F439015

General Info

Members Datasets Scaffolds Average Seq Length
417 216 834 178

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10315225|Ga0075364_103152252
Length 200
Sequence MAETGTLHDAFIDELRDSYDAERQLLKALPKLAKAATSPALRDAFESHLEETRGHVERLESVFEGLGEKVRGKHCDGIAGIIEEGKSVMEEEFDDTTMDACLIASGQRAEHYEMAAYGTLVAWARAMGHTEAADLLQETLDEEKAADEKLTALAEGGINQEAADIAHPDAAEDEDAVAEKTRKPAPKPMVKAAGKASSRR

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
186 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
191 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 10.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 4.56
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 17.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10315225 3300006051 Unclassified 1065
2 JGI24035J26624_1022611 3300002126 Unclassified 668
3 Ga0006778J45830_1035628 3300003162 Unclassified 709
4 Ga0032354_1009842 3300003693 Unclassified 849
5 Ga0032354_1010827 3300003693 Bacteria 835
6 Ga0058859_11320943 3300004798 Bacteria 688
7 Ga0058861_11318594 3300004800 Bacteria 780
8 Ga0058861_11964432 3300004800 Bacteria 981
9 Ga0058861_11973428 3300004800 Bacteria 687
10 Ga0058861_11995975 3300004800 Bacteria 906
11 Ga0058860_12228347 3300004801 Unclassified 872
12 Ga0058862_12711399 3300004803 Bacteria 795
13 Ga0065704_10528778 3300005289 Bacteria 648
14 Ga0065712_10034105 3300005290 Unclassified 1090
15 Ga0065712_10135395 3300005290 Bacteria 1503
16 Ga0065712_10318635 3300005290 Bacteria 831
17 Ga0065715_10105631 3300005293 Bacteria 2868
18 Ga0065715_10169223 3300005293 Bacteria 1561
19 Ga0065715_10245422 3300005293 Bacteria 1185
20 Ga0065707_10179716 3300005295 Bacteria 1426
21 Ga0065707_10415082 3300005295 Unclassified 836
22 Ga0070658_10117207 3300005327 Unclassified 2211
23 Ga0070676_10007841 3300005328 Bacteria 5740
24 Ga0070676_10244970 3300005328 Bacteria 1194
25 Ga0070676_10546995 3300005328 Unclassified 828
26 Ga0070690_100611252 3300005330 Bacteria 828
27 Ga0070677_10007014 3300005333 Bacteria 3748
28 Ga0070677_10111351 3300005333 Bacteria 1223
29 Ga0068869_100258196 3300005334 Bacteria 1394
30 Ga0070666_10046503 3300005335 Bacteria 2911
31 Ga0070666_10343143 3300005335 Bacteria 1067
32 Ga0070680_100057310 3300005336 Bacteria 3185
33 Ga0068868_100007113 3300005338 Bacteria 7956
34 Ga0070660_100933622 3300005339 Bacteria 732
35 Ga0070689_100089372 3300005340 Unclassified 2426
36 Ga0070689_100175934 3300005340 Bacteria 1736
37 Ga0070687_100132823 3300005343 Bacteria 1439
38 Ga0070687_100453105 3300005343 Bacteria 854
39 Ga0070661_100034806 3300005344 Unclassified 3655
40 Ga0070692_10271993 3300005345 Bacteria 1023
41 Ga0070668_100063837 3300005347 Unclassified 2855
42 Ga0070669_100054188 3300005353 Bacteria 2937
43 Ga0070669_100408996 3300005353 Unclassified 1112
44 Ga0070675_100009871 3300005354 Bacteria 7441
45 Ga0070675_100365517 3300005354 Bacteria 1282
46 Ga0070675_100462693 3300005354 Bacteria 1139
47 Ga0070674_100114149 3300005356 Bacteria 1989
48 Ga0070674_100863244 3300005356 Bacteria 786
49 Ga0070673_100024603 3300005364 Bacteria 4419
50 Ga0070673_100294925 3300005364 Bacteria 1426
51 Ga0070673_100405988 3300005364 Bacteria 1219
52 Ga0070688_100018415 3300005365 Bacteria 4030
53 Ga0070688_100142990 3300005365 Bacteria 1627
54 Ga0070659_100036576 3300005366 Bacteria 3828
55 Ga0070659_100230921 3300005366 Bacteria 1529
56 Ga0070659_100505166 3300005366 Unclassified 1031
57 Ga0070667_100046053 3300005367 Bacteria 3668
58 Ga0070713_100018550 3300005436 Bacteria 5288
59 Ga0070701_10117112 3300005438 Bacteria 1496
60 Ga0070711_100575117 3300005439 Bacteria 937
61 Ga0070700_100007730 3300005441 Bacteria 5822
62 Ga0070700_100102122 3300005441 Bacteria 1891
63 Ga0070663_100236775 3300005455 Bacteria 1440
64 Ga0070663_100563906 3300005455 Bacteria 953
65 Ga0070678_100031345 3300005456 Bacteria 3666
66 Ga0070662_101118374 3300005457 Bacteria 676
67 Ga0070681_10124105 3300005458 Bacteria 2515
68 Ga0070681_10298538 3300005458 Bacteria 1521
