F438997

General Info

Members Datasets Scaffolds Average Seq Length
417 249 834 322

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100048706|Ga0070698_1000487065
Length 382
Sequence MGPGHRTRARRGVRTGVVHRVAAPPGAAGEAAGESVFSGPVGRYVSLVRAVVQDRYASPETLRVREVPTPVAGDGEVLVRVRAASVHPDVWHVVTGRPYVLRLMGAGLRRPKNRIPGTDMAGDVVAVGASVTRFRPGDEVFGETTMGHQWLNGGAFAEYVPVPQDALARKPGSVTFEQAAAVPTSGLLALNNLPRKHLRSGQRVLVNGAGGGVGGFAVQLAKAHGATVTGVDAAMKLAMVTSLGADRVIDYAREDFTQGGERYDLIFDVPGNHSFAECRRVLAPGGTYVWIGHDRFGAAAGRWLGSVPHGLRLVVMSRFVPQLPTVTFSRPGKKDLMAVLAGFLEAGKLTPVVDRTFPLSEVPQALRYLQEGRARGRIVITV

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
222 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
228 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
246 2808606448 Streptomyces sp. 193411 Isolate Unclassified
247 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
248 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
249 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.36
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100048706 3300005471 Bacteria 4330
2 Ga0070658_10291372 3300005327 Bacteria 1391
3 Ga0070683_100414192 3300005329 Unclassified 1285
4 Ga0070690_100012052 3300005330 Bacteria 5076
5 Ga0070670_100002059 3300005331 Bacteria 16467
6 Ga0068869_100098360 3300005334 Unclassified 2210
7 Ga0070666_10010930 3300005335 Bacteria 5688
8 Ga0068868_100002282 3300005338 Bacteria 13257
9 Ga0068868_100034627 3300005338 Unclassified 3899
10 Ga0068868_100160301 3300005338 Bacteria 1857
11 Ga0070689_100286751 3300005340 Bacteria 1367
12 Ga0070675_100014145 3300005354 Bacteria 6290
13 Ga0070675_100345866 3300005354 Bacteria 1318
14 Ga0070673_100003205 3300005364 Bacteria 10140
15 Ga0070673_100145169 3300005364 Bacteria 2005
16 Ga0070673_100422429 3300005364 Unclassified 1195
17 Ga0070667_100004279 3300005367 Bacteria 12054
18 Ga0070709_10022433 3300005434 Bacteria 3692
19 Ga0070709_10077376 3300005434 Unclassified 2162
20 Ga0070709_10184513 3300005434 Bacteria 1467
21 Ga0070709_10207699 3300005434 Bacteria 1390
22 Ga0070714_100000805 3300005435 Bacteria 22198
23 Ga0070714_100013839 3300005435 Bacteria 6469
24 Ga0070714_100355505 3300005435 Bacteria 1376
25 Ga0070714_100374731 3300005435 Bacteria 1341
26 Ga0070713_100037119 3300005436 Unclassified 3938
27 Ga0070713_100292872 3300005436 Bacteria 1496
28 Ga0070713_100346998 3300005436 Bacteria 1376
29 Ga0070710_10002137 3300005437 Bacteria 9369
30 Ga0070711_100257116 3300005439 Bacteria 1372
31 Ga0070708_100037511 3300005445 Bacteria 4229
32 Ga0070708_100053437 3300005445 Bacteria 3584
33 Ga0070685_10137879 3300005466 Unclassified 1532
34 Ga0070707_100013968 3300005468 Bacteria 7524
35 Ga0070707_100026542 3300005468 Bacteria 5500
36 Ga0070707_100198294 3300005468 Bacteria 1957
37 Ga0070698_100060695 3300005471 Bacteria 3815
38 Ga0070698_100061931 3300005471 Bacteria 3775
39 Ga0070698_100194228 3300005471 Bacteria 1967
40 Ga0070698_100238977 3300005471 Bacteria 1750
41 Ga0070699_100081519 3300005518 Archaea 2820
42 Ga0070699_100145036 3300005518 Bacteria 2097
43 Ga0070679_100050567 3300005530 Bacteria 4140
44 Ga0070684_100078710 3300005535 Bacteria 2913
45 Ga0070697_100055579 3300005536 Unclassified 3218
46 Ga0070697_100159612 3300005536 Unclassified 1904
47 Ga0070672_100216516 3300005543 Bacteria 1605
