F439002

General Info

Members Datasets Scaffolds Average Seq Length
417 250 834 184

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000020|Ga0068855_100000020118
Length 224
Sequence MKLENWLVVFQRFWSTHVDALEKHLNQRAPLLAVTEKETKHMTRREQYVPGAAFGAHIDKKEEKWTLVLVRELAHPPAKVWNALTDPEHLREWAPFDADRNLGAVGTAQLTTVGAPKPMVSEAQVKRADAPKLLEFNWGGQDIRWELEPFGAGGTRLTLWHNIDRRFIAMGAAGWHLCIDIMDRFVAGHPIGRIVGPDAMKLEGWQRLHAEYAQQFGVQTPSGG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 2.16
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100000020 3300005563 Bacteria 205600
2 rootH1_10044321 3300003323 Unclassified 3675
3 Ga0065715_10130721 3300005293 Bacteria 2014
4 Ga0070683_100103878 3300005329 Bacteria 2678
5 Ga0070683_100148471 3300005329 Bacteria 2222
6 Ga0070683_100313425 3300005329 Bacteria 1493
7 Ga0070683_100440635 3300005329 Bacteria 1243
8 Ga0070683_100462927 3300005329 Bacteria 1210
9 Ga0070690_100004350 3300005330 Bacteria 7854
10 Ga0070690_100041477 3300005330 Bacteria 2914
11 Ga0070690_100998509 3300005330 Unclassified 659
12 Ga0070670_100244032 3300005331 Bacteria 1564
13 Ga0070670_100296427 3300005331 Bacteria 1414
14 Ga0070677_10174411 3300005333 Bacteria 1019
15 Ga0070680_100540716 3300005336 Bacteria 998
16 Ga0070682_100142575 3300005337 Bacteria 1635
17 Ga0068868_100124245 3300005338 Bacteria 2107
18 Ga0070660_100121899 3300005339 Bacteria 2081
19 Ga0070689_100000101 3300005340 Bacteria 50092
20 Ga0070689_100239555 3300005340 Bacteria 1494
21 Ga0070689_100628712 3300005340 Bacteria 932
22 Ga0070687_100683586 3300005343 Bacteria 715
23 Ga0070661_100368265 3300005344 Bacteria 1131
24 Ga0070668_100047019 3300005347 Bacteria 3316
25 Ga0070668_100071998 3300005347 Bacteria 2693
26 Ga0070675_100004496 3300005354 Bacteria 10650
27 Ga0070675_100944744 3300005354 Bacteria 791
28 Ga0070674_100028608 3300005356 Bacteria 3662
29 Ga0070674_100543291 3300005356 Bacteria 974
30 Ga0070673_100002057 3300005364 Bacteria 12132
31 Ga0070673_100623874 3300005364 Bacteria 985
32 Ga0070688_100000001 3300005365 Bacteria 106331
33 Ga0070659_100561163 3300005366 Bacteria 978
34 Ga0070659_100760016 3300005366 Bacteria 841
35 Ga0070713_100576755 3300005436 Bacteria 1067
36 Ga0070710_10272666 3300005437 Bacteria 1095
37 Ga0070710_10358534 3300005437 Bacteria 967
38 Ga0070700_100093123 3300005441 Bacteria 1970
39 Ga0070708_100031431 3300005445 Bacteria 4594
40 Ga0070708_100057065 3300005445 Bacteria 3475
41 Ga0070708_100116769 3300005445 Bacteria 2457
42 Ga0070678_100667068 3300005456 Bacteria 934
43 Ga0068867_100026078 3300005459 Bacteria 4194
44 Ga0068867_100092336 3300005459 Bacteria 2299
45 Ga0068867_100164964 3300005459 Bacteria 1750
46 Ga0068867_100201375 3300005459 Bacteria 1594
47 Ga0068867_100690375 3300005459 Bacteria 900
48 Ga0070685_10030017 3300005466 Bacteria 3025
49 Ga0070706_100023081 3300005467 Bacteria 5730
50 Ga0070706_100593441 3300005467 Bacteria 1029
51 Ga0070698_100366169 3300005471 Bacteria 1373
52 Ga0070698_100987431 3300005471 Bacteria 789
53 Ga0070699_100027688 3300005518 Bacteria 4886
54 Ga0070679_100022165 3300005530 Bacteria 6206
55 Ga0070679_100535913 3300005530 Bacteria 1114
56 Ga0070684_100194381 3300005535 Bacteria 1847
57 Ga0070697_100252138 3300005536 Bacteria 1509
58 Ga0070672_100009720 3300005543 Bacteria 6642
59 Ga0070672_100079064 3300005543 Bacteria 2632
60 Ga0070665_100005189 3300005548 Bacteria 13474
61 Ga0070665_100037229 3300005548 Bacteria 4895
62 Ga0070704_100555811 3300005549 Bacteria 1003
63 Ga0068855_100117860 3300005563 Bacteria 3041
64 Ga0068855_100282189 3300005563 Bacteria 1844
65 Ga0068855_100664118 3300005563 Bacteria 1118
66 Ga0070664_100047616 3300005564 Bacteria 3622
67 Ga0070664_100053625 3300005564 Bacteria 3419
68 Ga0068857_100133781 3300005577 Bacteria 2238
69 Ga0068856_101288409 3300005614 Bacteria 746
70 Ga0070702_100161288 3300005615 Bacteria 1450
71 Ga0068859_100005059 3300005617 Bacteria 13384