69 Ga0068867_100102800 3300005459 Bacteria 2185
70 Ga0070685_10520437 3300005466 Archaea 845
71 Ga0070679_100138241 3300005530 Unclassified 2417
72 Ga0070684_100616853 3300005535 Bacteria 1009
73 Ga0068853_100324147 3300005539 Bacteria 1428
74 Ga0070672_100038551 3300005543 Bacteria 3652
75 Ga0070672_100194075 3300005543 Bacteria 1696
76 Ga0070672_100348340 3300005543 Bacteria 1262
77 Ga0070686_100480978 3300005544 Unclassified 960
78 Ga0070696_100300082 3300005546 Bacteria 1230
79 Ga0070693_100036363 3300005547 Bacteria 2737
80 Ga0070665_100299921 3300005548 Bacteria 1610
81 Ga0070665_100927828 3300005548 Bacteria 883
82 Ga0070665_101053562 3300005548 Bacteria 825
83 Ga0070704_100192675 3300005549 Bacteria 1640
84 Ga0068855_100003468 3300005563 Bacteria 19304
85 Ga0070664_100022639 3300005564 Bacteria 5182
86 Ga0070664_100099378 3300005564 Unclassified 2529
87 Ga0070664_100339767 3300005564 Bacteria 1364
88 Ga0070702_100816914 3300005615 Bacteria 722
89 Ga0068852_100062271 3300005616 Bacteria 3245
90 Ga0068852_100124657 3300005616 Bacteria 2363
91 Ga0068852_100296106 3300005616 Bacteria 1565
92 Ga0068859_100044809 3300005617 Bacteria 4445
93 Ga0068859_100066462 3300005617 Bacteria 3640
94 Ga0068859_100179913 3300005617 Unclassified 2197
95 Ga0068859_100694074 3300005617 Bacteria 1109
96 Ga0068864_100000913 3300005618 Bacteria 24793
97 Ga0068864_100085846 3300005618 Bacteria 2768
98 Ga0068864_100152222 3300005618 Bacteria 2096
99 Ga0068861_100030117 3300005719 Bacteria 3975
100 Ga0068851_10282533 3300005834 Bacteria 949
101 Ga0068870_10280720 3300005840 Unclassified 1044
102 Ga0068870_10528837 3300005840 Unclassified 791
103 Ga0068870_10726670 3300005840 Unclassified 687
104 Ga0068863_100043536 3300005841 Bacteria 4261
105 Ga0068863_100085812 3300005841 Bacteria 2982
106 Ga0068863_100180043 3300005841 Bacteria 2029
107 Ga0068863_100530606 3300005841 Bacteria 1161
108 Ga0068858_100027469 3300005842 Bacteria 5286
109 Ga0068858_100069739 3300005842 Unclassified 3258
110 Ga0068858_100186013 3300005842 Bacteria 1962
111 Ga0068858_100308948 3300005842 Bacteria 1509
112 Ga0068858_100326942 3300005842 Bacteria 1466
113 Ga0068860_100249837 3300005843 Unclassified 1727
114 Ga0068860_100890652 3300005843 Unclassified 906
115 Ga0068862_100062580 3300005844 Bacteria 3200
116 Ga0068862_100076276 3300005844 Bacteria 2901
117 Ga0081538_10089200 3300005981 Bacteria 1602
118 Ga0075367_10048942 3300006178 Bacteria 2491
119 Ga0097621_100029352 3300006237 Bacteria 4342
120 Ga0097621_100395689 3300006237 Unclassified 1236
121 Ga0097621_100530772 3300006237 Bacteria 1069
122 Ga0075370_10614431 3300006353 Unclassified 659
123 Ga0068871_100013076 3300006358 Bacteria 6153
124 Ga0068871_100116045 3300006358 Bacteria 2257
125 Ga0068871_100305924 3300006358 Bacteria 1396
126 Ga0068871_100927002 3300006358 Unclassified 808
127 Ga0075428_100019136 3300006844 Bacteria 7573
128 Ga0075428_100077862 3300006844 Bacteria 3619
129 Ga0075428_100309027 3300006844 Bacteria 1699
130 Ga0075428_100501606 3300006844 Bacteria 1298
131 Ga0075430_100164820 3300006846 Bacteria 1844
132 Ga0075430_100182121 3300006846 Bacteria 1747
133 Ga0075430_100288561 3300006846 Bacteria 1357
134 Ga0075431_100011429 3300006847 Bacteria 8947
135 Ga0075431_100011472 3300006847 Bacteria 8930
136 Ga0075433_10014543 3300006852 Bacteria 6434
137 Ga0075434_100012375 3300006871 Bacteria 8085
138 Ga0075434_100187346 3300006871 Bacteria 2090
139 Ga0075434_100429561 3300006871 Bacteria 1342
140 Ga0075429_100002274 3300006880 Bacteria 16103
141 Ga0075429_100013737 3300006880 Bacteria 7021
142 Ga0075429_100032901 3300006880 Bacteria 4506
143 Ga0075429_100046599 3300006880 Bacteria 3772
144 Ga0075429_100054983 3300006880 Bacteria 3463
145 Ga0075429_100091531 3300006880 Bacteria 2653
146 Ga0075429_100347744 3300006880 Unclassified 1298
147 Ga0068865_100390307 3300006881 Bacteria 1138
148 Ga0097620_100044807 3300006931 Bacteria 4445
149 Ga0097620_100066462 3300006931 Bacteria 3640
