079
45 Ga0070705_100167622 3300005440 Unclassified 1475
46 Ga0070705_100208936 3300005440 Bacteria 1344
47 Ga0070705_100239116 3300005440 Unclassified 1268
48 Ga0070700_100015586 3300005441 Bacteria 4314
49 Ga0070700_100033714 3300005441 Unclassified 3086
50 Ga0070694_100024584 3300005444 Bacteria 3889
51 Ga0070694_100183780 3300005444 Bacteria 1548
52 Ga0070694_100191310 3300005444 Bacteria 1520
53 Ga0070694_100293189 3300005444 Bacteria 1244
54 Ga0070708_100116378 3300005445 Unclassified 2461
55 Ga0070708_100164744 3300005445 Bacteria 2067
56 Ga0070708_100511591 3300005445 Bacteria 1133
57 Ga0070678_100053796 3300005456 Bacteria 2930
58 Ga0070681_10060950 3300005458 Bacteria 3749
59 Ga0070681_10479893 3300005458 Bacteria 1156
60 Ga0068867_100007607 3300005459 Bacteria 7662
61 Ga0070706_100038049 3300005467 Bacteria 4442
62 Ga0070706_100050225 3300005467 Bacteria 3848
63 Ga0070706_100176843 3300005467 Bacteria 1993
64 Ga0070706_100249396 3300005467 Bacteria 1657
65 Ga0070707_100024885 3300005468 Bacteria 5674
66 Ga0070698_100018907 3300005471 Bacteria 7248
67 Ga0070699_100033485 3300005518 Bacteria 4439
68 Ga0070699_100239876 3300005518 Bacteria 1618
69 Ga0070697_100000462 3300005536 Bacteria 31136
70 Ga0070697_100035851 3300005536 Bacteria 4004
71 Ga0070697_100216093 3300005536 Bacteria 1633
72 Ga0068853_100041121 3300005539 Bacteria 3947
73 Ga0068853_100308162 3300005539 Bacteria 1465
74 Ga0068853_101064997 3300005539 Bacteria 779
75 Ga0070672_100003144 3300005543 Bacteria 10667
76 Ga0070686_100052511 3300005544 Bacteria 2599
77 Ga0070695_100018213 3300005545 Bacteria 4264
78 Ga0070695_100051215 3300005545 Bacteria 2649
79 Ga0070695_100183882 3300005545 Bacteria 1483
80 Ga0070695_100249669 3300005545 Bacteria 1291
81 Ga0070696_100047943 3300005546 Unclassified 2965
82 Ga0070693_100001493 3300005547 Bacteria 10543
83 Ga0070693_100056474 3300005547 Bacteria 2266
84 Ga0070693_100358888 3300005547 Bacteria 999
85 Ga0070704_100068774 3300005549 Bacteria 2563
86 Ga0070704_100421900 3300005549 Bacteria 1143
87 Ga0070704_100825553 3300005549 Unclassified 830
88 Ga0068855_100206952 3300005563 Bacteria 2207
89 Ga0068855_100221880 3300005563 Bacteria 2119
90 Ga0070664_100170238 3300005564 Bacteria 1932
91 Ga0070664_100507716 3300005564 Bacteria 1112
92 Ga0068854_100154659 3300005578 Bacteria 1771
93 Ga0070702_100015492 3300005615 Unclassified 3894
94 Ga0070702_100028331 3300005615 Bacteria 3035
95 Ga0070702_100061729 3300005615 Bacteria 2183
96 Ga0068852_100752078 3300005616 Bacteria 987
97 Ga0068859_100042857 3300005617 Unclassified 4547
98 Ga0068859_100069305 3300005617 Unclassified 3561
99 Ga0068859_100273958 3300005617 Bacteria 1780
100 Ga0068859_100391250 3300005617 Bacteria 1486
101 Ga0068859_100467148 3300005617 Bacteria 1357
102 Ga0068864_100034127 3300005618 Bacteria 4326
103 Ga0068864_100052297 3300005618 Bacteria 3520
104 Ga0068864_101101206 3300005618 Unclassified 790
105 Ga0068866_10007897 3300005718 Bacteria 4466
106 Ga0068861_100021833 3300005719 Bacteria 4604
107 Ga0068861_100153081 3300005719 Bacteria 1894
108 Ga0068851_10003965 3300005834 Bacteria 6629
109 Ga0068870_10021391 3300005840 Bacteria 3163
110 Ga0068870_10046661 3300005840 Unclassified 2273
111 Ga0068863_100023704 3300005841 Bacteria 5857
112 Ga0068858_100026001 3300005842 Bacteria 5444
113 Ga0068858_100036344 3300005842 Bacteria 4567
114 Ga0068860_100015924 3300005843 Bacteria 7338
115 Ga0068860_100035815 3300005843 Bacteria 4758
116 Ga0068860_100904458 3300005843 Unclassified 899
117 Ga0068862_100150654 3300005844 Bacteria 2070
118 Ga0068862_100199900 3300005844 Bacteria 1802
119 Ga0081539_10023561 3300005985 Bacteria 4029