72 Ga0068859_100019760 3300005617 Bacteria 6762
73 Ga0068859_100776800 3300005617 Unclassified 1046
74 Ga0068864_100349744 3300005618 Bacteria 1394
75 Ga0068864_100776765 3300005618 Bacteria 940
76 Ga0068864_101063540 3300005618 Bacteria 804
77 Ga0068866_10160352 3300005718 Bacteria 1311
78 Ga0068861_100151593 3300005719 Bacteria 1903
79 Ga0068863_100141792 3300005841 Bacteria 2297
80 Ga0068863_100244315 3300005841 Bacteria 1733
81 Ga0068863_100466160 3300005841 Bacteria 1241
82 Ga0068858_100198015 3300005842 Bacteria 1899
83 Ga0068858_100431075 3300005842 Bacteria 1269
84 Ga0068860_100058973 3300005843 Bacteria 3650
85 Ga0068860_100779647 3300005843 Bacteria 969
86 Ga0070712_100005279 3300006175 Bacteria 7993
87 Ga0075366_10594138 3300006195 Bacteria 686
88 Ga0097621_100058641 3300006237 Bacteria 3149
89 Ga0097621_100434252 3300006237 Bacteria 1181
90 Ga0097621_100558033 3300006237 Unclassified 1043
91 Ga0068871_100036500 3300006358 Bacteria 3913
92 Ga0068871_100108377 3300006358 Bacteria 2334
93 Ga0068871_100260065 3300006358 Bacteria 1514
94 Ga0075428_101231200 3300006844 Bacteria 788
95 Ga0075434_100010341 3300006871 Bacteria 8747
96 Ga0075434_100360005 3300006871 Bacteria 1476
97 Ga0075434_100393445 3300006871 Bacteria 1407
98 Ga0068865_100082923 3300006881 Bacteria 2306
99 Ga0068865_100361802 3300006881 Bacteria 1178
100 Ga0075436_100035558 3300006914 Bacteria 3436
101 Ga0097620_100005059 3300006931 Bacteria 13384
102 Ga0097620_100019757 3300006931 Bacteria 6762
103 Ga0097620_100776728 3300006931 Unclassified 1046
104 Ga0075435_100016187 3300007076 Bacteria 5620
105 Ga0075435_100033487 3300007076 Bacteria 4063
106 Ga0075435_100039837 3300007076 Bacteria 3750
107 Ga0075435_100049410 3300007076 Bacteria 3383
108 Ga0105240_10001049 3300009093 Bacteria 48973
109 Ga0111539_10013363 3300009094 Bacteria 10261
110 Ga0111539_10051107 3300009094 Bacteria 4924
111 Ga0105245_10001164 3300009098 Bacteria 23809
112 Ga0105245_10001324 3300009098 Bacteria 22391
113 Ga0105245_10024529 3300009098 Bacteria 5296
114 Ga0105245_10071270 3300009098 Bacteria 3156
115 Ga0105245_10327314 3300009098 Bacteria 1511
116 Ga0105247_10307814 3300009101 Unclassified 1101
117 Ga0114129_10018543 3300009147 Bacteria 9907
118 Ga0114129_10235162 3300009147 Bacteria 2466
119 Ga0114129_11222383 3300009147 Bacteria 935
120 Ga0114129_11731090 3300009147 Bacteria 762
121 Ga0105243_10044927 3300009148 Bacteria 3468
122 Ga0105243_10382917 3300009148 Bacteria 1302
123 Ga0105241_10008150 3300009174 Bacteria 7716
124 Ga0105241_10609231 3300009174 Bacteria 987
125 Ga0105242_10002238 3300009176 Bacteria 15262
126 Ga0105242_10003541 3300009176 Bacteria 12140
127 Ga0105242_10010057 3300009176 Bacteria 7245
128 Ga0105242_10050017 3300009176 Bacteria 3402
129 Ga0105242_10065166 3300009176 Bacteria 3005
130 Ga0105248_10022641 3300009177 Bacteria 6973
131 Ga0105248_10027352 3300009177 Bacteria 6348
132 Ga0105248_10043601 3300009177 Bacteria 5030
133 Ga0105248_10051419 3300009177 Bacteria 4623
134 Ga0105248_10124791 3300009177 Bacteria 2904
135 Ga0105248_10176058 3300009177 Bacteria 2411
136 Ga0105248_10456533 3300009177 Bacteria 1440
137 Ga0105237_10002610 3300009545 Bacteria 22190
138 Ga0105237_10122328 3300009545 Bacteria 2596
139 Ga0105237_10463927 3300009545 Bacteria 1272
140 Ga0105237_11055966 3300009545 Unclassified 819
141 Ga0105238_10062969 3300009551 Bacteria 3710
142 Ga0105249_11277044 3300009553 Bacteria 806
143 Ga0099796_10033237 3300010159 Bacteria 1696
144 Ga0105239_10229638 3300010375 Bacteria 2082
145 Ga0105246_10992349 3300011119 Bacteria 760
146 Ga0157374_10011056 3300013296 Bacteria 7797
147 Ga0157374_10048355 3300013296 Bacteria 3946
148 Ga0157378_10095486 3300013297 Bacteria 2708
149 Ga0157378_10185281 3300013297 Bacteria 1960
150 Ga0157378_10619099 3300013297 Bacteria 1095
151 Ga0163162_10090283 3300013306 Bacteria 3145
152 Ga0163162_10604724 3300013306 Bacteria 1222