150 Ga0097620_100179912 3300006931 Unclassified 2197
151 Ga0097620_100694077 3300006931 Bacteria 1109
152 Ga0075435_100000605 3300007076 Bacteria 21982
153 Ga0075435_100009561 3300007076 Bacteria 7031
154 Ga0075435_100059412 3300007076 Unclassified 3099
155 Ga0105240_10030785 3300009093 Bacteria 6971
156 Ga0111539_10000204 3300009094 Bacteria 70002
157 Ga0111539_10000592 3300009094 Bacteria 46779
158 Ga0111539_10004849 3300009094 Bacteria 17531
159 Ga0111539_10020505 3300009094 Bacteria 8141
160 Ga0111539_10055549 3300009094 Bacteria 4707
161 Ga0111539_10071864 3300009094 Bacteria 4082
162 Ga0111539_10083620 3300009094 Bacteria 3753
163 Ga0105245_10581478 3300009098 Bacteria 1144
164 Ga0105247_10028002 3300009101 Unclassified 3408
165 Ga0105247_10065134 3300009101 Unclassified 2266
166 Ga0114129_10000102 3300009147 Bacteria 84059
167 Ga0114129_10005481 3300009147 Bacteria 17934
168 Ga0114129_10008210 3300009147 Bacteria 14884
169 Ga0114129_10371861 3300009147 Bacteria 1889
170 Ga0114129_10752322 3300009147 Bacteria 1247
171 Ga0114129_10757220 3300009147 Bacteria 1243
172 Ga0105241_10732518 3300009174 Unclassified 905
173 Ga0105241_11222900 3300009174 Unclassified 712
174 Ga0105242_10237551 3300009176 Unclassified 1637
175 Ga0105248_10014368 3300009177 Bacteria 8713
176 Ga0105248_10017806 3300009177 Bacteria 7839
177 Ga0105248_10051754 3300009177 Bacteria 4608
178 Ga0105248_10174019 3300009177 Bacteria 2427
179 Ga0105248_10248460 3300009177 Bacteria 2002
180 Ga0105248_10263715 3300009177 Bacteria 1939
181 Ga0105248_11102395 3300009177 Bacteria 897
182 Ga0105238_10004715 3300009551 Bacteria 13479
183 Ga0105238_10276923 3300009551 Bacteria 1659
184 Ga0105238_10466138 3300009551 Bacteria 1261
185 Ga0105249_10059998 3300009553 Bacteria 3490
186 Ga0105249_10157748 3300009553 Bacteria 2190
187 Ga0105249_11185450 3300009553 Bacteria 835
188 Ga0105246_10193923 3300011119 Bacteria 1574
189 Ga0163162_10058643 3300013306 Bacteria 3879
190 Ga0157375_10125645 3300013308 Bacteria 2679
191 Ga0157375_10263179 3300013308 Unclassified 1886
192 Ga0157375_10905576 3300013308 Unclassified 1026
193 Ga0157375_10914832 3300013308 Unclassified 1021
194 Ga0157375_11582873 3300013308 Unclassified 774
195 Ga0163163_10023375 3300014325 Bacteria 5865
196 Ga0163163_10255799 3300014325 Unclassified 1802
197 Ga0163163_10921199 3300014325 Unclassified 937
198 Ga0163163_10998525 3300014325 Bacteria 900
199 Ga0157380_10954708 3300014326 Unclassified 887
200 Ga0157380_11290983 3300014326 Unclassified 777
201 Ga0157377_10023013 3300014745 Bacteria 3297
202 Ga0157379_10001547 3300014968 Bacteria 18911
203 Ga0157379_10048852 3300014968 Unclassified 3777
204 Ga0157379_10208283 3300014968 Bacteria 1769
205 Ga0157376_10038547 3300014969 Bacteria 3889
206 Ga0157376_10277361 3300014969 Bacteria 1577
207 Ga0157376_10653436 3300014969 Unclassified 1052
208 Ga0163161_10030871 3300017792 Bacteria 3816
209 Ga0197907_10647797 3300020069 Bacteria 877
210 Ga0197907_11477661 3300020069 Bacteria 765
211 Ga0206356_10658333 3300020070 Unclassified 752
212 Ga0206356_10848423 3300020070 Bacteria 839
213 Ga0206356_11686120 3300020070 Bacteria 864
214 Ga0206352_10781261 3300020078 Bacteria 917
215 Ga0206352_10841171 3300020078 Bacteria 1386
216 Ga0206350_10197865 3300020080 Bacteria 962
217 Ga0206350_10377174 3300020080 Bacteria 833
218 Ga0206350_11088002 3300020080 Bacteria 704
219 Ga0206350_11096057 3300020080 Bacteria 1379
220 Ga0206350_11427370 3300020080 Bacteria 969
221 Ga0206354_11033763 3300020081 Bacteria 755
222 Ga0154015_1202315 3300020610 Bacteria 866
223 Ga0224712_10103146 3300022467 Bacteria 1213
224 Ga0224712_10193295 3300022467 Bacteria 922
225 Ga0224712_10243082 3300022467 Bacteria 829
226 Ga0224712_10279927 3300022467 Bacteria 776
227 Ga0207697_10000380 3300025315 Bacteria 24920
228 Ga0207682_10001437 3300025893 Bacteria 10992
229 Ga0207688_10005082 3300025901 Bacteria 7154
230 Ga0207688_10059789 3300025901 Bacteria 2146
231 Ga0207680_10366290 3300025903 Bacteria 1014