120 Ga0097621_100071889 3300006237 Bacteria 2860
121 Ga0097621_100128497 3300006237 Bacteria 2154
122 Ga0068871_100003839 3300006358 Bacteria 10355
123 Ga0068871_100024273 3300006358 Bacteria 4699
124 Ga0075428_100195732 3300006844 Bacteria 2186
125 Ga0075428_100314715 3300006844 Bacteria 1683
126 Ga0075431_100765016 3300006847 Unclassified 941
127 Ga0075433_10067532 3300006852 Unclassified 3138
128 Ga0075433_10094309 3300006852 Bacteria 2649
129 Ga0075433_10456847 3300006852 Bacteria 1126
130 Ga0075434_100031119 3300006871 Bacteria 5260
131 Ga0075434_100077355 3300006871 Bacteria 3322
132 Ga0075434_100131296 3300006871 Bacteria 2524
133 Ga0075434_100358516 3300006871 Bacteria 1479
134 Ga0075434_100888395 3300006871 Unclassified 906
135 Ga0075429_100504329 3300006880 Bacteria 1060
136 Ga0068865_100012741 3300006881 Bacteria 5300
137 Ga0075436_100329816 3300006914 Unclassified 1097
138 Ga0097620_100042858 3300006931 Unclassified 4547
139 Ga0097620_100069302 3300006931 Unclassified 3561
140 Ga0097620_100273986 3300006931 Bacteria 1780
141 Ga0097620_100391250 3300006931 Bacteria 1486
142 Ga0097620_100467158 3300006931 Bacteria 1357
143 Ga0099794_10106741 3300007265 Unclassified 1401
144 Ga0105251_10127800 3300009011 Bacteria 1153
145 Ga0105240_10059063 3300009093 Bacteria 4787
146 Ga0111539_10004928 3300009094 Bacteria 17367
147 Ga0111539_10025068 3300009094 Bacteria 7310
148 Ga0111539_10771117 3300009094 Bacteria 1119
149 Ga0105245_10099962 3300009098 Bacteria 2683
150 Ga0114129_10262170 3300009147 Unclassified 2315
151 Ga0114129_10455327 3300009147 Bacteria 1677
152 Ga0114129_10716491 3300009147 Unclassified 1284
153 Ga0105243_10003457 3300009148 Bacteria 12770
154 Ga0105243_10014883 3300009148 Bacteria 5887
155 Ga0105243_10335681 3300009148 Bacteria 1382
156 Ga0105243_10401951 3300009148 Bacteria 1273
157 Ga0105243_10853172 3300009148 Bacteria 902
158 Ga0105241_10011560 3300009174 Bacteria 6473
159 Ga0105241_10045977 3300009174 Bacteria 3314
160 Ga0105241_10057461 3300009174 Bacteria 2985
161 Ga0105241_10099469 3300009174 Bacteria 2310
162 Ga0105241_10110586 3300009174 Bacteria 2198
163 Ga0105241_10173461 3300009174 Bacteria 1783
164 Ga0105241_10397410 3300009174 Unclassified 1208
165 Ga0105241_10403298 3300009174 Bacteria 1200
166 Ga0105242_10006868 3300009176 Bacteria 8778
167 Ga0105242_10102765 3300009176 Bacteria 2424
168 Ga0105242_10715459 3300009176 Bacteria 981
169 Ga0105248_10023544 3300009177 Bacteria 6841
170 Ga0105248_10449833 3300009177 Unclassified 1451
171 Ga0105248_10911797 3300009177 Bacteria 992
172 Ga0105237_10001358 3300009545 Bacteria 32392
173 Ga0105238_10015961 3300009551 Bacteria 7600
174 Ga0105249_10059157 3300009553 Unclassified 3514
175 Ga0105249_10086264 3300009553 Bacteria 2927
176 Ga0105249_10297067 3300009553 Bacteria 1619
177 Ga0105239_10034337 3300010375 Bacteria 5569
178 Ga0105239_10487304 3300010375 Bacteria 1401
179 Ga0105246_10049616 3300011119 Unclassified 2875
180 Ga0105246_10060228 3300011119 Bacteria 2637
181 Ga0105246_10332511 3300011119 Unclassified 1239
182 Ga0157373_10058698 3300013100 Unclassified 2727
183 Ga0157371_10139417 3300013102 Bacteria 1727
184 Ga0157374_10622484 3300013296 Bacteria 1090
185 Ga0157378_10030695 3300013297 Bacteria 4746
186 Ga0157378_10143484 3300013297 Bacteria 2219
187 Ga0157378_10334973 3300013297 Bacteria 1474
188 Ga0163162_10125181 3300013306 Unclassified 2676
189 Ga0163162_10218239 3300013306 Bacteria 2037
190 Ga0163162_10707361 3300013306 Unclassified 1129
191 Ga0163162_10728316 3300013306 Bacteria 1112
192 Ga0157372_10160250 3300013307 Bacteria 2600
193 Ga0157375_10478504 3300013308 Bacteria 1410
194 Ga0163163_10018968 3300014325 Bacteria 6452
