F439045

General Info

Members Datasets Scaffolds Average Seq Length
417 237 834 168

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10192814|Ga0105243_101928142
Length 188
Sequence MLGSSRILAFPHPRIPASPQMSEPEVWLRGALPDIAPLLQPVAHSLLQCRLEVRATVPTLSGSELWAIPGGAASAGYHVRHAIGSLDRLFTYARGEQLSSTQLHALKGEGRSEERVGIQGSLVADFDAAVDGALAQLRATDPATLLEPREVGRARLPSTVLGLLFHAAEHTQRHVGQLVTTSKVVRGG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
205 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
208 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
209 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
215 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
216 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 3.84
Rhizosphere 93.76
Stem 0
Stem Tuber 0
Unclassified 25.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10192814 3300009148 Bacteria 1781
2 MBSR1b_contig_3707631 2162886012 Bacteria 949
3 MBSR1b_contig_8908793 2162886012 Unclassified 1052
4 Ga0065712_10005552 3300005290 Unclassified 3164
5 Ga0065715_10120561 3300005293 Unclassified 2254
6 Ga0065715_10200352 3300005293 Bacteria 1362
7 Ga0065715_10631336 3300005293 Unclassified 689
8 Ga0070658_10003287 3300005327 Bacteria 13339
9 Ga0070658_10020737 3300005327 Bacteria 5265
10 Ga0070658_10040198 3300005327 Bacteria 3773
11 Ga0070658_10064577 3300005327 Unclassified 2986
12 Ga0070658_10749538 3300005327 Unclassified 848
13 Ga0070676_10534712 3300005328 Unclassified 837
14 Ga0070683_100033311 3300005329 Bacteria 4698
15 Ga0070683_100081570 3300005329 Unclassified 3029
16 Ga0070683_100589922 3300005329 Unclassified 1063
17 Ga0070690_100020644 3300005330 Bacteria 4014
18 Ga0070690_100960885 3300005330 Bacteria 671
19 Ga0070670_100008258 3300005331 Bacteria 8866
20 Ga0070670_100228029 3300005331 Bacteria 1621
21 Ga0070677_10030236 3300005333 Bacteria 2061
22 Ga0068869_100366587 3300005334 Bacteria 1178
23 Ga0070666_10187543 3300005335 Unclassified 1452
24 Ga0070666_10228128 3300005335 Bacteria 1315
25 Ga0070666_10356939 3300005335 Unclassified 1047
26 Ga0070680_100146209 3300005336 Unclassified 1983
27 Ga0070682_100063676 3300005337 Bacteria 2339
28 Ga0070660_100018397 3300005339 Bacteria 5106
29 Ga0070660_100024868 3300005339 Bacteria 4448
30 Ga0070689_100017765 3300005340 Bacteria 5230
31 Ga0070689_100538370 3300005340 Archaea 1005
32 Ga0070661_100008981 3300005344 Bacteria 6916
33 Ga0070661_100043137 3300005344 Bacteria 3295
34 Ga0070661_100113643 3300005344 Bacteria 2023
35 Ga0070661_100551143 3300005344 Bacteria 928
36 Ga0070692_10136056 3300005345 Bacteria 1386
37 Ga0070668_100028640 3300005347 Bacteria 4227
38 Ga0070668_100104522 3300005347 Bacteria 2248
39 Ga0070669_100281043 3300005353 Bacteria 1334
40 Ga0070671_100102178 3300005355 Bacteria 2405
41 Ga0070671_100210660 3300005355 Bacteria 1648
42 Ga0070671_100555347 3300005355 Unclassified 990
43 Ga0070671_100583424 3300005355 Bacteria 965
44 Ga0070674_100179717 3300005356 Bacteria 1620
45 Ga0070673_100652313 3300005364 Bacteria 963
46 Ga0070688_100362227 3300005365 Unclassified 1064
47 Ga0070659_100029394 3300005366 Bacteria 4247
48 Ga0070659_100040110 3300005366 Bacteria 3658
49 Ga0070659_100108044 3300005366 Bacteria 2244
50 Ga0070659_100267136 3300005366 Bacteria 1420
51 Ga0070667_100198729 3300005367 Bacteria 1779
52 Ga0070700_100286376 3300005441 Unclassified 1197
53 Ga0070700_100296221 3300005441 Bacteria 1179
54 Ga0070700_101011965 3300005441 Bacteria 684
55 Ga0070663_100011074 3300005455 Bacteria 5646
56 Ga0070678_100136732 3300005456 Bacteria 1955
57 Ga0070662_100167034 3300005457 Bacteria 1725
58 Ga0070662_100185818 3300005457 Bacteria 1641
59 Ga0070662_100648046 3300005457 Bacteria 891
60 Ga0070662_101449436 3300005457 Unclassified 592
61 Ga0068867_100089319 3300005459 Bacteria 2336
62 Ga0068867_100117586 3300005459 Unclassified 2050
63 Ga0068867_100632717 3300005459 Unclassified 937
64 Ga0068867_100768255 3300005459 Bacteria 857
65 Ga0070685_10332222 3300005466 Bacteria 1034