232 Ga0207680_10372032 3300025903 Unclassified 1006
233 Ga0207645_10031433 3300025907 Bacteria 3415
234 Ga0207643_10002289 3300025908 Bacteria 10423
235 Ga0207643_10256865 3300025908 Unclassified 1078
236 Ga0207707_10265009 3300025912 Bacteria 1490
237 Ga0207707_10414410 3300025912 Bacteria 1156
238 Ga0207695_10157938 3300025913 Bacteria 2201
239 Ga0207695_10368020 3300025913 Bacteria 1324
240 Ga0207660_10070871 3300025917 Bacteria 2535
241 Ga0207660_10930943 3300025917 Bacteria 709
242 Ga0207662_10154377 3300025918 Bacteria 1462
243 Ga0207657_10009026 3300025919 Bacteria 10067
244 Ga0207652_10197300 3300025921 Bacteria 1811
245 Ga0207652_10668104 3300025921 Bacteria 928
246 Ga0207681_10030624 3300025923 Unclassified 3509
247 Ga0207694_10191687 3300025924 Bacteria 1661
248 Ga0207694_10193496 3300025924 Bacteria 1653
249 Ga0207659_10018067 3300025926 Bacteria 4616
250 Ga0207659_10060114 3300025926 Bacteria 2734
251 Ga0207659_10390274 3300025926 Bacteria 1162
252 Ga0207659_10406975 3300025926 Bacteria 1139
253 Ga0207687_10482977 3300025927 Bacteria 1032
254 Ga0207700_10030623 3300025928 Bacteria 3813
255 Ga0207690_10034994 3300025932 Bacteria 3239
256 Ga0207690_10361817 3300025932 Bacteria 1149
257 Ga0207706_10001124 3300025933 Bacteria 27217
258 Ga0207670_10025395 3300025936 Bacteria 3718
259 Ga0207670_10146016 3300025936 Bacteria 1749
260 Ga0207670_10156305 3300025936 Bacteria 1698
261 Ga0207704_10310393 3300025938 Bacteria 1212
262 Ga0207691_10002188 3300025940 Bacteria 19113
263 Ga0207691_10169363 3300025940 Bacteria 1913
264 Ga0207711_10024298 3300025941 Bacteria 5075
265 Ga0207711_10091569 3300025941 Bacteria 2675
266 Ga0207711_10383296 3300025941 Unclassified 1305
267 Ga0207711_10690330 3300025941 Unclassified 952
268 Ga0207711_10969222 3300025941 Bacteria 789
269 Ga0207711_11022376 3300025941 Bacteria 766
270 Ga0207689_10440779 3300025942 Unclassified 1088
271 Ga0207689_10639621 3300025942 Bacteria 896
272 Ga0207661_10232008 3300025944 Unclassified 1635
273 Ga0207679_10030382 3300025945 Bacteria 3772
274 Ga0207651_10010753 3300025960 Bacteria 5086
275 Ga0207651_10421931 3300025960 Unclassified 1139
276 Ga0207712_11148990 3300025961 Unclassified 692
277 Ga0207668_10128395 3300025972 Bacteria 1932
278 Ga0207668_11569911 3300025972 Unclassified 594
279 Ga0207640_10028317 3300025981 Bacteria 3425
280 Ga0207658_10263140 3300025986 Bacteria 1471
281 Ga0207658_10652691 3300025986 Unclassified 948
282 Ga0207677_10103345 3300026023 Bacteria 2103
283 Ga0207677_10246614 3300026023 Bacteria 1448
284 Ga0207703_10008094 3300026035 Bacteria 8309
285 Ga0207703_10050141 3300026035 Unclassified 3377
286 Ga0207703_10137100 3300026035 Bacteria 2119
287 Ga0207703_11246403 3300026035 Bacteria 715
288 Ga0207678_10105780 3300026067 Bacteria 2401
289 Ga0207678_10870497 3300026067 Bacteria 796
290 Ga0207708_10010149 3300026075 Bacteria 6992
291 Ga0207708_10211440 3300026075 Unclassified 1551
292 Ga0207641_10012884 3300026088 Bacteria 6859
293 Ga0207641_10142114 3300026088 Bacteria 2167
294 Ga0207641_10203937 3300026088 Bacteria 1825
295 Ga0207641_10843680 3300026088 Bacteria 908
296 Ga0207641_10893104 3300026088 Bacteria 882
297 Ga0207648_10042969 3300026089 Bacteria 3969
298 Ga0207676_10058940 3300026095 Unclassified 3030
299 Ga0207676_10221510 3300026095 Bacteria 1685
300 Ga0207676_11372347 3300026095 Bacteria 702
301 Ga0207674_10461449 3300026116 Bacteria 1228
302 Ga0207675_100006069 3300026118 Bacteria 11496
303 Ga0207683_10005941 3300026121 Bacteria 10464
304 Ga0207683_10170204 3300026121 Bacteria 1972
305 Ga0207683_10596058 3300026121 Bacteria 1023
306 Ga0207698_10249018 3300026142 Unclassified 1624
307 Ga0207698_10276872 3300026142 Bacteria 1550
308 Ga0207698_10414308 3300026142 Unclassified 1291
309 Ga0207698_10448909 3300026142 Bacteria 1244
310 Ga0209813_10009296 3300027866 Bacteria 2510
311 Ga0209974_10155886 3300027876 Bacteria 826
312 Ga0207428_10008973 3300027907 Bacteria 9007
313 Ga0207428_10017662 3300027907 Bacteria 6117