195 Ga0163163_10083428 3300014325 Bacteria 3201
196 Ga0163163_10111958 3300014325 Bacteria 2758
197 Ga0163163_10309927 3300014325 Bacteria 1631
198 Ga0163163_10353435 3300014325 Bacteria 1526
199 Ga0163163_10448099 3300014325 Bacteria 1351
200 Ga0163163_10696821 3300014325 Bacteria 1079
201 Ga0163163_10790111 3300014325 Bacteria 1012
202 Ga0157380_10096049 3300014326 Bacteria 2456
203 Ga0157380_10150237 3300014326 Bacteria 2013
204 Ga0157377_10025215 3300014745 Bacteria 3169
205 Ga0157377_10121789 3300014745 Bacteria 1582
206 Ga0157379_10040315 3300014968 Bacteria 4167
207 Ga0163161_10033564 3300017792 Bacteria 3667
208 Ga0163161_10039790 3300017792 Bacteria 3377
209 Ga0207656_10006554 3300025321 Bacteria 4195
210 Ga0207713_1093819 3300025735 Bacteria 1049
211 Ga0207653_10001441 3300025885 Bacteria 7715
212 Ga0207642_10011802 3300025899 Bacteria 3131
213 Ga0207680_10067622 3300025903 Bacteria 2201
214 Ga0207647_10012882 3300025904 Bacteria 5810
215 Ga0207647_10146512 3300025904 Bacteria 1381
216 Ga0207643_10000775 3300025908 Bacteria 19477
217 Ga0207643_10010121 3300025908 Bacteria 5070
218 Ga0207643_10031391 3300025908 Bacteria 2961
219 Ga0207684_10019912 3300025910 Bacteria 5735
220 Ga0207684_10215704 3300025910 Bacteria 1656
221 Ga0207684_10505747 3300025910 Unclassified 1035
222 Ga0207654_10045800 3300025911 Bacteria 2491
223 Ga0207654_10054528 3300025911 Bacteria 2310
224 Ga0207654_10100429 3300025911 Bacteria 1782
225 Ga0207654_10106023 3300025911 Unclassified 1740
226 Ga0207707_10045726 3300025912 Bacteria 3815
227 Ga0207707_10594480 3300025912 Unclassified 937
228 Ga0207695_10189906 3300025913 Bacteria 1972
229 Ga0207671_10002677 3300025914 Bacteria 18681
230 Ga0207660_10349997 3300025917 Unclassified 1184
231 Ga0207652_10153564 3300025921 Bacteria 2062
232 Ga0207646_10116642 3300025922 Bacteria 2398
233 Ga0207646_10630036 3300025922 Unclassified 961
234 Ga0207650_10085288 3300025925 Unclassified 2402
235 Ga0207650_10145321 3300025925 Bacteria 1867
236 Ga0207650_10289680 3300025925 Bacteria 1335
237 Ga0207659_10788222 3300025926 Bacteria 816
238 Ga0207644_10048749 3300025931 Bacteria 3030
239 Ga0207686_10030879 3300025934 Bacteria 3177
240 Ga0207686_10068700 3300025934 Bacteria 2271
241 Ga0207709_10003946 3300025935 Bacteria 8656
242 Ga0207709_10137279 3300025935 Bacteria 1676
243 Ga0207709_10369241 3300025935 Bacteria 1088
244 Ga0207709_10493674 3300025935 Bacteria 954
245 Ga0207670_10001276 3300025936 Bacteria 13298
246 Ga0207670_10047728 3300025936 Bacteria 2854
247 Ga0207669_10127891 3300025937 Bacteria 1739
248 Ga0207704_10060375 3300025938 Bacteria 2346
249 Ga0207704_10949296 3300025938 Bacteria 725
250 Ga0207665_10044406 3300025939 Bacteria 2974
251 Ga0207691_10005451 3300025940 Bacteria 12285
252 Ga0207711_10260291 3300025941 Unclassified 1594
253 Ga0207711_10689049 3300025941 Unclassified 953
254 Ga0207689_10003658 3300025942 Bacteria 14026
255 Ga0207689_10005999 3300025942 Bacteria 10747
256 Ga0207689_10072951 3300025942 Bacteria 2820
257 Ga0207689_10140075 3300025942 Unclassified 1992
258 Ga0207679_10050540 3300025945 Bacteria 3039
259 Ga0207667_10195171 3300025949 Bacteria 2077
260 Ga0207651_10115897 3300025960 Bacteria 2021
261 Ga0207712_10161369 3300025961 Bacteria 1742
262 Ga0207712_10602055 3300025961 Bacteria 951
263 Ga0207640_10221405 3300025981 Bacteria 1449
264 Ga0207658_10016563 3300025986 Bacteria 5073
265 Ga0207677_10074409 3300026023 Bacteria 2410
266 Ga0207703_10121630 3300026035 Bacteria 2241
267 Ga0207703_10169300 3300026035 Bacteria 1920
268 Ga0207708_10019347 3300026075 Bacteria 5131
269 Ga0207708_10026243 3300026075 Unclassified 4407
270 Ga0207708_10026370 3300026075 Bacteria 4397