48 Ga0070686_100013113 3300005544 Bacteria 4733
49 Ga0070665_100276305 3300005548 Bacteria 1682
50 Ga0068856_100066566 3300005614 Bacteria 3560
51 Ga0068856_100139023 3300005614 Bacteria 2435
52 Ga0068859_100141138 3300005617 Bacteria 2483
53 Ga0068864_100022153 3300005618 Bacteria 5326
54 Ga0068864_100041193 3300005618 Unclassified 3951
55 Ga0068864_100153584 3300005618 Bacteria 2087
56 Ga0068863_100001362 3300005841 Bacteria 24306
57 Ga0068863_100130561 3300005841 Unclassified 2399
58 Ga0068858_100020020 3300005842 Bacteria 6257
59 Ga0081455_10130979 3300005937 Bacteria 1961
60 Ga0070717_10020938 3300006028 Bacteria 5149
61 Ga0070717_10062576 3300006028 Bacteria 3086
62 Ga0070717_10099499 3300006028 Bacteria 2467
63 Ga0070717_10107677 3300006028 Bacteria 2374
64 Ga0070717_10176496 3300006028 Bacteria 1860
65 Ga0070717_10257426 3300006028 Unclassified 1543
66 Ga0070715_10004284 3300006163 Bacteria 4658
67 Ga0070715_10043940 3300006163 Bacteria 1886
68 Ga0070716_100000988 3300006173 Bacteria 12405
69 Ga0070716_100003527 3300006173 Bacteria 7376
70 Ga0070716_100012104 3300006173 Bacteria 4362
71 Ga0070716_100036307 3300006173 Unclassified 2717
72 Ga0070716_100062751 3300006173 Bacteria 2155
73 Ga0070712_100023895 3300006175 Bacteria 4042
74 Ga0070712_100024412 3300006175 Bacteria 4006
75 Ga0070712_100064795 3300006175 Bacteria 2592
76 Ga0097621_100052414 3300006237 Unclassified 3324
77 Ga0075428_100213965 3300006844 Bacteria 2082
78 Ga0075430_100023455 3300006846 Bacteria 5253
79 Ga0075431_100009896 3300006847 Bacteria 9574
80 Ga0075429_100009499 3300006880 Bacteria 8439
81 Ga0075429_100027674 3300006880 Unclassified 4921
82 Ga0075429_100153680 3300006880 Bacteria 2015
83 Ga0097620_100141136 3300006931 Bacteria 2483
84 Ga0075435_100063568 3300007076 Bacteria 2998
85 Ga0105240_10180007 3300009093 Bacteria 2495
86 Ga0111539_10076839 3300009094 Bacteria 3931
87 Ga0111539_10105972 3300009094 Bacteria 3298
88 Ga0114129_10001178 3300009147 Bacteria 34683
89 Ga0114129_10063150 3300009147 Bacteria 5173
90 Ga0114129_10068631 3300009147 Bacteria 4943
91 Ga0114129_10078779 3300009147 Bacteria 4583
92 Ga0114129_10098726 3300009147 Bacteria 4042
93 Ga0114129_10185251 3300009147 Bacteria 2830
94 Ga0105248_10002102 3300009177 Bacteria 22067
95 Ga0105239_10656898 3300010375 Bacteria 1198
96 Ga0105246_10086950 3300011119 Unclassified 2242
97 Ga0105246_10123459 3300011119 Unclassified 1922
98 Ga0163162_10001234 3300013306 Bacteria 23888
99 Ga0157372_10130418 3300013307 Bacteria 2892
100 Ga0157375_10031852 3300013308 Bacteria 4994
101 Ga0163163_10016847 3300014325 Bacteria 6802
102 Ga0163163_10028128 3300014325 Bacteria 5394
103 Ga0163163_10076056 3300014325 Bacteria 3351
104 Ga0157377_10077886 3300014745 Unclassified 1931
105 Ga0157376_10143728 3300014969 Bacteria 2143
106 Ga0157376_10619924 3300014969 Bacteria 1079
107 Ga0183360_10001 3300015689 Bacteria 3943671
108 Ga0207692_10000678 3300025898 Bacteria 12026
109 Ga0207692_10040439 3300025898 Bacteria 2301
110 Ga0207680_10004493 3300025903 Bacteria 6618
111 Ga0207699_10013311 3300025906 Bacteria 4207
112 Ga0207699_10061198 3300025906 Bacteria 2264
113 Ga0207699_10068527 3300025906 Bacteria 2161
114 Ga0207699_10083802 3300025906 Unclassified 1984
115 Ga0207699_10233972 3300025906 Bacteria 1259