314 Ga0207428_10065641 3300027907 Bacteria 2862
315 Ga0207428_10202378 3300027907 Bacteria 1494
316 Ga0268266_10124106 3300028379 Bacteria 2302
317 Ga0268266_10277536 3300028379 Bacteria 1557
318 Ga0268264_10183046 3300028381 Unclassified 1904
319 Ga0268264_10422470 3300028381 Bacteria 1286
320 Ga0307408_100008092 3300031548 Bacteria 6949
321 Ga0307408_100047756 3300031548 Bacteria 3067
322 Ga0307405_10283433 3300031731 Bacteria 1248
323 Ga0307407_10481965 3300031903 Bacteria 906
324 Ga0307412_10093023 3300031911 Bacteria 2114
325 Ga0307412_10315352 3300031911 Bacteria 1242
326 Ga0307409_100171732 3300031995 Bacteria 1909
327 Ga0307416_100033895 3300032002 Bacteria 3878
328 Ga0307416_100122291 3300032002 Bacteria 2323
329 Ga0307416_100173418 3300032002 Bacteria 2011
330 Ga0307411_10207299 3300032005 Bacteria 1510
331 Ga0373952_0035722 3300035092 Unclassified 1126
332 Ga0373932_0018137 3300035112 Bacteria 1816
333 Ga0373939_0011096 3300035114 Bacteria 2266
334 Ga0373962_0047040 3300035242 Unclassified 1233
335 Ga0436365_1800408 3300039437 Bacteria 15472
336 Ga0439463_087499 3300042016 Bacteria 802
337 Ga0439435_0014180 3300042436 Bacteria 1966
338 Ga0439444_0018082 3300042437 Bacteria 1217
339 Ga0439464_0019222 3300042439 Bacteria 1864
340 Ga0439440_0015082 3300042993 Bacteria 1676
341 Ga0439440_0068705 3300042993 Bacteria 918
342 Ga0451576_0143218 3300045051 Bacteria 2492
343 Ga0495659_0329947 3300046664 Unclassified 649
344 Ga0495658_0389933 3300046683 Unclassified 887
345 Ga0496100_0008178 3300048903 Bacteria 5824
346 Ga0496101_0000225 3300048904 Bacteria 42158
347 Ga0496102_0644406 3300048905 Bacteria 983
348 Ga0496104_0049351 3300048907 Bacteria 3969
349 Ga0496104_0555592 3300048907 Bacteria 1059
350 Ga0496104_0636719 3300048907 Bacteria 975
351 Ga0496105_0100714 3300048908 Bacteria 2385
352 Ga0496106_0053865 3300048909 Bacteria 3039
353 Ga0496106_0548452 3300048909 Bacteria 928
354 Ga0496107_0083034 3300048910 Bacteria 2336
355 Ga0496107_0601944 3300048910 Bacteria 812
356 Ga0496109_0774327 3300048912 Unclassified 898
357 Ga0496110_0597748 3300048913 Bacteria 1001
358 Ga0496112_0003348 3300048915 Bacteria 13221
359 Ga0496112_0221382 3300048915 Bacteria 1848
360 Ga0496112_0415013 3300048915 Bacteria 1285
361 Ga0496114_0000508 3300048917 Bacteria 28503
362 Ga0496114_0516393 3300048917 Bacteria 1056
363 Ga0496115_0146808 3300048918 Bacteria 1947
364 Ga0501292_016731 3300049515 Bacteria 1156
365 Ga0501299_004830 3300049522 Bacteria 2040
366 Ga0501071_0843645 3300049587 Bacteria 707
367 Ga0501073_0582511 3300049589 Unclassified 773
368 Ga0501074_0686762 3300049590 Bacteria 723
369 Ga0501216_045248 3300049660 Bacteria 852
370 Ga0501228_005279 3300049666 Bacteria 1141
371 nmdc:mga00v17_99065_c2 3300050491 Unclassified 944
372 nmdc:mga06z11_507712_c1 3300050494 Unclassified 731
373 nmdc:mga04h51_121699_c1 3300050495 Unclassified 972
374 nmdc:mga05p37_115676_c1 3300050507 Bacteria 3296
375 nmdc:mga05p37_452657_c1 3300050507 Bacteria 1485
376 nmdc:mga05p37_46642_c1 3300050507 Bacteria 5328
377 nmdc:mga05p37_99627_c1 3300050507 Bacteria 3579
378 nmdc:mga09592_13555_c1 3300050508 Bacteria 6658
379 nmdc:mga09592_20093_c1 3300050508 Bacteria 5488
380 nmdc:mga09592_292663_c1 3300050508 Bacteria 1412
381 nmdc:mga09592_29462_c1 3300050508 Bacteria 3956
382 nmdc:mga09592_388867_c1 3300050508 Bacteria 1206
383 nmdc:mga0qj67_66379_c1 3300050509 Bacteria 2874
384 nmdc:mga0qj67_80182_c1 3300050509 Bacteria 2615
385 nmdc:mga06r32_5900_c1 3300050510 Bacteria 11024
386 nmdc:mga08y16_36621_c1 3300050511 Bacteria 5153
387 nmdc:mga08y16_46401_c1 3300050511 Bacteria 4549
388 nmdc:mga08y16_63899_c1 3300050511 Bacteria 3845
389 nmdc:mga0n895_343344_c1 3300050512 Bacteria 1512
390 nmdc:mga0n895_644711_c1 3300050512 Bacteria 1058
391 nmdc:mga0n895_6868_c1 3300050512 Bacteria 9720
392 nmdc:mga0n895_806903_c1 3300050512 Bacteria 928
393 nmdc:mga0rr50_1048_c1 3300050513 Bacteria 15011
394 nmdc:mga0rr50_147161_c1 3300050513 Bacteria 1900