271 Ga0207708_10329199 3300026075 Bacteria 1248
272 Ga0207641_10181197 3300026088 Bacteria 1929
273 Ga0207648_10003674 3300026089 Bacteria 16053
274 Ga0207648_10045968 3300026089 Bacteria 3828
275 Ga0207648_10181502 3300026089 Bacteria 1863
276 Ga0207648_10454993 3300026089 Unclassified 1166
277 Ga0207676_10011223 3300026095 Bacteria 6399
278 Ga0207676_10060574 3300026095 Bacteria 2994
279 Ga0207676_10071805 3300026095 Bacteria 2780
280 Ga0207676_10603643 3300026095 Unclassified 1054
281 Ga0207674_10036859 3300026116 Bacteria 5090
282 Ga0207674_10068324 3300026116 Bacteria 3576
283 Ga0207675_100002337 3300026118 Bacteria 18795
284 Ga0207675_100139327 3300026118 Bacteria 2304
285 Ga0207683_10012581 3300026121 Bacteria 7220
286 Ga0207698_10873681 3300026142 Bacteria 905
287 Ga0209588_1015437 3300027671 Bacteria 2348
288 Ga0268265_10087112 3300028380 Unclassified 2484
289 Ga0268265_10160293 3300028380 Bacteria 1910
290 Ga0268264_10011056 3300028381 Bacteria 7454
291 Ga0268264_10044044 3300028381 Bacteria 3700
292 Ga0307408_100158939 3300031548 Bacteria 1793
293 Ga0307405_10009384 3300031731 Bacteria 5014
294 Ga0307413_10100885 3300031824 Bacteria 1907
295 Ga0307410_10481349 3300031852 Bacteria 1018
296 Ga0307406_10018133 3300031901 Unclassified 4107
297 Ga0307406_10209889 3300031901 Bacteria 1440
298 Ga0307412_10050079 3300031911 Bacteria 2755
299 Ga0307409_100209123 3300031995 Unclassified 1752
300 Ga0307416_100339261 3300032002 Bacteria 1514
301 Ga0307414_10007011 3300032004 Bacteria 6314
302 Ga0307411_10072142 3300032005 Unclassified 2344
303 Ga0307415_100022869 3300032126 Bacteria 3868
304 Ga0307415_100316629 3300032126 Bacteria 1299
305 Ga0373940_0014389 3300035088 Bacteria 1930
306 Ga0373951_0002206 3300035091 Bacteria 4952
307 Ga0373961_0031142 3300035241 Bacteria 1488
308 Ga0373931_0166323 3300035691 Bacteria 1296
309 Ga0395900_0222601 3300037418 Bacteria 1901
310 Ga0395898_0163379 3300037466 Bacteria 2130
311 Ga0395905_0004200 3300037471 Bacteria 15076
312 Ga0451577_0544681 3300042876 Unclassified 1054
313 Ga0495643_0008885 3300046522 Bacteria 6316
314 Ga0495642_0008981 3300046528 Bacteria 3824
315 Ga0495642_0019509 3300046528 Bacteria 2659
316 Ga0495598_0021967 3300046537 Bacteria 1703
317 Ga0495621_0015027 3300046539 Bacteria 2462
318 Ga0495597_0075011 3300046542 Bacteria 1452
319 Ga0495633_0136445 3300046558 Bacteria 1135
320 Ga0495668_0037314 3300046616 Bacteria 2719
321 Ga0495661_0005012 3300046665 Bacteria 9454
322 Ga0495687_009462 3300047443 Bacteria 5442
323 Ga0495687_068531 3300047443 Bacteria 1432
324 Ga0495615_0073591 3300048090 Bacteria 925
325 Ga0496100_0059230 3300048903 Bacteria 2516
326 Ga0496100_1034207 3300048903 Bacteria 647
327 Ga0496101_0220458 3300048904 Bacteria 1472
328 Ga0496102_0029604 3300048905 Bacteria 4900
329 Ga0496103_0024501 3300048906 Bacteria 3644
330 Ga0496104_0629818 3300048907 Bacteria 982
331 Ga0496105_0445174 3300048908 Bacteria 1023
332 Ga0496108_0131400 3300048911 Bacteria 2152
333 Ga0496109_0070278 3300048912 Bacteria 3212
334 Ga0496110_0139626 3300048913 Bacteria 2190
335 Ga0496110_0233888 3300048913 Bacteria 1672
336 Ga0496111_0110811 3300048914 Bacteria 2021
337 Ga0496114_0013290 3300048917 Bacteria 6600
338 Ga0496114_0308931 3300048917 Bacteria 1396
339 Ga0496125_0004893 3300048928 Bacteria 15183
340 Ga0496126_0236499 3300048929 Bacteria 1528
341 Ga0501292_004875 3300049515 Bacteria 1852
342 Ga0501292_009267 3300049515 Bacteria 1458
343 Ga0501294_010300 3300049517 Bacteria 923
344 Ga0501296_020532 3300049519 Bacteria 842
345 Ga0501298_001136 3300049521 Bacteria 3846
346 Ga0501300_009769 3300049523 Bacteria 1399
347 Ga0501038_0001729 3300049574 Bacteria 20311