153 Ga0157372_10870341 3300013307 Bacteria 1046
154 Ga0157375_10078641 3300013308 Bacteria 3332
155 Ga0157375_10539773 3300013308 Bacteria 1328
156 Ga0157375_10806167 3300013308 Bacteria 1087
157 Ga0157375_11004798 3300013308 Bacteria 974
158 Ga0157380_10011941 3300014326 Bacteria 6284
159 Ga0157380_10017626 3300014326 Bacteria 5286
160 Ga0157379_10553072 3300014968 Unclassified 1071
161 Ga0157376_10001677 3300014969 Bacteria 14711
162 Ga0157376_10122525 3300014969 Bacteria 2307
163 Ga0163161_10214661 3300017792 Bacteria 1487
164 Ga0213875_10001973 3300021388 Bacteria 12686
165 Ga0213875_10087711 3300021388 Unclassified 1451
166 Ga0207692_10007911 3300025898 Bacteria 4380
167 Ga0207692_10324158 3300025898 Bacteria 943
168 Ga0207688_10339741 3300025901 Bacteria 924
169 Ga0207647_10331992 3300025904 Bacteria 862
170 Ga0207647_10518554 3300025904 Bacteria 663
171 Ga0207684_10011665 3300025910 Bacteria 7671
172 Ga0207654_10016508 3300025911 Bacteria 3846
173 Ga0207695_10007040 3300025913 Bacteria 14431
174 Ga0207671_10002278 3300025914 Bacteria 20762
175 Ga0207671_10130353 3300025914 Unclassified 1929
176 Ga0207671_10313389 3300025914 Bacteria 1241
177 Ga0207663_10041728 3300025916 Bacteria 2798
178 Ga0207660_10156300 3300025917 Bacteria 1756
179 Ga0207662_10024882 3300025918 Bacteria 3446
180 Ga0207662_10427042 3300025918 Bacteria 903
181 Ga0207657_10098952 3300025919 Bacteria 2423
182 Ga0207652_10004919 3300025921 Bacteria 10810
183 Ga0207646_10024661 3300025922 Bacteria 5507
184 Ga0207681_10318642 3300025923 Bacteria 1236
185 Ga0207694_10020945 3300025924 Bacteria 4950
186 Ga0207650_10227729 3300025925 Bacteria 1502
187 Ga0207659_10000241 3300025926 Bacteria 33277
188 Ga0207659_10098866 3300025926 Bacteria 2195
189 Ga0207687_10051248 3300025927 Bacteria 2876
190 Ga0207687_10120254 3300025927 Bacteria 1963
191 Ga0207687_10169090 3300025927 Bacteria 1684
192 Ga0207700_10499186 3300025928 Bacteria 1077
193 Ga0207706_10430838 3300025933 Bacteria 1142
194 Ga0207686_10012872 3300025934 Bacteria 4612
195 Ga0207686_10015987 3300025934 Bacteria 4205
196 Ga0207686_10027987 3300025934 Bacteria 3307
197 Ga0207686_10073097 3300025934 Bacteria 2211
198 Ga0207686_10155428 3300025934 Bacteria 1597
199 Ga0207709_10674944 3300025935 Bacteria 825
200 Ga0207670_10000012 3300025936 Bacteria 246808
201 Ga0207670_10078888 3300025936 Bacteria 2297
202 Ga0207669_10032008 3300025937 Bacteria 2948
203 Ga0207669_10366093 3300025937 Bacteria 1119
204 Ga0207704_10015752 3300025938 Bacteria 3863
205 Ga0207704_10045177 3300025938 Bacteria 2615
206 Ga0207704_10138895 3300025938 Bacteria 1696
207 Ga0207704_10426042 3300025938 Bacteria 1053
208 Ga0207691_10000805 3300025940 Bacteria 31178
209 Ga0207691_10023548 3300025940 Bacteria 5798
210 Ga0207691_10059183 3300025940 Bacteria 3484
211 Ga0207711_10050041 3300025941 Bacteria 3577
212 Ga0207711_10195166 3300025941 Bacteria 1846
213 Ga0207711_10833494 3300025941 Bacteria 858
214 Ga0207689_10132048 3300025942 Bacteria 2055
215 Ga0207661_10217745 3300025944 Bacteria 1686
216 Ga0207661_10261045 3300025944 Bacteria 1543
217 Ga0207661_10379806 3300025944 Bacteria 1279
218 Ga0207679_10067014 3300025945 Bacteria 2692
219 Ga0207679_10181935 3300025945 Bacteria 1740
220 Ga0207667_10000258 3300025949 Bacteria 74576
221 Ga0207667_10075045 3300025949 Bacteria 3512
222 Ga0207667_10504069 3300025949 Bacteria 1228
223 Ga0207651_10003466 3300025960 Bacteria 7751
224 Ga0207651_10064324 3300025960 Bacteria 2567
225 Ga0207651_10544911 3300025960 Bacteria 1008
226 Ga0207668_10044109 3300025972 Bacteria 3031
227 Ga0207658_10138726 3300025986 Bacteria 1965
228 Ga0207677_10101862 3300026023 Bacteria 2115
229 Ga0207677_10178672 3300026023 Bacteria 1667
230 Ga0207703_10526198 3300026035 Bacteria 1113
231 Ga0207703_10726532 3300026035 Bacteria 945
232 Ga0207678_10929325 3300026067 Bacteria 769
233 Ga0207708_10008678 3300026075 Bacteria 7522
234 Ga0207641_10063967 3300026088 Bacteria 3144