116 Ga0207705_10235674 3300025909 Bacteria 1393
117 Ga0207684_10089538 3300025910 Bacteria 2622
118 Ga0207684_10139459 3300025910 Bacteria 2084
119 Ga0207684_10340179 3300025910 Bacteria 1292
120 Ga0207693_10030393 3300025915 Bacteria 4266
121 Ga0207693_10080740 3300025915 Bacteria 2546
122 Ga0207693_10136929 3300025915 Unclassified 1925
123 Ga0207663_10021785 3300025916 Bacteria 3654
124 Ga0207663_10054980 3300025916 Bacteria 2495
125 Ga0207652_10193905 3300025921 Bacteria 1827
126 Ga0207646_10019949 3300025922 Bacteria 6219
127 Ga0207646_10093435 3300025922 Archaea 2693
128 Ga0207694_10090933 3300025924 Bacteria 2408
129 Ga0207650_10069066 3300025925 Bacteria 2654
130 Ga0207659_10002098 3300025926 Bacteria 11802
131 Ga0207659_10187922 3300025926 Bacteria 1642
132 Ga0207700_10000171 3300025928 Bacteria 38786
133 Ga0207700_10002722 3300025928 Bacteria 10193
134 Ga0207700_10004312 3300025928 Bacteria 8363
135 Ga0207700_10089007 3300025928 Bacteria 2432
136 Ga0207700_10101485 3300025928 Bacteria 2295
137 Ga0207700_10309277 3300025928 Bacteria 1366
138 Ga0207700_10379239 3300025928 Bacteria 1236
139 Ga0207664_10002296 3300025929 Bacteria 12621
140 Ga0207664_10018645 3300025929 Bacteria 5113
141 Ga0207664_10038582 3300025929 Bacteria 3705
142 Ga0207664_10061852 3300025929 Bacteria 2988
143 Ga0207644_10010812 3300025931 Bacteria 6024
144 Ga0207665_10001616 3300025939 Bacteria 15211
145 Ga0207665_10008850 3300025939 Bacteria 6609
146 Ga0207665_10017204 3300025939 Bacteria 4750
147 Ga0207665_10023432 3300025939 Bacteria 4068
148 Ga0207691_10100565 3300025940 Bacteria 2581
149 Ga0207689_10068356 3300025942 Bacteria 2920
150 Ga0207689_10114235 3300025942 Bacteria 2219
151 Ga0207661_10376307 3300025944 Bacteria 1285
152 Ga0207651_10470609 3300025960 Bacteria 1081
153 Ga0207658_10032958 3300025986 Unclassified 3692
154 Ga0207677_10000050 3300026023 Bacteria 100733
155 Ga0207702_10180898 3300026078 Bacteria 1942
156 Ga0207641_10056978 3300026088 Unclassified 3323
157 Ga0207641_10316292 3300026088 Bacteria 1479
158 Ga0207676_10003402 3300026095 Bacteria 11242
159 Ga0207676_10487079 3300026095 Unclassified 1169
160 Ga0207674_10395286 3300026116 Bacteria 1336
161 Ga0207675_100098642 3300026118 Bacteria 2751
162 Ga0207683_10041026 3300026121 Bacteria 4040
163 Ga0265319_1003294 3300028563 Bacteria 8489
164 Ga0307515_10081466 3300028794 Bacteria 4204
165 Ga0265332_10013091 3300031238 Bacteria 3677
166 Ga0265340_10009270 3300031247 Bacteria 5286
167 Ga0265316_10026071 3300031344 Bacteria 4870
168 Ga0307408_100150315 3300031548 Bacteria 1838
169 Ga0316575_10019031 3300031665 Bacteria 2621
170 Ga0316579_10000356 3300031691 Bacteria 14396
171 Ga0316579_10038348 3300031691 Bacteria 2215
172 Ga0265342_10016412 3300031712 Bacteria 4842
173 Ga0316576_10000265 3300031727 Bacteria 22779
174 Ga0316576_10002533 3300031727 Bacteria 10418
175 Ga0316576_10003993 3300031727 Bacteria 8769
176 Ga0316576_10023757 3300031727 Bacteria 4275
177 Ga0316576_10203392 3300031727 Archaea 1492
178 Ga0316578_10038048 3300031728 Bacteria 2773
179 Ga0307405_10008477 3300031731 Bacteria 5213
180 Ga0307410_10341842 3300031852 Bacteria 1193
181 Ga0307416_100057830 3300032002 Bacteria 3140
182 Ga0307414_10309224 3300032004 Bacteria 1341
183 Ga0307415_100099464 3300032126 Bacteria 2129