348 Ga0501072_0124761 3300049588 Bacteria 2051
349 Ga0501198_001715 3300049649 Unclassified 2896
350 Ga0501198_009372 3300049649 Bacteria 1436
351 Ga0501202_064392 3300049652 Unclassified 834
352 Ga0501207_002037 3300049654 Bacteria 2586
353 Ga0501207_002999 3300049654 Unclassified 2211
354 Ga0501208_029137 3300049655 Bacteria 963
355 Ga0501216_000841 3300049660 Bacteria 3869
356 Ga0501216_016948 3300049660 Bacteria 1241
357 Ga0501217_021353 3300049661 Bacteria 1528
358 Ga0501217_076087 3300049661 Bacteria 921
359 Ga0501223_008447 3300049663 Bacteria 2099
360 Ga0501224_001003 3300049664 Unclassified 3658
361 Ga0501224_007997 3300049664 Bacteria 1541
362 Ga0501224_021860 3300049664 Bacteria 954
363 Ga0501227_010387 3300049665 Unclassified 2018
364 Ga0501227_010398 3300049665 Bacteria 2017
365 Ga0501228_003730 3300049666 Bacteria 1273
366 Ga0501228_025756 3300049666 Unclassified 693
367 Ga0501230_018054 3300049667 Bacteria 1201
368 Ga0501230_030947 3300049667 Unclassified 996
369 Ga0501235_004227 3300049669 Bacteria 3112
370 Ga0501235_006851 3300049669 Unclassified 2481
371 Ga0501235_011567 3300049669 Bacteria 1935
372 Ga0501243_005044 3300049675 Bacteria 1982
373 Ga0501243_023147 3300049675 Bacteria 1032
374 Ga0501249_018221 3300049679 Bacteria 1517
375 Ga0501249_024080 3300049679 Bacteria 1340
376 Ga0501252_015459 3300049682 Bacteria 953
377 Ga0501256_002209 3300049685 Unclassified 1527
378 Ga0501256_002757 3300049685 Bacteria 1417
379 Ga0501258_003130 3300049687 Bacteria 1498
380 Ga0501259_012259 3300049688 Unclassified 1428
381 Ga0501261_017424 3300049690 Bacteria 1005
382 Ga0501225_0004047 3300049705 Unclassified 4387
383 Ga0501225_0009079 3300049705 Bacteria 2840
384 Ga0501225_0013055 3300049705 Unclassified 2327
385 Ga0501225_0013775 3300049705 Bacteria 2261
386 Ga0501229_012887 3300049706 Bacteria 1070
387 Ga0501229_016056 3300049706 Bacteria 973
388 Ga0501234_003870 3300049707 Bacteria 2355
389 Ga0501234_006074 3300049707 Unclassified 1891
390 Ga0501234_011170 3300049707 Bacteria 1404
391 Ga0501245_007280 3300049708 Bacteria 1562
392 Ga0501266_005166 3300049763 Bacteria 1626
393 Ga0501268_004497 3300049765 Unclassified 1969
394 Ga0501268_005116 3300049765 Bacteria 1871
395 Ga0501269_015088 3300049766 Unclassified 949
396 Ga0501269_020999 3300049766 Bacteria 815
397 Ga0501270_029608 3300049767 Bacteria 895
398 Ga0501271_005991 3300049768 Bacteria 1198
399 Ga0501273_002065 3300049770 Bacteria 2011
400 Ga0501276_009588 3300049773 Unclassified 804
401 Ga0501283_003392 3300049779 Bacteria 2103
402 Ga0501204_015353 3300049850 Bacteria 950
403 nmdc:mga05p37_381744_c1 3300050507 Unclassified 1651
404 nmdc:mga09592_343156_c1 3300050508 Bacteria 1293
405 nmdc:mga09592_528689_c1 3300050508 Bacteria 1014
406 nmdc:mga0qj67_133785_c1 3300050509 Unclassified 2009
407 nmdc:mga08y16_316194_c1 3300050511 Bacteria 1608
408 nmdc:mga08y16_39284_c1 3300050511 Bacteria 4966
409 nmdc:mga08y16_532461_c1 3300050511 Bacteria 1190
410 nmdc:mga0n895_170414_c1 3300050512 Bacteria 2209
411 nmdc:mga0n895_335399_c1 3300050512 Bacteria 1532
412 nmdc:mga0n895_694008_c1 3300050512 Unclassified 1014
413 nmdc:mga0n895_964103_c1 3300050512 Bacteria 836
414 nmdc:mga08x19_3316_c3 3300050514 Unclassified 3525
415 nmdc:mga0a205_183052_c1 3300050515 Bacteria 1989
416 nmdc:mga0a205_259780_c1 3300050515 Bacteria 1614
417 nmdc:mga0a205_490144_c1 3300050515 Bacteria 1087
418 Ga0157375_10131631
419 SwRhRL2b_contig_1904902
420 MRS1b_contig_1754336
421 CNAas_1000335
422 JGI24737J22298_10049178
423 JGI24742J22300_10011758
424 rootH2_10144893
425 Ga0065704_10092815
426 Ga0065704_10309908
427 Ga0065712_10002216
428 Ga0065712_10093476
429 Ga0065715_10021285