235 Ga0207641_10079499 3300026088 Bacteria 2843
236 Ga0207641_10368316 3300026088 Bacteria 1373
237 Ga0207641_10462322 3300026088 Bacteria 1228
238 Ga0207648_10038360 3300026089 Bacteria 4216
239 Ga0207648_10062373 3300026089 Bacteria 3249
240 Ga0207648_10124348 3300026089 Bacteria 2269
241 Ga0207648_10486778 3300026089 Bacteria 1127
242 Ga0207648_10914992 3300026089 Bacteria 820
243 Ga0207676_10318354 3300026095 Bacteria 1427
244 Ga0207674_10604667 3300026116 Bacteria 1059
245 Ga0207675_100144058 3300026118 Bacteria 2265
246 Ga0209179_1014353 3300027512 Bacteria 1453
247 Ga0207428_10021175 3300027907 Bacteria 5507
248 Ga0207428_10066573 3300027907 Bacteria 2838
249 Ga0268266_10034404 3300028379 Bacteria 4309
250 Ga0268266_10090576 3300028379 Bacteria 2681
251 Ga0268266_10172203 3300028379 Bacteria 1965
252 Ga0268266_10180675 3300028379 Bacteria 1921
253 Ga0268265_10000208 3300028380 Bacteria 68360
254 Ga0268264_10064248 3300028381 Bacteria 3088
255 Ga0268264_10121006 3300028381 Bacteria 2307
256 Ga0265319_1137475 3300028563 Bacteria 759
257 Ga0265334_10031965 3300028573 Bacteria 2101
258 Ga0265318_10047168 3300028577 Bacteria 1625
259 Ga0265336_10024289 3300028666 Bacteria 1917
260 Ga0265338_10059908 3300028800 Bacteria 3350
261 Ga0265324_10038534 3300029957 Bacteria 1658
262 Ga0265332_10005251 3300031238 Bacteria 5989
263 Ga0265320_10003694 3300031240 Bacteria 10207
264 Ga0265320_10049564 3300031240 Bacteria 2044
265 Ga0265329_10026061 3300031242 Bacteria 1930
266 Ga0265340_10050782 3300031247 Bacteria 2010
267 Ga0265339_10117167 3300031249 Bacteria 1372
268 Ga0265316_10058088 3300031344 Bacteria 3015
269 Ga0265316_10131945 3300031344 Bacteria 1881
270 Ga0265313_10012224 3300031595 Bacteria 5259
271 Ga0265313_10072224 3300031595 Bacteria 1586
272 Ga0265314_10079110 3300031711 Unclassified 2174
273 Ga0265342_10025267 3300031712 Bacteria 3738
274 Ga0307413_10434215 3300031824 Unclassified 1038
275 Ga0307413_10746137 3300031824 Bacteria 818
276 Ga0307410_10519597 3300031852 Unclassified 982
277 Ga0307406_10713175 3300031901 Bacteria 839
278 Ga0307407_10547137 3300031903 Bacteria 855
279 Ga0307409_100074572 3300031995 Bacteria 2712
280 Ga0307409_100350603 3300031995 Bacteria 1393
281 Ga0307409_100444154 3300031995 Bacteria 1250
282 Ga0307416_100301400 3300032002 Bacteria 1593
283 Ga0307414_10545312 3300032004 Bacteria 1033
284 Ga0307411_10220589 3300032005 Bacteria 1471
285 Ga0307411_10417157 3300032005 Unclassified 1114
286 Ga0307415_100404955 3300032126 Bacteria 1166
287 Ga0307415_100555819 3300032126 Bacteria 1014
288 Ga0373930_0000190 3300034816 Bacteria 7423
289 Ga0373948_0032170 3300034817 Bacteria 1063
290 Ga0373958_0001725 3300034819 Bacteria 2969
291 Ga0373959_0002213 3300034820 Bacteria 3100
292 Ga0373938_0009388 3300034957 Bacteria 1771
293 Ga0373929_0002028 3300035085 Bacteria 3770
294 Ga0373940_0002904 3300035088 Bacteria 3415
295 Ga0373940_0223148 3300035088 Bacteria 627
296 Ga0373949_0003873 3300035090 Bacteria 3477
297 Ga0373951_0000928 3300035091 Bacteria 7886
298 Ga0373952_0000354 3300035092 Bacteria 7749
299 Ga0373932_0000157 3300035112 Bacteria 19830
300 Ga0373941_0006216 3300035115 Bacteria 2865
301 Ga0373953_0138452 3300035117 Bacteria 1040
302 Ga0373954_0294501 3300035118 Bacteria 800
303 Ga0373956_0018793 3300035119 Bacteria 2929
304 Ga0373957_0002093 3300035120 Bacteria 5601
305 Ga0373957_0055283 3300035120 Bacteria 1526
306 Ga0373960_0001327 3300035121 Bacteria 5444
307 Ga0373955_0026786 3300035172 Bacteria 2974
308 Ga0373942_0001220 3300035207 Bacteria 6767
309 Ga0373961_0011608 3300035241 Bacteria 2189
310 Ga0373962_0000383 3300035242 Bacteria 9648
311 Ga0373962_0050322 3300035242 Bacteria 1200
312 Ga0373933_0089753 3300035724 Bacteria 1895
313 Ga0373937_0006669 3300036401 Bacteria 9966
314 Ga0373937_1578431 3300036401 Bacteria 603
315 Ga0436364_0057835 3300037853 Bacteria 986
316 Ga0436364_0165195 3300037853 Bacteria 13427