66 Ga0070698_100067618 3300005471 Bacteria 3593
67 Ga0070679_100617593 3300005530 Unclassified 1027
68 Ga0070679_100854966 3300005530 Bacteria 853
69 Ga0070684_100002336 3300005535 Bacteria 13977
70 Ga0070684_100037815 3300005535 Bacteria 4143
71 Ga0070684_100053229 3300005535 Bacteria 3522
72 Ga0070684_100422982 3300005535 Bacteria 1230
73 Ga0068853_100022679 3300005539 Bacteria 5247
74 Ga0070672_100106360 3300005543 Unclassified 2282
75 Ga0070672_100278327 3300005543 Bacteria 1414
76 Ga0070672_100475800 3300005543 Unclassified 1078
77 Ga0070686_100000656 3300005544 Bacteria 20273
78 Ga0070686_100112183 3300005544 Bacteria 1859
79 Ga0070695_100141135 3300005545 Bacteria 1671
80 Ga0070695_100563481 3300005545 Unclassified 890
81 Ga0068855_100073440 3300005563 Bacteria 3974
82 Ga0070664_100043076 3300005564 Bacteria 3808
83 Ga0070664_100069780 3300005564 Bacteria 3007
84 Ga0070664_100103942 3300005564 Unclassified 2473
85 Ga0070664_100164746 3300005564 Bacteria 1963
86 Ga0070664_100246327 3300005564 Bacteria 1605
87 Ga0068857_100019287 3300005577 Bacteria 5987
88 Ga0068854_100055528 3300005578 Bacteria 2851
89 Ga0070702_100236085 3300005615 Bacteria 1231
90 Ga0070702_100448260 3300005615 Bacteria 936
91 Ga0068852_100253894 3300005616 Bacteria 1686
92 Ga0068852_100678368 3300005616 Bacteria 1039
93 Ga0068852_101882390 3300005616 Unclassified 620
94 Ga0068859_100008573 3300005617 Bacteria 10338
95 Ga0068859_100111342 3300005617 Bacteria 2800
96 Ga0068864_100161876 3300005618 Bacteria 2035
97 Ga0068866_10145048 3300005718 Bacteria 1368
98 Ga0068851_10400058 3300005834 Unclassified 808
99 Ga0068870_10003492 3300005840 Bacteria 6668
100 Ga0068863_100061498 3300005841 Bacteria 3551
101 Ga0068863_100530877 3300005841 Bacteria 1161
102 Ga0068858_100097989 3300005842 Bacteria 2733
103 Ga0068860_100083544 3300005843 Bacteria 3037
104 Ga0068860_101159576 3300005843 Unclassified 793
105 Ga0068860_101195595 3300005843 Unclassified 780
106 Ga0068862_100509743 3300005844 Bacteria 1143
107 Ga0068862_101068860 3300005844 Bacteria 801
108 Ga0068862_101647145 3300005844 Bacteria 649
109 Ga0081539_10000290 3300005985 Bacteria 113852
110 Ga0075364_10001498 3300006051 Bacteria 12712
111 Ga0075362_10007780 3300006177 Unclassified 4073
112 Ga0075367_10002170 3300006178 Bacteria 8842
113 Ga0075366_10009012 3300006195 Bacteria 5565
114 Ga0075366_10014936 3300006195 Bacteria 4440
115 Ga0068871_101509306 3300006358 Unclassified 635
116 Ga0075428_100028099 3300006844 Bacteria 6221
117 Ga0075428_100594520 3300006844 Bacteria 1182
118 Ga0075430_100087854 3300006846 Archaea 2602
119 Ga0075431_100663640 3300006847 Unclassified 1022
120 Ga0075431_100783971 3300006847 Bacteria 927
121 Ga0075433_10002140 3300006852 Bacteria 14955
122 Ga0075433_10009410 3300006852 Bacteria 7808
123 Ga0075434_100082120 3300006871 Bacteria 3220
124 Ga0075434_100084240 3300006871 Unclassified 3178
125 Ga0075434_100131400 3300006871 Bacteria 2523
126 Ga0075434_100878760 3300006871 Bacteria 911
127 Ga0075429_100116050 3300006880 Bacteria 2341
128 Ga0075429_100518768 3300006880 Unclassified 1044
129 Ga0075429_100883867 3300006880 Bacteria 782
130 Ga0068865_100193935 3300006881 Bacteria 1573
131 Ga0097620_100008573 3300006931 Bacteria 10338
132 Ga0097620_100111336 3300006931 Bacteria 2800
133 Ga0075435_100126377 3300007076 Unclassified 2137
134 Ga0075435_100175704 3300007076 Bacteria 1808
135 Ga0075435_100278727 3300007076 Bacteria 1427
136 Ga0111539_10002499 3300009094 Bacteria 24388
137 Ga0111539_10243712 3300009094 Unclassified 2093
138 Ga0111539_10333892 3300009094 Bacteria 1764
139 Ga0111539_10343863 3300009094 Bacteria 1736
140 Ga0111539_10902429 3300009094 Bacteria 1028
141 Ga0105245_10109116 3300009098 Unclassified 2571
142 Ga0114129_10018786 3300009147 Bacteria 9846
143 Ga0114129_10046250 3300009147 Bacteria 6117
144 Ga0105243_10159306 3300009148 Bacteria 1945
145 Ga0105241_10459942 3300009174 Bacteria 1127
146 Ga0105248_10029677 3300009177 Bacteria 6102
147 Ga0105248_10041143 3300009177 Bacteria 5180