430 Ga0065715_10091992
431 Ga0065715_10104002
432 Ga0065707_10003373
433 Ga0065707_10097403
434 Ga0070690_100109231
435 Ga0070670_100008804
436 Ga0070670_100149099
437 Ga0070670_100173231
438 Ga0070670_100299882
439 Ga0068869_100042560
440 Ga0068869_100057431
441 Ga0068869_100057757
442 Ga0068869_100326833
443 Ga0070666_10033572
444 Ga0070680_100321138
445 Ga0070682_100006339
446 Ga0068868_100115798
447 Ga0070689_100104530
448 Ga0070689_100474314
449 Ga0070687_100096679
450 Ga0070687_100283525
451 Ga0070692_10022205
452 Ga0070675_100351774
453 Ga0070671_100015022
454 Ga0070674_100013739
455 Ga0070673_100230422
456 Ga0070667_100037963
457 Ga0070703_10004100
458 Ga0070709_10068189
459 Ga0070701_10051511
460 Ga0070705_100001506
461 Ga0070705_100073144
462 Ga0070705_100167622
463 Ga0070705_100208936
464 Ga0070705_100239116
465 Ga0070700_100015586
466 Ga0070700_100033714
467 Ga0070694_100024584
468 Ga0070694_100183780
469 Ga0070694_100191310
470 Ga0070694_100293189
471 Ga0070708_100116378
472 Ga0070708_100164744
473 Ga0070708_100511591
474 Ga0070678_100053796
475 Ga0070681_10060950
476 Ga0070681_10479893
477 Ga0068867_100007607
478 Ga0070706_100038049
479 Ga0070706_100050225
480 Ga0070706_100176843
481 Ga0070706_100249396
482 Ga0070707_100024885
483 Ga0070698_100018907
484 Ga0070699_100033485
485 Ga0070699_100239876
486 Ga0070697_100000462
487 Ga0070697_100035851
488 Ga0070697_100216093
489 Ga0068853_100041121
490 Ga0068853_100308162
491 Ga0068853_101064997
492 Ga0070672_100003144
493 Ga0070686_100052511
494 Ga0070695_100018213
495 Ga0070695_100051215
496 Ga0070695_100183882
497 Ga0070695_100249669
498 Ga0070696_100047943
499 Ga0070693_100001493
500 Ga0070693_100056474
501 Ga0070693_100358888
502 Ga0070704_100068774
503 Ga0070704_100421900
504 Ga0070704_100825553
505 Ga0068855_100206952
506 Ga0068855_100221880
507 Ga0070664_100170238
508 Ga0070664_100507716
509 Ga0068854_100154659
510 Ga0070702_100015492
511 Ga0070702_100028331
512 Ga0070702_100061729
513 Ga0068852_100752078
514 Ga0068859_100042857
515 Ga0068859_100069305
516 Ga0068859_100273958
517 Ga0068859_100391250
518 Ga0068859_100467148
519 Ga0068864_100034127
520 Ga0068864_100052297
521 Ga0068864_101101206
522 Ga0068866_10007897
523 Ga0068861_100021833
524 Ga0068861_100153081
525 Ga0068851_10003965
526 Ga0068870_10021391
527 Ga0068870_10046661
528 Ga0068863_100023704
529 Ga0068858_100026001
530 Ga0068858_100036344
531 Ga0068860_100015924
532 Ga0068860_100035815
533 Ga0068860_100904458
534 Ga0068862_100150654
535 Ga0068862_100199900
536 Ga0081539_10023561
537 Ga0097621_100071889
538 Ga0097621_100128497
539 Ga0068871_100003839
540 Ga0068871_100024273
541 Ga0075428_100195732
542 Ga0075428_100314715
543 Ga0075431_100765016
544 Ga0075433_10067532
545 Ga0075433_10094309
546 Ga0075433_10456847
547 Ga0075434_100031119
548 Ga0075434_100077355
549 Ga0075434_100131296
550 Ga0075434_100358516
551 Ga0075434_100888395
552 Ga0075429_100504329
553 Ga0068865_100012741
554 Ga0075436_100329816
555 Ga0097620_100042858
556 Ga0097620_100069302
557 Ga0097620_100273986
558 Ga0097620_100391250
559 Ga0097620_100467158
560 Ga0099794_10106741
561 Ga0105251_10127800
562 Ga0105240_10059063
563 Ga0111539_10004928
564 Ga0111539_10025068
565 Ga0111539_10771117
566 Ga0105245_10099962
567 Ga0114129_10262170
568 Ga0114129_10455327
569 Ga0114129_10716491
570 Ga0105243_10003457
571 Ga0105243_10014883
572 Ga0105243_10335681
573 Ga0105243_10401951
574 Ga0105243_10853172
575 Ga0105241_10011560
576 Ga0105241_10045977
577 Ga0105241_10057461
578 Ga0105241_10099469
579 Ga0105241_10110586
580 Ga0105241_10173461
581 Ga0105241_10397410
582 Ga0105241_10403298
583 Ga0105242_10006868
584 Ga0105242_10102765