395 nmdc:mga0rr50_160148_c1 3300050513 Unclassified 1826
396 nmdc:mga0rr50_589647_c1 3300050513 Bacteria 947
397 nmdc:mga0a205_11201_c1 3300050515 Bacteria 8254
398 nmdc:mga0a205_186575_c1 3300050515 Bacteria 1966
399 nmdc:mga0a205_29917_c1 3300050515 Bacteria 5212
400 nmdc:mga0a205_855671_c1 3300050515 Bacteria 756
401 Ga0495601_0115871 3300053077 Bacteria 1738
402 Ga0587073_0003273 3300059492 Bacteria 2207
403 Ga0587073_0010992 3300059492 Bacteria 1535
404 Ga0587073_0036676 3300059492 Bacteria 1046
405 Ga0587080_031322 3300059503 Bacteria 928
406 Ga0587082_006714 3300059504 Bacteria 1547
407 Ga0587082_024794 3300059504 Bacteria 1004
408 Ga0587083_0056081 3300059505 Bacteria 874
409 Ga0587099_021165 3300059622 Bacteria 736
410 Ga0587115_028841 3300059626 Archaea 815
411 Ga0587128_031596 3300059630 Bacteria 880
412 Ga0587072_037403 3300059643 Bacteria 931
413 Ga0587075_021078 3300059644 Bacteria 968
414 Ga0587107_004207 3300059652 Bacteria 1448
415 Ga0587114_001147 3300059655 Bacteria 2125
416 Ga0587071_031067 3300060344 Bacteria 1029
417 Ga0530510_0517749 3300061734 Bacteria 905
418 Ga0075364_10315225
419 JGI24035J26624_1022611
420 Ga0006778J45830_1035628
421 Ga0032354_1009842
422 Ga0032354_1010827
423 Ga0058859_11320943
424 Ga0058861_11318594
425 Ga0058861_11964432
426 Ga0058861_11973428
427 Ga0058861_11995975
428 Ga0058860_12228347
429 Ga0058862_12711399
430 Ga0065704_10528778
431 Ga0065712_10034105
432 Ga0065712_10135395
433 Ga0065712_10318635
434 Ga0065715_10105631
435 Ga0065715_10169223
436 Ga0065715_10245422
437 Ga0065707_10179716
438 Ga0065707_10415082
439 Ga0070658_10117207
440 Ga0070676_10007841
441 Ga0070676_10244970
442 Ga0070676_10546995
443 Ga0070690_100611252
444 Ga0070677_10007014
445 Ga0070677_10111351
446 Ga0068869_100258196
447 Ga0070666_10046503
448 Ga0070666_10343143
449 Ga0070680_100057310
450 Ga0068868_100007113
451 Ga0070660_100933622
452 Ga0070689_100089372
453 Ga0070689_100175934
454 Ga0070687_100132823
455 Ga0070687_100453105
456 Ga0070661_100034806
457 Ga0070692_10271993
458 Ga0070668_100063837
459 Ga0070669_100054188
460 Ga0070669_100408996
461 Ga0070675_100009871
462 Ga0070675_100365517
463 Ga0070675_100462693
464 Ga0070674_100114149
465 Ga0070674_100863244
466 Ga0070673_100024603
467 Ga0070673_100294925
468 Ga0070673_100405988
469 Ga0070688_100018415
470 Ga0070688_100142990
471 Ga0070659_100036576
472 Ga0070659_100230921
473 Ga0070659_100505166
474 Ga0070667_100046053
475 Ga0070713_100018550
476 Ga0070701_10117112
477 Ga0070711_100575117
478 Ga0070700_100007730
479 Ga0070700_100102122
480 Ga0070663_100236775
481 Ga0070663_100563906
482 Ga0070678_100031345
483 Ga0070662_101118374
484 Ga0070681_10124105
485 Ga0070681_10298538
486 Ga0068867_100102800
487 Ga0070685_10520437
488 Ga0070679_100138241
489 Ga0070684_100616853
490 Ga0068853_100324147
491 Ga0070672_100038551
492 Ga0070672_100194075
493 Ga0070672_100348340
494 Ga0070686_100480978
495 Ga0070696_100300082
496 Ga0070693_100036363
497 Ga0070665_100299921
498 Ga0070665_100927828
499 Ga0070665_101053562
500 Ga0070704_100192675
501 Ga0068855_100003468
502 Ga0070664_100022639
503 Ga0070664_100099378
504 Ga0070664_100339767
505 Ga0070702_100816914
506 Ga0068852_100062271
507 Ga0068852_100124657
508 Ga0068852_100296106
509 Ga0068859_100044809
510 Ga0068859_100066462
511 Ga0068859_100179913
512 Ga0068859_100694074
513 Ga0068864_100000913
514 Ga0068864_100085846
515 Ga0068864_100152222
516 Ga0068861_100030117
517 Ga0068851_10282533
518 Ga0068870_10280720
519 Ga0068870_10528837
520 Ga0068870_10726670
521 Ga0068863_100043536
522 Ga0068863_100085812
523 Ga0068863_100180043
524 Ga0068863_100530606
525 Ga0068858_100027469
526 Ga0068858_100069739
527 Ga0068858_100186013
528 Ga0068858_100308948
529 Ga0068858_100326942
530 Ga0068860_100249837
531 Ga0068860_100890652
532 Ga0068862_100062580
533 Ga0068862_100076276
534 Ga0081538_10089200
535 Ga0075367_10048942
536 Ga0097621_100029352
537 Ga0097621_100395689
538 Ga0097621_100530772
539 Ga0075370_10614431
540 Ga0068871_100013076