148 Ga0105248_10067895 3300009177 Bacteria 4003
149 Ga0105248_10102044 3300009177 Bacteria 3233
150 Ga0105249_10020415 3300009553 Bacteria 5923
151 Ga0105249_10136373 3300009553 Bacteria 2349
152 Ga0105249_10610523 3300009553 Bacteria 1146
153 Ga0105249_11167239 3300009553 Bacteria 841
154 Ga0105249_11307479 3300009553 Unclassified 797
155 Ga0105239_10348265 3300010375 Bacteria 1672
156 Ga0157373_10002864 3300013100 Bacteria 13059
157 Ga0157373_10726301 3300013100 Bacteria 729
158 Ga0157373_10751968 3300013100 Bacteria 717
159 Ga0157371_10000363 3300013102 Bacteria 57446
160 Ga0157371_10351542 3300013102 Bacteria 1073
161 Ga0157370_10033013 3300013104 Bacteria 5048
162 Ga0157369_10832468 3300013105 Bacteria 948
163 Ga0163162_10340270 3300013306 Bacteria 1633
164 Ga0157372_10001249 3300013307 Bacteria 27471
165 Ga0157372_10009424 3300013307 Bacteria 10389
166 Ga0157372_10052580 3300013307 Bacteria 4536
167 Ga0157372_10220978 3300013307 Unclassified 2196
168 Ga0157372_10894096 3300013307 Unclassified 1030
169 Ga0157375_10229546 3300013308 Bacteria 2015
170 Ga0157375_10533085 3300013308 Unclassified 1337
171 Ga0163163_10018200 3300014325 Bacteria 6570
172 Ga0157380_10188239 3300014326 Bacteria 1820
173 Ga0157377_10107237 3300014745 Unclassified 1674
174 Ga0207697_10018546 3300025315 Unclassified 2853
175 Ga0207697_10188456 3300025315 Bacteria 905
176 Ga0207682_10005265 3300025893 Bacteria 5290
177 Ga0207688_10081105 3300025901 Bacteria 1853
178 Ga0207688_10577393 3300025901 Bacteria 708
179 Ga0207680_10031669 3300025903 Unclassified 2997
180 Ga0207680_10061855 3300025903 Bacteria 2285
181 Ga0207680_10099332 3300025903 Bacteria 1867
182 Ga0207647_10000082 3300025904 Bacteria 71437
183 Ga0207647_10072995 3300025904 Bacteria 2068
184 Ga0207647_10503465 3300025904 Bacteria 675
185 Ga0207645_10164247 3300025907 Bacteria 1453
186 Ga0207645_10266445 3300025907 Unclassified 1135
187 Ga0207645_10745953 3300025907 Unclassified 666
188 Ga0207643_10162830 3300025908 Unclassified 1343
189 Ga0207705_10044331 3300025909 Bacteria 3196
190 Ga0207705_10097283 3300025909 Bacteria 2161
191 Ga0207705_10355311 3300025909 Archaea 1129
192 Ga0207705_10443231 3300025909 Bacteria 1006
193 Ga0207705_10780007 3300025909 Unclassified 742
194 Ga0207654_10135042 3300025911 Bacteria 1566
195 Ga0207662_10004511 3300025918 Bacteria 7335
196 Ga0207662_10009355 3300025918 Bacteria 5388
197 Ga0207657_10020115 3300025919 Bacteria 6317
198 Ga0207657_10028419 3300025919 Bacteria 5101
199 Ga0207657_10581481 3300025919 Unclassified 874
200 Ga0207649_10035257 3300025920 Bacteria 3005
201 Ga0207649_10097822 3300025920 Bacteria 1936
202 Ga0207649_10363662 3300025920 Bacteria 1074
203 Ga0207652_10241197 3300025921 Bacteria 1629
204 Ga0207652_10670559 3300025921 Bacteria 927
205 Ga0207652_11319825 3300025921 Unclassified 624
206 Ga0207681_10088481 3300025923 Bacteria 2206
207 Ga0207681_10983367 3300025923 Bacteria 708
208 Ga0207650_10246334 3300025925 Unclassified 1445
209 Ga0207650_11106724 3300025925 Unclassified 674
210 Ga0207659_10059112 3300025926 Bacteria 2754
211 Ga0207659_10202033 3300025926 Bacteria 1588
212 Ga0207644_10085364 3300025931 Bacteria 2342
213 Ga0207644_10138700 3300025931 Bacteria 1870
214 Ga0207690_10011862 3300025932 Bacteria 5211
215 Ga0207690_10071537 3300025932 Unclassified 2392
216 Ga0207690_10256302 3300025932 Bacteria 1353
217 Ga0207690_10909084 3300025932 Unclassified 730
218 Ga0207690_10949936 3300025932 Bacteria 714
219 Ga0207706_10068016 3300025933 Bacteria 3135
220 Ga0207706_10254338 3300025933 Bacteria 1534
221 Ga0207670_10082299 3300025936 Bacteria 2255
222 Ga0207670_10410290 3300025936 Unclassified 1085
223 Ga0207669_10404726 3300025937 Bacteria 1070
224 Ga0207691_10011867 3300025940 Bacteria 8361
225 Ga0207691_10016794 3300025940 Bacteria 6946
226 Ga0207691_10022524 3300025940 Bacteria 5940
227 Ga0207691_10027330 3300025940 Bacteria 5349
228 Ga0207691_10197987 3300025940 Bacteria 1749
229 Ga0207691_10298207 3300025940 Unclassified 1385