585 Ga0105242_10715459
586 Ga0105248_10023544
587 Ga0105248_10449833
588 Ga0105248_10911797
589 Ga0105237_10001358
590 Ga0105238_10015961
591 Ga0105249_10059157
592 Ga0105249_10086264
593 Ga0105249_10297067
594 Ga0105239_10034337
595 Ga0105239_10487304
596 Ga0105246_10049616
597 Ga0105246_10060228
598 Ga0105246_10332511
599 Ga0157373_10058698
600 Ga0157371_10139417
601 Ga0157374_10622484
602 Ga0157378_10030695
603 Ga0157378_10143484
604 Ga0157378_10334973
605 Ga0163162_10125181
606 Ga0163162_10218239
607 Ga0163162_10707361
608 Ga0163162_10728316
609 Ga0157372_10160250
610 Ga0157375_10478504
611 Ga0163163_10018968
612 Ga0163163_10083428
613 Ga0163163_10111958
614 Ga0163163_10309927
615 Ga0163163_10353435
616 Ga0163163_10448099
617 Ga0163163_10696821
618 Ga0163163_10790111
619 Ga0157380_10096049
620 Ga0157380_10150237
621 Ga0157377_10025215
622 Ga0157377_10121789
623 Ga0157379_10040315
624 Ga0163161_10033564
625 Ga0163161_10039790
626 Ga0207656_10006554
627 Ga0207713_1093819
628 Ga0207653_10001441
629 Ga0207642_10011802
630 Ga0207680_10067622
631 Ga0207647_10012882
632 Ga0207647_10146512
633 Ga0207643_10000775
634 Ga0207643_10010121
635 Ga0207643_10031391
636 Ga0207684_10019912
637 Ga0207684_10215704
638 Ga0207684_10505747
639 Ga0207654_10045800
640 Ga0207654_10054528
641 Ga0207654_10100429
642 Ga0207654_10106023
643 Ga0207707_10045726
644 Ga0207707_10594480
645 Ga0207695_10189906
646 Ga0207671_10002677
647 Ga0207660_10349997
648 Ga0207652_10153564
649 Ga0207646_10116642
650 Ga0207646_10630036
651 Ga0207650_10085288
652 Ga0207650_10145321
653 Ga0207650_10289680
654 Ga0207659_10788222
655 Ga0207644_10048749
656 Ga0207686_10030879
657 Ga0207686_10068700
658 Ga0207709_10003946
659 Ga0207709_10137279
660 Ga0207709_10369241
661 Ga0207709_10493674
662 Ga0207670_10001276
663 Ga0207670_10047728
664 Ga0207669_10127891
665 Ga0207704_10060375
666 Ga0207704_10949296
667 Ga0207665_10044406
668 Ga0207691_10005451
669 Ga0207711_10260291
670 Ga0207711_10689049
671 Ga0207689_10003658
672 Ga0207689_10005999
673 Ga0207689_10072951
674 Ga0207689_10140075
675 Ga0207679_10050540
676 Ga0207667_10195171
677 Ga0207651_10115897
678 Ga0207712_10161369
679 Ga0207712_10602055
680 Ga0207640_10221405
681 Ga0207658_10016563
682 Ga0207677_10074409
683 Ga0207703_10121630
684 Ga0207703_10169300
685 Ga0207708_10019347
686 Ga0207708_10026243
687 Ga0207708_10026370
688 Ga0207708_10329199
689 Ga0207641_10181197
690 Ga0207648_10003674
691 Ga0207648_10045968
692 Ga0207648_10181502
693 Ga0207648_10454993
694 Ga0207676_10011223
695 Ga0207676_10060574
696 Ga0207676_10071805
697 Ga0207676_10603643
698 Ga0207674_10036859
699 Ga0207674_10068324
700 Ga0207675_100002337
701 Ga0207675_100139327
702 Ga0207683_10012581
703 Ga0207698_10873681
704 Ga0209588_1015437
705 Ga0268265_10087112
706 Ga0268265_10160293
707 Ga0268264_10011056
708 Ga0268264_10044044
709 Ga0307408_100158939
710 Ga0307405_10009384
711 Ga0307413_10100885
712 Ga0307410_10481349
713 Ga0307406_10018133
714 Ga0307406_10209889
715 Ga0307412_10050079
716 Ga0307409_100209123
717 Ga0307416_100339261
718 Ga0307414_10007011
719 Ga0307411_10072142
720 Ga0307415_100022869
721 Ga0307415_100316629
722 Ga0373940_0014389
723 Ga0373951_0002206
724 Ga0373961_0031142
725 Ga0373931_0166323
726 Ga0395900_0222601
727 Ga0395898_0163379
728 Ga0395905_0004200
729 Ga0451577_0544681
730 Ga0495643_0008885
731 Ga0495642_0008981
732 Ga0495642_0019509
733 Ga0495598_0021967
734 Ga0495621_0015027
735 Ga0495597_0075011
736 Ga0495633_0136445
737 Ga0495668_0037314
738 Ga0495661_0005012
739 Ga0495687_009462
740 Ga0495687_068531
741 Ga0495615_0073591
742 Ga0496100_0059230
743 Ga0496100_1034207
744 Ga0496101_0220458
745 Ga0496102_0029604