317 Ga0436364_0356768 3300037853 Bacteria 1205
318 Ga0436364_0433388 3300037853 Bacteria 5066
319 Ga0436364_0679391 3300037853 Bacteria 5241
320 Ga0436365_0377850 3300039437 Bacteria 6349
321 Ga0436365_1062994 3300039437 Bacteria 1325
322 Ga0451847_0838511 3300041503 Bacteria 794
323 Ga0451849_0177524 3300041505 Bacteria 3167
324 Ga0451851_0883595 3300041507 Bacteria 2145
325 Ga0451853_0508974 3300041512 Bacteria 37152
326 Ga0466961_0272822 3300044693 Bacteria 1036
327 Ga0453684_1191890 3300044712 Unclassified 800
328 Ga0466970_0001303 3300044765 Bacteria 12073
329 Ga0451576_0009094 3300045051 Bacteria 11560
330 Ga0495580_0091824 3300046472 Bacteria 2113
331 Ga0495582_0265786 3300046473 Bacteria 984
332 Ga0495594_0571991 3300046499 Bacteria 641
333 Ga0495628_0777982 3300046516 Bacteria 671
334 Ga0495630_0973768 3300046517 Unclassified 645
335 Ga0495586_0182658 3300046535 Bacteria 1187
336 Ga0495586_0713674 3300046535 Bacteria 579
337 Ga0495621_0014688 3300046539 Bacteria 2483
338 Ga0495622_0069357 3300046557 Bacteria 1628
339 Ga0495667_0716276 3300046559 Bacteria 620
340 Ga0495668_0171416 3300046616 Bacteria 1189
341 Ga0495634_0198148 3300046642 Bacteria 1249
342 Ga0495647_0012343 3300046681 Bacteria 2940
343 Ga0495669_0310219 3300046684 Bacteria 761
344 Ga0495604_0282591 3300047317 Unclassified 1121
345 Ga0495636_0190656 3300047318 Bacteria 933
346 Ga0495674_0674640 3300047319 Bacteria 813
347 Ga0495672_0155165 3300047320 Bacteria 1183
348 Ga0495680_0048569 3300047322 Bacteria 3332
349 Ga0495614_0271795 3300048089 Bacteria 779
350 Ga0496100_0207435 3300048903 Bacteria 1432
351 Ga0496102_1002837 3300048905 Bacteria 755
352 Ga0496104_0114116 3300048907 Bacteria 2591
353 Ga0496104_0498817 3300048907 Bacteria 1128
354 Ga0496105_0210648 3300048908 Bacteria 1584
355 Ga0496105_0330662 3300048908 Bacteria 1220
356 Ga0496106_0198783 3300048909 Bacteria 1595
357 Ga0496106_0230128 3300048909 Bacteria 1480
358 Ga0496112_0735238 3300048915 Bacteria 913
359 Ga0501031_0004345 3300049568 Bacteria 9167
360 Ga0501032_0015325 3300049569 Bacteria 5411
361 Ga0501033_0003571 3300049570 Bacteria 12724
362 Ga0501034_0396902 3300049571 Bacteria 1302
363 Ga0501036_0000295 3300049572 Bacteria 34600
364 Ga0501036_0963089 3300049572 Bacteria 699
365 Ga0501037_0014741 3300049573 Bacteria 5749
366 Ga0501038_0001014 3300049574 Bacteria 25267
367 Ga0501038_0570497 3300049574 Bacteria 859
368 Ga0501039_0011021 3300049575 Bacteria 6887
369 Ga0501040_0461304 3300049576 Bacteria 915
370 Ga0501042_0025063 3300049578 Bacteria 4188
371 Ga0501043_0002917 3300049579 Bacteria 14273
372 Ga0501046_0043368 3300049580 Bacteria 3581
373 Ga0501046_0332790 3300049580 Bacteria 1105
374 Ga0501067_0000758 3300049583 Bacteria 17370
375 Ga0501068_0000872 3300049584 Bacteria 15717
376 Ga0501069_0000735 3300049585 Bacteria 15273
377 Ga0501071_0485314 3300049587 Bacteria 947
378 Ga0501072_0017997 3300049588 Bacteria 5432
379 Ga0501073_0001754 3300049589 Bacteria 16104
380 Ga0501073_0274909 3300049589 Bacteria 1162
381 Ga0501074_0254183 3300049590 Bacteria 1249
382 Ga0501076_0016369 3300049592 Bacteria 5623
383 Ga0501076_0299483 3300049592 Bacteria 1318
384 Ga0501077_0003719 3300049593 Bacteria 9177
385 Ga0501079_0001799 3300049741 Bacteria 15314
386 Ga0501079_0236031 3300049741 Bacteria 1429
387 Ga0501080_0000017 3300049742 Bacteria 96079
388 Ga0501080_0013562 3300049742 Bacteria 7502
389 Ga0501044_0038002 3300049823 Bacteria 5029
390 nmdc:mga0k408_215637_c1 3300050493 Bacteria 1146
391 nmdc:mga05p37_10784_c1 3300050507 Bacteria 10847
392 nmdc:mga05p37_1348394_c1 3300050507 Bacteria 723
393 nmdc:mga05p37_624203_c1 3300050507 Bacteria 1212
394 nmdc:mga05p37_660994_c1 3300050507 Bacteria 1168
395 nmdc:mga08y16_1369_c1 3300050511 Bacteria 24366
396 nmdc:mga08y16_328049_c1 3300050511 Bacteria 1575
397 nmdc:mga08y16_4283_c1 3300050511 Bacteria 14894
398 nmdc:mga0n895_1059151_c1 3300050512 Bacteria 790