230 Ga0207691_10530110 3300025940 Unclassified 999
231 Ga0207711_10037086 3300025941 Bacteria 4139
232 Ga0207711_10038307 3300025941 Unclassified 4076
233 Ga0207661_10018329 3300025944 Bacteria 5201
234 Ga0207661_11475481 3300025944 Viruses 623
235 Ga0207679_10161413 3300025945 Unclassified 1835
236 Ga0207679_10370611 3300025945 Bacteria 1253
237 Ga0207679_10395715 3300025945 Bacteria 1214
238 Ga0207679_10596299 3300025945 Bacteria 995
239 Ga0207651_10045723 3300025960 Bacteria 2938
240 Ga0207651_10633587 3300025960 Bacteria 937
241 Ga0207712_10423433 3300025961 Bacteria 1124
242 Ga0207712_11085270 3300025961 Unclassified 712
243 Ga0207668_10089687 3300025972 Bacteria 2255
244 Ga0207640_10239403 3300025981 Bacteria 1401
245 Ga0207640_10300851 3300025981 Bacteria 1269
246 Ga0207640_11111235 3300025981 Bacteria 700
247 Ga0207658_10068336 3300025986 Bacteria 2681
248 Ga0207658_10205885 3300025986 Bacteria 1646
249 Ga0207703_10042780 3300026035 Bacteria 3634
250 Ga0207703_10464358 3300026035 Unclassified 1184
251 Ga0207639_10496535 3300026041 Bacteria 1114
252 Ga0207678_10322311 3300026067 Unclassified 1330
253 Ga0207708_10020221 3300026075 Bacteria 5021
254 Ga0207708_10255525 3300026075 Bacteria 1413
255 Ga0207648_10005100 3300026089 Bacteria 13307
256 Ga0207648_10066763 3300026089 Bacteria 3137
257 Ga0207648_10499314 3300026089 Bacteria 1113
258 Ga0207648_10513745 3300026089 Bacteria 1097
259 Ga0207676_10040884 3300026095 Bacteria 3556
260 Ga0207676_10360265 3300026095 Bacteria 1348
261 Ga0207674_10011770 3300026116 Bacteria 9815
262 Ga0207674_10022079 3300026116 Bacteria 6842
263 Ga0207674_10530661 3300026116 Bacteria 1137
264 Ga0207675_100147722 3300026118 Unclassified 2236
265 Ga0207675_100407939 3300026118 Bacteria 1340
266 Ga0207683_10081497 3300026121 Bacteria 2872
267 Ga0207683_10875339 3300026121 Bacteria 834
268 Ga0207698_10003010 3300026142 Bacteria 10110
269 Ga0207698_10108122 3300026142 Bacteria 2324
270 Ga0207698_10673955 3300026142 Bacteria 1027
271 Ga0207698_10758760 3300026142 Bacteria 969
272 Ga0207698_11281363 3300026142 Unclassified 747
273 Ga0268265_10777261 3300028380 Unclassified 931
274 Ga0268265_10845398 3300028380 Unclassified 895
275 Ga0268264_10624139 3300028381 Bacteria 1064
276 Ga0307408_100098587 3300031548 Bacteria 2222
277 Ga0307408_100593196 3300031548 Bacteria 983
278 Ga0307405_10068291 3300031731 Bacteria 2274
279 Ga0307405_10132026 3300031731 Bacteria 1727
280 Ga0307405_10354888 3300031731 Bacteria 1132
281 Ga0307413_10007027 3300031824 Bacteria 5190
282 Ga0307413_10453630 3300031824 Unclassified 1018
283 Ga0307410_10086585 3300031852 Bacteria 2213
284 Ga0307406_10060809 3300031901 Bacteria 2437
285 Ga0307406_10169804 3300031901 Bacteria 1577
286 Ga0307407_10108169 3300031903 Bacteria 1740
287 Ga0307407_10186149 3300031903 Bacteria 1380
288 Ga0307412_11051820 3300031911 Unclassified 722
289 Ga0307409_100011225 3300031995 Bacteria 5632
290 Ga0307409_100564429 3300031995 Bacteria 1119
291 Ga0307409_100750659 3300031995 Unclassified 979
292 Ga0307416_100634997 3300032002 Bacteria 1151
293 Ga0307416_101223177 3300032002 Bacteria 857
294 Ga0307414_11441216 3300032004 Unclassified 640
295 Ga0307411_10332342 3300032005 Bacteria 1232
296 Ga0373958_0001104 3300034819 Bacteria 3562
297 Ga0373938_0028119 3300034957 Bacteria 1187
298 Ga0373928_0002015 3300035084 Bacteria 3962
299 Ga0373929_0001144 3300035085 Bacteria 5132
300 Ga0373940_0033582 3300035088 Bacteria 1380
301 Ga0373949_0029746 3300035090 Bacteria 1296
302 Ga0373952_0004217 3300035092 Bacteria 2598
303 Ga0373932_0002757 3300035112 Bacteria 4366
304 Ga0373941_0012635 3300035115 Bacteria 2212
305 Ga0373943_0117907 3300035170 Bacteria 1408
306 Ga0373942_0000934 3300035207 Bacteria 7988
307 Ga0373931_0002446 3300035691 Bacteria 8223
308 Ga0373937_0551754 3300036401 Unclassified 1095
309 Ga0395905_0615576 3300037471 Bacteria 988
310 Ga0439433_0112949 3300041999 Unclassified 681
311 Ga0439446_0298752 3300042156 Unclassified 565