541 Ga0068871_100116045
542 Ga0068871_100305924
543 Ga0068871_100927002
544 Ga0075428_100019136
545 Ga0075428_100077862
546 Ga0075428_100309027
547 Ga0075428_100501606
548 Ga0075430_100164820
549 Ga0075430_100182121
550 Ga0075430_100288561
551 Ga0075431_100011429
552 Ga0075431_100011472
553 Ga0075433_10014543
554 Ga0075434_100012375
555 Ga0075434_100187346
556 Ga0075434_100429561
557 Ga0075429_100002274
558 Ga0075429_100013737
559 Ga0075429_100032901
560 Ga0075429_100046599
561 Ga0075429_100054983
562 Ga0075429_100091531
563 Ga0075429_100347744
564 Ga0068865_100390307
565 Ga0097620_100044807
566 Ga0097620_100066462
567 Ga0097620_100179912
568 Ga0097620_100694077
569 Ga0075435_100000605
570 Ga0075435_100009561
571 Ga0075435_100059412
572 Ga0105240_10030785
573 Ga0111539_10000204
574 Ga0111539_10000592
575 Ga0111539_10004849
576 Ga0111539_10020505
577 Ga0111539_10055549
578 Ga0111539_10071864
579 Ga0111539_10083620
580 Ga0105245_10581478
581 Ga0105247_10028002
582 Ga0105247_10065134
583 Ga0114129_10000102
584 Ga0114129_10005481
585 Ga0114129_10008210
586 Ga0114129_10371861
587 Ga0114129_10752322
588 Ga0114129_10757220
589 Ga0105241_10732518
590 Ga0105241_11222900
591 Ga0105242_10237551
592 Ga0105248_10014368
593 Ga0105248_10017806
594 Ga0105248_10051754
595 Ga0105248_10174019
596 Ga0105248_10248460
597 Ga0105248_10263715
598 Ga0105248_11102395
599 Ga0105238_10004715
600 Ga0105238_10276923
601 Ga0105238_10466138
602 Ga0105249_10059998
603 Ga0105249_10157748
604 Ga0105249_11185450
605 Ga0105246_10193923
606 Ga0163162_10058643
607 Ga0157375_10125645
608 Ga0157375_10263179
609 Ga0157375_10905576
610 Ga0157375_10914832
611 Ga0157375_11582873
612 Ga0163163_10023375
613 Ga0163163_10255799
614 Ga0163163_10921199
615 Ga0163163_10998525
616 Ga0157380_10954708
617 Ga0157380_11290983
618 Ga0157377_10023013
619 Ga0157379_10001547
620 Ga0157379_10048852
621 Ga0157379_10208283
622 Ga0157376_10038547
623 Ga0157376_10277361
624 Ga0157376_10653436
625 Ga0163161_10030871
626 Ga0197907_10647797
627 Ga0197907_11477661
628 Ga0206356_10658333
629 Ga0206356_10848423
630 Ga0206356_11686120
631 Ga0206352_10781261
632 Ga0206352_10841171
633 Ga0206350_10197865
634 Ga0206350_10377174
635 Ga0206350_11088002
636 Ga0206350_11096057
637 Ga0206350_11427370
638 Ga0206354_11033763
639 Ga0154015_1202315
640 Ga0224712_10103146
641 Ga0224712_10193295
642 Ga0224712_10243082
643 Ga0224712_10279927
644 Ga0207697_10000380
645 Ga0207682_10001437
646 Ga0207688_10005082
647 Ga0207688_10059789
648 Ga0207680_10366290
649 Ga0207680_10372032
650 Ga0207645_10031433
651 Ga0207643_10002289
652 Ga0207643_10256865
653 Ga0207707_10265009
654 Ga0207707_10414410
655 Ga0207695_10157938
656 Ga0207695_10368020
657 Ga0207660_10070871
658 Ga0207660_10930943
659 Ga0207662_10154377
660 Ga0207657_10009026
661 Ga0207652_10197300
662 Ga0207652_10668104
663 Ga0207681_10030624
664 Ga0207694_10191687
665 Ga0207694_10193496
666 Ga0207659_10018067
667 Ga0207659_10060114
668 Ga0207659_10390274
669 Ga0207659_10406975
670 Ga0207687_10482977
671 Ga0207700_10030623
672 Ga0207690_10034994
673 Ga0207690_10361817
674 Ga0207706_10001124
675 Ga0207670_10025395
676 Ga0207670_10146016
677 Ga0207670_10156305
678 Ga0207704_10310393
679 Ga0207691_10002188
680 Ga0207691_10169363
681 Ga0207711_10024298
682 Ga0207711_10091569
683 Ga0207711_10383296
684 Ga0207711_10690330
685 Ga0207711_10969222
686 Ga0207711_11022376
687 Ga0207689_10440779
688 Ga0207689_10639621
689 Ga0207661_10232008
690 Ga0207679_10030382
691 Ga0207651_10010753
692 Ga0207651_10421931
693 Ga0207712_11148990
694 Ga0207668_10128395
695 Ga0207668_11569911
696 Ga0207640_10028317
697 Ga0207658_10263140
698 Ga0207658_10652691
699 Ga0207677_10103345
700 Ga0207677_10246614
701 Ga0207703_10008094
702 Ga0207703_10050141
703 Ga0207703_10137100
704 Ga0207703_11246403
705 Ga0207678_10105780
706 Ga0207678_10870497
707 Ga0207708_10010149
708 Ga0207708_10211440
709 Ga0207641_10012884
710 Ga0207641_10142114
711 Ga0207641_10203937
712 Ga0207641_10843680