399 nmdc:mga0n895_1882_c1 3300050512 Bacteria 16047
400 nmdc:mga0n895_214543_c1 3300050512 Bacteria 1954
401 nmdc:mga0rr50_19325_c1 3300050513 Bacteria 4596
402 nmdc:mga0rr50_26090_c1 3300050513 Bacteria 4071
403 nmdc:mga0rr50_47584_c1 3300050513 Bacteria 3165
404 nmdc:mga0rr50_720320_c1 3300050513 Bacteria 851
405 nmdc:mga0rr50_76169_c1 3300050513 Bacteria 2574
406 nmdc:mga08x19_86488_c1 3300050514 Bacteria 2064
407 nmdc:mga0a205_787_c1 3300050515 Bacteria 25716
408 Ga0500635_0022780 3300053080 Bacteria 1946
409 Ga0495619_0574773 3300053085 Bacteria 772
410 Ga0495619_0670812 3300053085 Unclassified 706
411 Ga0500562_150236 3300053108 Bacteria 634
412 Ga0500614_017155 3300053123 Bacteria 1633
413 Ga0501084_0010305 3300054114 Bacteria 7732
414 Ga0501084_0021065 3300054114 Bacteria 5438
415 Ga0501082_0029052 3300060353 Bacteria 4763
416 Ga0530510_0168134 3300061734 Bacteria 1624
417 Ga0530510_0451550 3300061734 Bacteria 972
418 Ga0068855_100000020
419 rootH1_10044321
420 Ga0065715_10130721
421 Ga0070683_100103878
422 Ga0070683_100148471
423 Ga0070683_100313425
424 Ga0070683_100440635
425 Ga0070683_100462927
426 Ga0070690_100004350
427 Ga0070690_100041477
428 Ga0070690_100998509
429 Ga0070670_100244032
430 Ga0070670_100296427
431 Ga0070677_10174411
432 Ga0070680_100540716
433 Ga0070682_100142575
434 Ga0068868_100124245
435 Ga0070660_100121899
436 Ga0070689_100000101
437 Ga0070689_100239555
438 Ga0070689_100628712
439 Ga0070687_100683586
440 Ga0070661_100368265
441 Ga0070668_100047019
442 Ga0070668_100071998
443 Ga0070675_100004496
444 Ga0070675_100944744
445 Ga0070674_100028608
446 Ga0070674_100543291
447 Ga0070673_100002057
448 Ga0070673_100623874
449 Ga0070688_100000001
450 Ga0070659_100561163
451 Ga0070659_100760016
452 Ga0070713_100576755
453 Ga0070710_10272666
454 Ga0070710_10358534
455 Ga0070700_100093123
456 Ga0070708_100031431
457 Ga0070708_100057065
458 Ga0070708_100116769
459 Ga0070678_100667068
460 Ga0068867_100026078
461 Ga0068867_100092336
462 Ga0068867_100164964
463 Ga0068867_100201375
464 Ga0068867_100690375
465 Ga0070685_10030017
466 Ga0070706_100023081
467 Ga0070706_100593441
468 Ga0070698_100366169
469 Ga0070698_100987431
470 Ga0070699_100027688
471 Ga0070679_100022165
472 Ga0070679_100535913
473 Ga0070684_100194381
474 Ga0070697_100252138
475 Ga0070672_100009720
476 Ga0070672_100079064
477 Ga0070665_100005189
478 Ga0070665_100037229
479 Ga0070704_100555811
480 Ga0068855_100117860
481 Ga0068855_100282189
482 Ga0068855_100664118
483 Ga0070664_100047616
484 Ga0070664_100053625
485 Ga0068857_100133781
486 Ga0068856_101288409
487 Ga0070702_100161288
488 Ga0068859_100005059
489 Ga0068859_100019760
490 Ga0068859_100776800
491 Ga0068864_100349744
492 Ga0068864_100776765
493 Ga0068864_101063540
494 Ga0068866_10160352
495 Ga0068861_100151593
496 Ga0068863_100141792
497 Ga0068863_100244315
498 Ga0068863_100466160
499 Ga0068858_100198015
500 Ga0068858_100431075
501 Ga0068860_100058973
502 Ga0068860_100779647
503 Ga0070712_100005279
504 Ga0075366_10594138
505 Ga0097621_100058641
506 Ga0097621_100434252
507 Ga0097621_100558033
508 Ga0068871_100036500
509 Ga0068871_100108377
510 Ga0068871_100260065
511 Ga0075428_101231200
512 Ga0075434_100010341
513 Ga0075434_100360005
514 Ga0075434_100393445
515 Ga0068865_100082923
516 Ga0068865_100361802
517 Ga0075436_100035558
518 Ga0097620_100005059
519 Ga0097620_100019757
520 Ga0097620_100776728
521 Ga0075435_100016187
522 Ga0075435_100033487
523 Ga0075435_100039837
524 Ga0075435_100049410
525 Ga0105240_10001049
526 Ga0111539_10013363
527 Ga0111539_10051107
528 Ga0105245_10001164
529 Ga0105245_10001324
530 Ga0105245_10024529
531 Ga0105245_10071270
532 Ga0105245_10327314
533 Ga0105247_10307814
534 Ga0114129_10018543
535 Ga0114129_10235162
536 Ga0114129_11222383
537 Ga0114129_11731090
538 Ga0105243_10044927
539 Ga0105243_10382917
540 Ga0105241_10008150
541 Ga0105241_10609231
542 Ga0105242_10002238