312 Ga0439435_0013995 3300042436 Unclassified 1975
313 Ga0451576_1764911 3300045051 Unclassified 640
314 Ga0466967_1489493 3300045976 Bacteria 674
315 Ga0495603_0033871 3300046455 Unclassified 3073
316 Ga0495641_0021337 3300046461 Bacteria 3260
317 Ga0495639_0019935 3300046475 Unclassified 2928
318 Ga0495594_0015356 3300046499 Bacteria 4022
319 Ga0495596_0096162 3300046500 Bacteria 1150
320 Ga0495618_0009055 3300046514 Bacteria 6008
321 Ga0495628_0690060 3300046516 Unclassified 722
322 Ga0495630_0023729 3300046517 Unclassified 4534
323 Ga0495663_0055759 3300046525 Unclassified 1233
324 Ga0495666_0006027 3300046526 Bacteria 6107
325 Ga0495640_0025029 3300046533 Bacteria 4335
326 Ga0495586_0026250 3300046535 Unclassified 3116
327 Ga0495667_0302186 3300046559 Bacteria 1014
328 Ga0495667_0364078 3300046559 Unclassified 913
329 Ga0495634_0010673 3300046642 Bacteria 6724
330 Ga0495599_0613389 3300046678 Unclassified 633
331 Ga0495623_0027567 3300046679 Bacteria 3656
332 Ga0495647_0003334 3300046681 Bacteria 5146
333 Ga0495658_0041803 3300046683 Bacteria 2556
334 Ga0495669_0131033 3300046684 Bacteria 1180
335 Ga0495613_0031729 3300046689 Unclassified 3924
336 Ga0495581_0419448 3300047315 Unclassified 780
337 Ga0495680_0046608 3300047322 Unclassified 3416
338 Ga0495684_0148380 3300047471 Bacteria 1755
339 Ga0495593_0213154 3300047673 Bacteria 970
340 Ga0495615_0135073 3300048090 Bacteria 724
341 Ga0496100_0440870 3300048903 Unclassified 997
342 Ga0496101_0453131 3300048904 Unclassified 1012
343 Ga0496104_0054429 3300048907 Bacteria 3782
344 Ga0496104_0147577 3300048907 Bacteria 2259
345 Ga0496105_0120504 3300048908 Bacteria 2164
346 Ga0496106_0048051 3300048909 Bacteria 3213
347 Ga0496108_0086824 3300048911 Bacteria 2656
348 Ga0496108_0531882 3300048911 Bacteria 1026
349 Ga0496109_0577957 3300048912 Bacteria 1059
350 Ga0496110_0009761 3300048913 Bacteria 7774
351 Ga0496111_0070786 3300048914 Bacteria 2538
352 Ga0496112_0016291 3300048915 Bacteria 6959
353 Ga0496112_0178838 3300048915 Bacteria 2085
354 Ga0496112_0629872 3300048915 Bacteria 1003
355 Ga0496113_0431495 3300048916 Unclassified 1059
356 Ga0496113_0664534 3300048916 Unclassified 833
357 Ga0501303_026417 3300049526 Unclassified 652
358 Ga0501034_0001470 3300049571 Bacteria 31214
359 Ga0501046_0958980 3300049580 Bacteria 595
360 Ga0501071_0393947 3300049587 Bacteria 1057
361 Ga0501073_0395208 3300049589 Bacteria 955
362 Ga0501073_0740800 3300049589 Bacteria 678
363 Ga0501074_0229302 3300049590 Bacteria 1322
364 Ga0501202_016436 3300049652 Unclassified 1436
365 Ga0501222_012120 3300049662 Unclassified 1136
366 Ga0501223_016824 3300049663 Bacteria 1445
367 Ga0501235_000854 3300049669 Bacteria 6238
368 Ga0501242_009496 3300049674 Unclassified 1152
369 Ga0501249_003904 3300049679 Bacteria 3012
370 Ga0501250_000808 3300049680 Bacteria 2322
371 Ga0501259_013299 3300049688 Unclassified 1381
372 Ga0501221_005111 3300049704 Bacteria 2188
373 Ga0501225_0010797 3300049705 Bacteria 2580
374 Ga0501079_0241254 3300049741 Bacteria 1412
375 Ga0501079_0324282 3300049741 Bacteria 1206
376 Ga0501080_0761067 3300049742 Bacteria 851
377 Ga0501081_0060849 3300049743 Bacteria 2617
378 Ga0501081_0416015 3300049743 Bacteria 996
379 Ga0501265_005204 3300049762 Bacteria 1494
380 Ga0501268_000562 3300049765 Bacteria 4107
381 Ga0501274_008532 3300049771 Unclassified 920
382 Ga0501045_0125998 3300049824 Bacteria 1903
383 Ga0501226_028169 3300049853 Unclassified 634
384 nmdc:mga03683_16082_c1 3300050489 Unclassified 2804
385 nmdc:mga00v17_5438_c1 3300050491 Bacteria 6708
386 nmdc:mga0k408_22808_c1 3300050493 Unclassified 3527
387 nmdc:mga0k408_42375_c1 3300050493 Unclassified 2622
388 nmdc:mga06z11_19593_c1 3300050494 Unclassified 3114
389 nmdc:mga05p37_110310_c1 3300050507 Bacteria 3384
390 nmdc:mga05p37_16932_c1 3300050507 Bacteria 8789
391 nmdc:mga09592_311555_c1 3300050508 Unclassified 1364
392 nmdc:mga09592_717551_c1 3300050508 Unclassified 850
393 nmdc:mga0qj67_182004_c1 3300050509 Unclassified 1707