746 Ga0496103_0024501
747 Ga0496104_0629818
748 Ga0496105_0445174
749 Ga0496108_0131400
750 Ga0496109_0070278
751 Ga0496110_0139626
752 Ga0496110_0233888
753 Ga0496111_0110811
754 Ga0496114_0013290
755 Ga0496114_0308931
756 Ga0496125_0004893
757 Ga0496126_0236499
758 Ga0501292_004875
759 Ga0501292_009267
760 Ga0501294_010300
761 Ga0501296_020532
762 Ga0501298_001136
763 Ga0501300_009769
764 Ga0501038_0001729
765 Ga0501072_0124761
766 Ga0501198_001715
767 Ga0501198_009372
768 Ga0501202_064392
769 Ga0501207_002037
770 Ga0501207_002999
771 Ga0501208_029137
772 Ga0501216_000841
773 Ga0501216_016948
774 Ga0501217_021353
775 Ga0501217_076087
776 Ga0501223_008447
777 Ga0501224_001003
778 Ga0501224_007997
779 Ga0501224_021860
780 Ga0501227_010387
781 Ga0501227_010398
782 Ga0501228_003730
783 Ga0501228_025756
784 Ga0501230_018054
785 Ga0501230_030947
786 Ga0501235_004227
787 Ga0501235_006851
788 Ga0501235_011567
789 Ga0501243_005044
790 Ga0501243_023147
791 Ga0501249_018221
792 Ga0501249_024080
793 Ga0501252_015459
794 Ga0501256_002209
795 Ga0501256_002757
796 Ga0501258_003130
797 Ga0501259_012259
798 Ga0501261_017424
799 Ga0501225_0004047
800 Ga0501225_0009079
801 Ga0501225_0013055
802 Ga0501225_0013775
803 Ga0501229_012887
804 Ga0501229_016056
805 Ga0501234_003870
806 Ga0501234_006074
807 Ga0501234_011170
808 Ga0501245_007280
809 Ga0501266_005166
810 Ga0501268_004497
811 Ga0501268_005116
812 Ga0501269_015088
813 Ga0501269_020999
814 Ga0501270_029608
815 Ga0501271_005991
816 Ga0501273_002065
817 Ga0501276_009588
818 Ga0501283_003392
819 Ga0501204_015353
820 nmdc:mga05p37_381744_c1
821 nmdc:mga09592_343156_c1
822 nmdc:mga09592_528689_c1
823 nmdc:mga0qj67_133785_c1
824 nmdc:mga08y16_316194_c1
825 nmdc:mga08y16_39284_c1
826 nmdc:mga08y16_532461_c1
827 nmdc:mga0n895_170414_c1
828 nmdc:mga0n895_335399_c1
829 nmdc:mga0n895_694008_c1
830 nmdc:mga0n895_964103_c1
831 nmdc:mga08x19_3316_c3
832 nmdc:mga0a205_183052_c1
833 nmdc:mga0a205_259780_c1
834 nmdc:mga0a205_490144_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

41

232

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cmy-assembly1.cif.gz_V chlorobium tepidum ferritin 0.4548 1 175
6j4j-assembly1.cif.gz_H soybean seed h-2 ferritin 0.4524 4 163
6osa-assembly1.cif.gz_R human neurotensin receptor 1 (hntsr1) - gi1 protein complex in non-canonical conformation (nc state) 0.4381 61 197
4cmy-assembly1.cif.gz_V chlorobium tepidum ferritin 0.4287 1 175
5krw-assembly1.cif.gz_A recognition and targeting mechanisms by chaperones in flagella assembly and operation 0.374 1 166
ID Description Score Start End Superfamily
af_P0C672_1_107_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5941 85 187 1.20.5.110
af_Q10NB6_155_261_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5725 81 147 1.20.5.110
af_P0C672_1_107_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5275 85 187 1.20.5.110
2qbi601 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.4571 84 165 1.10.132.20
af_Q4D7Q0_368_532_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4457 84 164 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2V8QW58-F1-model_v4 Site-2 protease family protein 0.9902 1 208 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A2V8QW58-F1-model_v4 Site-2 protease family protein 0.9808 1 208 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A7W1H782-F1-model_v4 Site-2 protease family protein 0.9748 1 207 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A7W1H782-F1-model_v4 Site-2 protease family protein 0.9656 1 207 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A7X7XDZ8-F1-model_v4 Site-2 protease family protein 0.9559 2 207 GO:0005886
GO:0006508
GO:0008237
GO:0046872

Map