543 Ga0105242_10003541
544 Ga0105242_10010057
545 Ga0105242_10050017
546 Ga0105242_10065166
547 Ga0105248_10022641
548 Ga0105248_10027352
549 Ga0105248_10043601
550 Ga0105248_10051419
551 Ga0105248_10124791
552 Ga0105248_10176058
553 Ga0105248_10456533
554 Ga0105237_10002610
555 Ga0105237_10122328
556 Ga0105237_10463927
557 Ga0105237_11055966
558 Ga0105238_10062969
559 Ga0105249_11277044
560 Ga0099796_10033237
561 Ga0105239_10229638
562 Ga0105246_10992349
563 Ga0157374_10011056
564 Ga0157374_10048355
565 Ga0157378_10095486
566 Ga0157378_10185281
567 Ga0157378_10619099
568 Ga0163162_10090283
569 Ga0163162_10604724
570 Ga0157372_10870341
571 Ga0157375_10078641
572 Ga0157375_10539773
573 Ga0157375_10806167
574 Ga0157375_11004798
575 Ga0157380_10011941
576 Ga0157380_10017626
577 Ga0157379_10553072
578 Ga0157376_10001677
579 Ga0157376_10122525
580 Ga0163161_10214661
581 Ga0213875_10001973
582 Ga0213875_10087711
583 Ga0207692_10007911
584 Ga0207692_10324158
585 Ga0207688_10339741
586 Ga0207647_10331992
587 Ga0207647_10518554
588 Ga0207684_10011665
589 Ga0207654_10016508
590 Ga0207695_10007040
591 Ga0207671_10002278
592 Ga0207671_10130353
593 Ga0207671_10313389
594 Ga0207663_10041728
595 Ga0207660_10156300
596 Ga0207662_10024882
597 Ga0207662_10427042
598 Ga0207657_10098952
599 Ga0207652_10004919
600 Ga0207646_10024661
601 Ga0207681_10318642
602 Ga0207694_10020945
603 Ga0207650_10227729
604 Ga0207659_10000241
605 Ga0207659_10098866
606 Ga0207687_10051248
607 Ga0207687_10120254
608 Ga0207687_10169090
609 Ga0207700_10499186
610 Ga0207706_10430838
611 Ga0207686_10012872
612 Ga0207686_10015987
613 Ga0207686_10027987
614 Ga0207686_10073097
615 Ga0207686_10155428
616 Ga0207709_10674944
617 Ga0207670_10000012
618 Ga0207670_10078888
619 Ga0207669_10032008
620 Ga0207669_10366093
621 Ga0207704_10015752
622 Ga0207704_10045177
623 Ga0207704_10138895
624 Ga0207704_10426042
625 Ga0207691_10000805
626 Ga0207691_10023548
627 Ga0207691_10059183
628 Ga0207711_10050041
629 Ga0207711_10195166
630 Ga0207711_10833494
631 Ga0207689_10132048
632 Ga0207661_10217745
633 Ga0207661_10261045
634 Ga0207661_10379806
635 Ga0207679_10067014
636 Ga0207679_10181935
637 Ga0207667_10000258
638 Ga0207667_10075045
639 Ga0207667_10504069
640 Ga0207651_10003466
641 Ga0207651_10064324
642 Ga0207651_10544911
643 Ga0207668_10044109
644 Ga0207658_10138726
645 Ga0207677_10101862
646 Ga0207677_10178672
647 Ga0207703_10526198
648 Ga0207703_10726532
649 Ga0207678_10929325
650 Ga0207708_10008678
651 Ga0207641_10063967
652 Ga0207641_10079499
653 Ga0207641_10368316
654 Ga0207641_10462322
655 Ga0207648_10038360
656 Ga0207648_10062373
657 Ga0207648_10124348
658 Ga0207648_10486778
659 Ga0207648_10914992
660 Ga0207676_10318354
661 Ga0207674_10604667
662 Ga0207675_100144058
663 Ga0209179_1014353
664 Ga0207428_10021175
665 Ga0207428_10066573
666 Ga0268266_10034404
667 Ga0268266_10090576
668 Ga0268266_10172203
669 Ga0268266_10180675
670 Ga0268265_10000208
671 Ga0268264_10064248
672 Ga0268264_10121006
673 Ga0265319_1137475
674 Ga0265334_10031965
675 Ga0265318_10047168
676 Ga0265336_10024289
677 Ga0265338_10059908
678 Ga0265324_10038534
679 Ga0265332_10005251
680 Ga0265320_10003694
681 Ga0265320_10049564
682 Ga0265329_10026061
683 Ga0265340_10050782
684 Ga0265339_10117167
685 Ga0265316_10058088
686 Ga0265316_10131945
687 Ga0265313_10012224
688 Ga0265313_10072224
689 Ga0265314_10079110
690 Ga0265342_10025267
691 Ga0307413_10434215
692 Ga0307413_10746137
693 Ga0307410_10519597
694 Ga0307406_10713175
695 Ga0307407_10547137
696 Ga0307409_100074572
697 Ga0307409_100350603
698 Ga0307409_100444154
699 Ga0307416_100301400
700 Ga0307414_10545312
701 Ga0307411_10220589
702 Ga0307411_10417157
703 Ga0307415_100404955
704 Ga0307415_100555819
705 Ga0373930_0000190
706 Ga0373948_0032170
707 Ga0373958_0001725
708 Ga0373959_0002213
709 Ga0373938_0009388
710 Ga0373929_0002028
711 Ga0373940_0002904
712 Ga0373940_0223148