394 nmdc:mga0qj67_78243_c1 3300050509 Bacteria 2647
395 nmdc:mga06r32_1105401_c1 3300050510 Unclassified 742
396 nmdc:mga06r32_632579_c1 3300050510 Unclassified 1039
397 nmdc:mga06r32_871161_c1 3300050510 Bacteria 858
398 nmdc:mga08y16_19860_c1 3300050511 Bacteria 7086
399 nmdc:mga08y16_369532_c1 3300050511 Unclassified 1471
400 nmdc:mga08y16_375135_c1 3300050511 Bacteria 1459
401 nmdc:mga08y16_45244_c1 3300050511 Bacteria 4612
402 nmdc:mga0n895_46396_c1 3300050512 Unclassified 4245
403 nmdc:mga0n895_901329_c1 3300050512 Bacteria 870
404 nmdc:mga0rr50_190583_c1 3300050513 Bacteria 1680
405 nmdc:mga0rr50_504646_c1 3300050513 Bacteria 1029
406 nmdc:mga08x19_494205_c1 3300050514 Bacteria 863
407 nmdc:mga0a205_133858_c1 3300050515 Bacteria 2379
408 nmdc:mga0a205_151455_c1 3300050515 Unclassified 2219
409 nmdc:mga0a205_6299_c1 3300050515 Bacteria 10712
410 Ga0501084_0264330 3300054114 Bacteria 1453
411 Ga0590071_003038 3300059421 Bacteria 4160
412 Ga0590071_016969 3300059421 Bacteria 1709
413 Ga0590074_005560 3300059423 Bacteria 2089
414 Ga0590074_029522 3300059423 Bacteria 966
415 Ga0590075_002417 3300059424 Bacteria 4476
416 Ga0590077_029117 3300059426 Bacteria 1201
417 Ga0501082_0073509 3300060353 Bacteria 2945
418 Ga0105243_10192814
419 MBSR1b_contig_3707631
420 MBSR1b_contig_8908793
421 Ga0065712_10005552
422 Ga0065715_10120561
423 Ga0065715_10200352
424 Ga0065715_10631336
425 Ga0070658_10003287
426 Ga0070658_10020737
427 Ga0070658_10040198
428 Ga0070658_10064577
429 Ga0070658_10749538
430 Ga0070676_10534712
431 Ga0070683_100033311
432 Ga0070683_100081570
433 Ga0070683_100589922
434 Ga0070690_100020644
435 Ga0070690_100960885
436 Ga0070670_100008258
437 Ga0070670_100228029
438 Ga0070677_10030236
439 Ga0068869_100366587
440 Ga0070666_10187543
441 Ga0070666_10228128
442 Ga0070666_10356939
443 Ga0070680_100146209
444 Ga0070682_100063676
445 Ga0070660_100018397
446 Ga0070660_100024868
447 Ga0070689_100017765
448 Ga0070689_100538370
449 Ga0070661_100008981
450 Ga0070661_100043137
451 Ga0070661_100113643
452 Ga0070661_100551143
453 Ga0070692_10136056
454 Ga0070668_100028640
455 Ga0070668_100104522
456 Ga0070669_100281043
457 Ga0070671_100102178
458 Ga0070671_100210660
459 Ga0070671_100555347
460 Ga0070671_100583424
461 Ga0070674_100179717
462 Ga0070673_100652313
463 Ga0070688_100362227
464 Ga0070659_100029394
465 Ga0070659_100040110
466 Ga0070659_100108044
467 Ga0070659_100267136
468 Ga0070667_100198729
469 Ga0070700_100286376
470 Ga0070700_100296221
471 Ga0070700_101011965
472 Ga0070663_100011074
473 Ga0070678_100136732
474 Ga0070662_100167034
475 Ga0070662_100185818
476 Ga0070662_100648046
477 Ga0070662_101449436
478 Ga0068867_100089319
479 Ga0068867_100117586
480 Ga0068867_100632717
481 Ga0068867_100768255
482 Ga0070685_10332222
483 Ga0070698_100067618
484 Ga0070679_100617593
485 Ga0070679_100854966
486 Ga0070684_100002336
487 Ga0070684_100037815
488 Ga0070684_100053229
489 Ga0070684_100422982
490 Ga0068853_100022679
491 Ga0070672_100106360
492 Ga0070672_100278327
493 Ga0070672_100475800
494 Ga0070686_100000656
495 Ga0070686_100112183
496 Ga0070695_100141135
497 Ga0070695_100563481
498 Ga0068855_100073440
499 Ga0070664_100043076
500 Ga0070664_100069780
501 Ga0070664_100103942
502 Ga0070664_100164746
503 Ga0070664_100246327
504 Ga0068857_100019287
505 Ga0068854_100055528
506 Ga0070702_100236085
507 Ga0070702_100448260
508 Ga0068852_100253894
509 Ga0068852_100678368
510 Ga0068852_101882390
511 Ga0068859_100008573
512 Ga0068859_100111342
513 Ga0068864_100161876
514 Ga0068866_10145048
515 Ga0068851_10400058
516 Ga0068870_10003492
517 Ga0068863_100061498
518 Ga0068863_100530877
519 Ga0068858_100097989
520 Ga0068860_100083544
521 Ga0068860_101159576
522 Ga0068860_101195595
523 Ga0068862_100509743
524 Ga0068862_101068860
525 Ga0068862_101647145
526 Ga0081539_10000290
527 Ga0075364_10001498
528 Ga0075362_10007780
529 Ga0075367_10002170
530 Ga0075366_10009012
531 Ga0075366_10014936
532 Ga0068871_101509306
533 Ga0075428_100028099
534 Ga0075428_100594520