713 Ga0207641_10893104
714 Ga0207648_10042969
715 Ga0207676_10058940
716 Ga0207676_10221510
717 Ga0207676_11372347
718 Ga0207674_10461449
719 Ga0207675_100006069
720 Ga0207683_10005941
721 Ga0207683_10170204
722 Ga0207683_10596058
723 Ga0207698_10249018
724 Ga0207698_10276872
725 Ga0207698_10414308
726 Ga0207698_10448909
727 Ga0209813_10009296
728 Ga0209974_10155886
729 Ga0207428_10008973
730 Ga0207428_10017662
731 Ga0207428_10065641
732 Ga0207428_10202378
733 Ga0268266_10124106
734 Ga0268266_10277536
735 Ga0268264_10183046
736 Ga0268264_10422470
737 Ga0307408_100008092
738 Ga0307408_100047756
739 Ga0307405_10283433
740 Ga0307407_10481965
741 Ga0307412_10093023
742 Ga0307412_10315352
743 Ga0307409_100171732
744 Ga0307416_100033895
745 Ga0307416_100122291
746 Ga0307416_100173418
747 Ga0307411_10207299
748 Ga0373952_0035722
749 Ga0373932_0018137
750 Ga0373939_0011096
751 Ga0373962_0047040
752 Ga0436365_1800408
753 Ga0439463_087499
754 Ga0439435_0014180
755 Ga0439444_0018082
756 Ga0439464_0019222
757 Ga0439440_0015082
758 Ga0439440_0068705
759 Ga0451576_0143218
760 Ga0495659_0329947
761 Ga0495658_0389933
762 Ga0496100_0008178
763 Ga0496101_0000225
764 Ga0496102_0644406
765 Ga0496104_0049351
766 Ga0496104_0555592
767 Ga0496104_0636719
768 Ga0496105_0100714
769 Ga0496106_0053865
770 Ga0496106_0548452
771 Ga0496107_0083034
772 Ga0496107_0601944
773 Ga0496109_0774327
774 Ga0496110_0597748
775 Ga0496112_0003348
776 Ga0496112_0221382
777 Ga0496112_0415013
778 Ga0496114_0000508
779 Ga0496114_0516393
780 Ga0496115_0146808
781 Ga0501292_016731
782 Ga0501299_004830
783 Ga0501071_0843645
784 Ga0501073_0582511
785 Ga0501074_0686762
786 Ga0501216_045248
787 Ga0501228_005279
788 nmdc:mga00v17_99065_c2
789 nmdc:mga06z11_507712_c1
790 nmdc:mga04h51_121699_c1
791 nmdc:mga05p37_115676_c1
792 nmdc:mga05p37_452657_c1
793 nmdc:mga05p37_46642_c1
794 nmdc:mga05p37_99627_c1
795 nmdc:mga09592_13555_c1
796 nmdc:mga09592_20093_c1
797 nmdc:mga09592_292663_c1
798 nmdc:mga09592_29462_c1
799 nmdc:mga09592_388867_c1
800 nmdc:mga0qj67_66379_c1
801 nmdc:mga0qj67_80182_c1
802 nmdc:mga06r32_5900_c1
803 nmdc:mga08y16_36621_c1
804 nmdc:mga08y16_46401_c1
805 nmdc:mga08y16_63899_c1
806 nmdc:mga0n895_343344_c1
807 nmdc:mga0n895_644711_c1
808 nmdc:mga0n895_6868_c1
809 nmdc:mga0n895_806903_c1
810 nmdc:mga0rr50_1048_c1
811 nmdc:mga0rr50_147161_c1
812 nmdc:mga0rr50_160148_c1
813 nmdc:mga0rr50_589647_c1
814 nmdc:mga0a205_11201_c1
815 nmdc:mga0a205_186575_c1
816 nmdc:mga0a205_29917_c1
817 nmdc:mga0a205_855671_c1
818 Ga0495601_0115871
819 Ga0587073_0003273
820 Ga0587073_0010992
821 Ga0587073_0036676
822 Ga0587080_031322
823 Ga0587082_006714
824 Ga0587082_024794
825 Ga0587083_0056081
826 Ga0587099_021165
827 Ga0587115_028841
828 Ga0587128_031596
829 Ga0587072_037403
830 Ga0587075_021078
831 Ga0587107_004207
832 Ga0587114_001147
833 Ga0587071_031067
834 Ga0530510_0517749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

6

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.974 1 152
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9687 6 154
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9674 6 160
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9624 6 156
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9377 6 160
ID Description Score Start End Superfamily
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9766 2 154 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9741 1 152 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9376 1 152 1.20.1260.10
4eruA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9327 2 156 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9175 2 154 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7W0KAP2-F1-model_v4 DUF892 family protein 0.9953 48 164
AF-A0A838P3M0-F1-model_v4 DUF892 family protein 0.9935 6 162 GO:0016491
AF-A0A7U3ZRX8-F1-model_v4 Ferritin-like domain-containing protein 0.9935 7 164
AF-A0A5Q4DBJ4-F1-model_v4 DUF892 family protein 0.9921 6 165
AF-A0A6M1Q178-F1-model_v4 deleted 0.9913 6 163

Map