713 Ga0373949_0003873
714 Ga0373951_0000928
715 Ga0373952_0000354
716 Ga0373932_0000157
717 Ga0373941_0006216
718 Ga0373953_0138452
719 Ga0373954_0294501
720 Ga0373956_0018793
721 Ga0373957_0002093
722 Ga0373957_0055283
723 Ga0373960_0001327
724 Ga0373955_0026786
725 Ga0373942_0001220
726 Ga0373961_0011608
727 Ga0373962_0000383
728 Ga0373962_0050322
729 Ga0373933_0089753
730 Ga0373937_0006669
731 Ga0373937_1578431
732 Ga0436364_0057835
733 Ga0436364_0165195
734 Ga0436364_0356768
735 Ga0436364_0433388
736 Ga0436364_0679391
737 Ga0436365_0377850
738 Ga0436365_1062994
739 Ga0451847_0838511
740 Ga0451849_0177524
741 Ga0451851_0883595
742 Ga0451853_0508974
743 Ga0466961_0272822
744 Ga0453684_1191890
745 Ga0466970_0001303
746 Ga0451576_0009094
747 Ga0495580_0091824
748 Ga0495582_0265786
749 Ga0495594_0571991
750 Ga0495628_0777982
751 Ga0495630_0973768
752 Ga0495586_0182658
753 Ga0495586_0713674
754 Ga0495621_0014688
755 Ga0495622_0069357
756 Ga0495667_0716276
757 Ga0495668_0171416
758 Ga0495634_0198148
759 Ga0495647_0012343
760 Ga0495669_0310219
761 Ga0495604_0282591
762 Ga0495636_0190656
763 Ga0495674_0674640
764 Ga0495672_0155165
765 Ga0495680_0048569
766 Ga0495614_0271795
767 Ga0496100_0207435
768 Ga0496102_1002837
769 Ga0496104_0114116
770 Ga0496104_0498817
771 Ga0496105_0210648
772 Ga0496105_0330662
773 Ga0496106_0198783
774 Ga0496106_0230128
775 Ga0496112_0735238
776 Ga0501031_0004345
777 Ga0501032_0015325
778 Ga0501033_0003571
779 Ga0501034_0396902
780 Ga0501036_0000295
781 Ga0501036_0963089
782 Ga0501037_0014741
783 Ga0501038_0001014
784 Ga0501038_0570497
785 Ga0501039_0011021
786 Ga0501040_0461304
787 Ga0501042_0025063
788 Ga0501043_0002917
789 Ga0501046_0043368
790 Ga0501046_0332790
791 Ga0501067_0000758
792 Ga0501068_0000872
793 Ga0501069_0000735
794 Ga0501071_0485314
795 Ga0501072_0017997
796 Ga0501073_0001754
797 Ga0501073_0274909
798 Ga0501074_0254183
799 Ga0501076_0016369
800 Ga0501076_0299483
801 Ga0501077_0003719
802 Ga0501079_0001799
803 Ga0501079_0236031
804 Ga0501080_0000017
805 Ga0501080_0013562
806 Ga0501044_0038002
807 nmdc:mga0k408_215637_c1
808 nmdc:mga05p37_10784_c1
809 nmdc:mga05p37_1348394_c1
810 nmdc:mga05p37_624203_c1
811 nmdc:mga05p37_660994_c1
812 nmdc:mga08y16_1369_c1
813 nmdc:mga08y16_328049_c1
814 nmdc:mga08y16_4283_c1
815 nmdc:mga0n895_1059151_c1
816 nmdc:mga0n895_1882_c1
817 nmdc:mga0n895_214543_c1
818 nmdc:mga0rr50_19325_c1
819 nmdc:mga0rr50_26090_c1
820 nmdc:mga0rr50_47584_c1
821 nmdc:mga0rr50_720320_c1
822 nmdc:mga0rr50_76169_c1
823 nmdc:mga08x19_86488_c1
824 nmdc:mga0a205_787_c1
825 Ga0500635_0022780
826 Ga0495619_0574773
827 Ga0495619_0670812
828 Ga0500562_150236
829 Ga0500614_017155
830 Ga0501084_0010305
831 Ga0501084_0021065
832 Ga0501082_0029052
833 Ga0530510_0168134
834 Ga0530510_0451550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

74

187

0.77

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

64

177

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.855 25 146
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8429 25 154
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8252 25 154
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8142 20 152
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8142 25 154
ID Description Score Start End Superfamily
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8365 27 146 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8179 25 148 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7988 29 154 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7961 21 139 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7946 22 150 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9879 5 177
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9705 1 177
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9658 5 177
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9651 1 177
AF-A0A2V9XQP2-F1-model_v4 Polyketide cyclase 0.9644 1 181

Map