535 Ga0075430_100087854
536 Ga0075431_100663640
537 Ga0075431_100783971
538 Ga0075433_10002140
539 Ga0075433_10009410
540 Ga0075434_100082120
541 Ga0075434_100084240
542 Ga0075434_100131400
543 Ga0075434_100878760
544 Ga0075429_100116050
545 Ga0075429_100518768
546 Ga0075429_100883867
547 Ga0068865_100193935
548 Ga0097620_100008573
549 Ga0097620_100111336
550 Ga0075435_100126377
551 Ga0075435_100175704
552 Ga0075435_100278727
553 Ga0111539_10002499
554 Ga0111539_10243712
555 Ga0111539_10333892
556 Ga0111539_10343863
557 Ga0111539_10902429
558 Ga0105245_10109116
559 Ga0114129_10018786
560 Ga0114129_10046250
561 Ga0105243_10159306
562 Ga0105241_10459942
563 Ga0105248_10029677
564 Ga0105248_10041143
565 Ga0105248_10067895
566 Ga0105248_10102044
567 Ga0105249_10020415
568 Ga0105249_10136373
569 Ga0105249_10610523
570 Ga0105249_11167239
571 Ga0105249_11307479
572 Ga0105239_10348265
573 Ga0157373_10002864
574 Ga0157373_10726301
575 Ga0157373_10751968
576 Ga0157371_10000363
577 Ga0157371_10351542
578 Ga0157370_10033013
579 Ga0157369_10832468
580 Ga0163162_10340270
581 Ga0157372_10001249
582 Ga0157372_10009424
583 Ga0157372_10052580
584 Ga0157372_10220978
585 Ga0157372_10894096
586 Ga0157375_10229546
587 Ga0157375_10533085
588 Ga0163163_10018200
589 Ga0157380_10188239
590 Ga0157377_10107237
591 Ga0207697_10018546
592 Ga0207697_10188456
593 Ga0207682_10005265
594 Ga0207688_10081105
595 Ga0207688_10577393
596 Ga0207680_10031669
597 Ga0207680_10061855
598 Ga0207680_10099332
599 Ga0207647_10000082
600 Ga0207647_10072995
601 Ga0207647_10503465
602 Ga0207645_10164247
603 Ga0207645_10266445
604 Ga0207645_10745953
605 Ga0207643_10162830
606 Ga0207705_10044331
607 Ga0207705_10097283
608 Ga0207705_10355311
609 Ga0207705_10443231
610 Ga0207705_10780007
611 Ga0207654_10135042
612 Ga0207662_10004511
613 Ga0207662_10009355
614 Ga0207657_10020115
615 Ga0207657_10028419
616 Ga0207657_10581481
617 Ga0207649_10035257
618 Ga0207649_10097822
619 Ga0207649_10363662
620 Ga0207652_10241197
621 Ga0207652_10670559
622 Ga0207652_11319825
623 Ga0207681_10088481
624 Ga0207681_10983367
625 Ga0207650_10246334
626 Ga0207650_11106724
627 Ga0207659_10059112
628 Ga0207659_10202033
629 Ga0207644_10085364
630 Ga0207644_10138700
631 Ga0207690_10011862
632 Ga0207690_10071537
633 Ga0207690_10256302
634 Ga0207690_10909084
635 Ga0207690_10949936
636 Ga0207706_10068016
637 Ga0207706_10254338
638 Ga0207670_10082299
639 Ga0207670_10410290
640 Ga0207669_10404726
641 Ga0207691_10011867
642 Ga0207691_10016794
643 Ga0207691_10022524
644 Ga0207691_10027330
645 Ga0207691_10197987
646 Ga0207691_10298207
647 Ga0207691_10530110
648 Ga0207711_10037086
649 Ga0207711_10038307
650 Ga0207661_10018329
651 Ga0207661_11475481
652 Ga0207679_10161413
653 Ga0207679_10370611
654 Ga0207679_10395715
655 Ga0207679_10596299
656 Ga0207651_10045723
657 Ga0207651_10633587
658 Ga0207712_10423433
659 Ga0207712_11085270
660 Ga0207668_10089687
661 Ga0207640_10239403
662 Ga0207640_10300851
663 Ga0207640_11111235
664 Ga0207658_10068336
665 Ga0207658_10205885
666 Ga0207703_10042780
667 Ga0207703_10464358
668 Ga0207639_10496535
669 Ga0207678_10322311
670 Ga0207708_10020221
671 Ga0207708_10255525
672 Ga0207648_10005100
673 Ga0207648_10066763
674 Ga0207648_10499314
675 Ga0207648_10513745
676 Ga0207676_10040884
677 Ga0207676_10360265
678 Ga0207674_10011770
679 Ga0207674_10022079
680 Ga0207674_10530661
681 Ga0207675_100147722
682 Ga0207675_100407939
683 Ga0207683_10081497
684 Ga0207683_10875339
685 Ga0207698_10003010
686 Ga0207698_10108122
687 Ga0207698_10673955
688 Ga0207698_10758760
689 Ga0207698_11281363
690 Ga0268265_10777261
691 Ga0268265_10845398
692 Ga0268264_10624139
693 Ga0307408_100098587
694 Ga0307408_100593196
695 Ga0307405_10068291
696 Ga0307405_10132026
697 Ga0307405_10354888
698 Ga0307413_10007027
699 Ga0307413_10453630
700 Ga0307410_10086585
701 Ga0307406_10060809
702 Ga0307406_10169804
703 Ga0307407_10108169
704 Ga0307407_10186149
705 Ga0307412_11051820
706 Ga0307409_100011225
707 Ga0307409_100564429
708 Ga0307409_100750659
709 Ga0307416_100634997
710 Ga0307416_101223177
711 Ga0307414_11441216
712 Ga0307411_10332342
713 Ga0373958_0001104
714 Ga0373938_0028119
715 Ga0373928_0002015
716 Ga0373929_0001144
717 Ga0373940_0033582
718 Ga0373949_0029746
719 Ga0373952_0004217
720 Ga0373932_0002757
721 Ga0373941_0012635
722 Ga0373943_0117907
723 Ga0373942_0000934
724 Ga0373931_0002446
725 Ga0373937_0551754
726 Ga0395905_0615576
727 Ga0439433_0112949
728 Ga0439446_0298752
729 Ga0439435_0013995
730 Ga0451576_1764911
731 Ga0466967_1489493
732 Ga0495603_0033871
733 Ga0495641_0021337
734 Ga0495639_0019935
735 Ga0495594_0015356
736 Ga0495596_0096162
737 Ga0495618_0009055
738 Ga0495628_0690060
739 Ga0495630_0023729
740 Ga0495663_0055759
741 Ga0495666_0006027
742 Ga0495640_0025029
743 Ga0495586_0026250
744 Ga0495667_0302186
745 Ga0495667_0364078
746 Ga0495634_0010673
747 Ga0495599_0613389
748 Ga0495623_0027567
749 Ga0495647_0003334
750 Ga0495658_0041803
751 Ga0495669_0131033
752 Ga0495613_0031729
753 Ga0495581_0419448
754 Ga0495680_0046608
755 Ga0495684_0148380
756 Ga0495593_0213154
757 Ga0495615_0135073
758 Ga0496100_0440870
759 Ga0496101_0453131
760 Ga0496104_0054429
761 Ga0496104_0147577
762 Ga0496105_0120504
763 Ga0496106_0048051
764 Ga0496108_0086824
765 Ga0496108_0531882
766 Ga0496109_0577957
767 Ga0496110_0009761
768 Ga0496111_0070786
769 Ga0496112_0016291
770 Ga0496112_0178838
771 Ga0496112_0629872
772 Ga0496113_0431495
773 Ga0496113_0664534
774 Ga0501303_026417
775 Ga0501034_0001470
776 Ga0501046_0958980
777 Ga0501071_0393947
778 Ga0501073_0395208
779 Ga0501073_0740800
780 Ga0501074_0229302
781 Ga0501202_016436
782 Ga0501222_012120
783 Ga0501223_016824
784 Ga0501235_000854
785 Ga0501242_009496
786 Ga0501249_003904
787 Ga0501250_000808
788 Ga0501259_013299
789 Ga0501221_005111
790 Ga0501225_0010797
791 Ga0501079_0241254
792 Ga0501079_0324282
793 Ga0501080_0761067
794 Ga0501081_0060849
795 Ga0501081_0416015
796 Ga0501265_005204
797 Ga0501268_000562
798 Ga0501274_008532
799 Ga0501045_0125998
800 Ga0501226_028169
801 nmdc:mga03683_16082_c1
802 nmdc:mga00v17_5438_c1
803 nmdc:mga0k408_22808_c1
804 nmdc:mga0k408_42375_c1
805 nmdc:mga06z11_19593_c1
806 nmdc:mga05p37_110310_c1
807 nmdc:mga05p37_16932_c1
808 nmdc:mga09592_311555_c1
809 nmdc:mga09592_717551_c1
810 nmdc:mga0qj67_182004_c1
811 nmdc:mga0qj67_78243_c1
812 nmdc:mga06r32_1105401_c1
813 nmdc:mga06r32_632579_c1
814 nmdc:mga06r32_871161_c1
815 nmdc:mga08y16_19860_c1
816 nmdc:mga08y16_369532_c1
817 nmdc:mga08y16_375135_c1
818 nmdc:mga08y16_45244_c1
819 nmdc:mga0n895_46396_c1
820 nmdc:mga0n895_901329_c1
821 nmdc:mga0rr50_190583_c1
822 nmdc:mga0rr50_504646_c1
823 nmdc:mga08x19_494205_c1
824 nmdc:mga0a205_133858_c1
825 nmdc:mga0a205_151455_c1
826 nmdc:mga0a205_6299_c1
827 Ga0501084_0264330
828 Ga0590071_003038
829 Ga0590071_016969
830 Ga0590074_005560
831 Ga0590074_029522
832 Ga0590075_002417
833 Ga0590077_029117
834 Ga0501082_0073509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

45

178

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.8274 13 166
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.82 16 170
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8079 22 160
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.7854 16 170
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7844 22 165
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8079 22 160 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8051 17 167 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7894 17 167 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7665 22 160 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7611 19 165 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A4Q5QU83-F1-model_v4 DinB family protein 0.9857 50 168
AF-A0A271JE96-F1-model_v4 Metal-dependent hydrolase 0.9846 4 165 GO:0016787
AF-A0A5D6V4F6-F1-model_v4 DinB family protein 0.9827 1 165
AF-A0A1N6FVR1-F1-model_v4 DinB family protein 0.9819 4 166
AF-A0A6B9ZIJ5-F1-model_v4 DinB family protein 0.9807 3 167

Map