184 Ga0316583_10008766 3300032133 Bacteria 3649
185 Ga0316585_10004623 3300032137 Bacteria 3845
186 Ga0373926_0002508 3300035083 Bacteria 5824
187 Ga0373934_0004322 3300035086 Bacteria 5246
188 Ga0373934_0031616 3300035086 Bacteria 2073
189 Ga0373923_0007814 3300035111 Bacteria 3778
190 Ga0373923_0034494 3300035111 Bacteria 2054
191 Ga0373936_0002027 3300035113 Bacteria 7493
192 Ga0373945_0001532 3300035116 Bacteria 7071
193 Ga0373953_0000421 3300035117 Bacteria 11537
194 Ga0373953_0001114 3300035117 Bacteria 7606
195 Ga0373954_0014202 3300035118 Bacteria 3550
196 Ga0373956_0001991 3300035119 Bacteria 8466
197 Ga0373956_0043733 3300035119 Bacteria 1995
198 Ga0373957_0000144 3300035120 Bacteria 17836
199 Ga0373957_0032088 3300035120 Unclassified 1933
200 Ga0373943_0053360 3300035170 Bacteria 1996
201 Ga0373946_0000454 3300035171 Bacteria 13502
202 Ga0373946_0042222 3300035171 Bacteria 1874
203 Ga0373955_0000420 3300035172 Bacteria 17929
204 Ga0373955_0125900 3300035172 Bacteria 1493
205 Ga0373924_0033812 3300035410 Bacteria 2066
206 Ga0373924_0043811 3300035410 Bacteria 1838
207 Ga0373931_0073932 3300035691 Bacteria 1866
208 Ga0373935_0002642 3300035692 Bacteria 10297
209 Ga0373927_0009990 3300035695 Bacteria 6359
210 Ga0373933_0000169 3300035724 Bacteria 42826
211 Ga0373933_0213997 3300035724 Bacteria 1235
212 Ga0373933_0279082 3300035724 Bacteria 1079
213 Ga0373937_0001816 3300036401 Bacteria 17916
214 Ga0373937_0015076 3300036401 Bacteria 6828
215 Ga0373937_0041354 3300036401 Bacteria 4204
216 Ga0373937_0135501 3300036401 Bacteria 2302
217 Ga0373937_0287198 3300036401 Bacteria 1554
218 Ga0373937_0418680 3300036401 Bacteria 1271
219 Ga0316582_0049862 3300036647 Bacteria 2649
220 Ga0316584_0004697 3300036712 Bacteria 9056
221 Ga0373925_0101230 3300037068 Bacteria 2215
222 Ga0373925_0311846 3300037068 Bacteria 1272
223 Ga0395898_0046047 3300037466 Bacteria 4285
224 Ga0395898_0101962 3300037466 Bacteria 2756
225 Ga0316581_0012924 3300037588 Bacteria 2359
226 Ga0436364_1563566 3300037853 Bacteria 2990
227 Ga0395901_0012594 3300038443 Bacteria 8583
228 Ga0400484_27485 3300038725 Bacteria 2841
229 Ga0400483_066153 3300039062 Bacteria 5250
230 Ga0400483_163479 3300039062 Bacteria 11467
231 Ga0400483_275050 3300039062 Bacteria 7428
232 Ga0436362_1082278 3300039453 Bacteria 1292
233 Ga0439442_017641 3300042002 Bacteria 1473
234 Ga0439449_0086769 3300042007 Bacteria 1155
235 Ga0450907_029209 3300042146 Bacteria 936
236 Ga0439434_0047768 3300042435 Bacteria 1323
237 Ga0451577_0141496 3300042876 Bacteria 2162
238 Ga0451577_0143864 3300042876 Bacteria 2144
239 Ga0453683_0020768 3300044673 Bacteria 4196
240 Ga0451576_0010284 3300045051 Bacteria 10747
241 Ga0451576_0118269 3300045051 Bacteria 2759
242 Ga0495592_0001208 3300046454 Bacteria 17934
243 Ga0495603_0252875 3300046455 Bacteria 1014
244 Ga0495629_0018619 3300046459 Bacteria 4964
245 Ga0495629_0034117 3300046459 Bacteria 3597
246 Ga0495629_0135554 3300046459 Bacteria 1714
247 Ga0495641_0012938 3300046461 Bacteria 4626
248 Ga0495641_0019145 3300046461 Bacteria 3512
249 Ga0495651_0001519 3300046462 Bacteria 17944
250 Ga0495651_0121915 3300046462 Bacteria 1914
251 Ga0495653_0042513 3300046463 Bacteria 3539
252 Ga0495653_0110305 3300046463 Bacteria 1978
253 Ga0495580_0010814 3300046472 Bacteria 7085
254 Ga0495580_0032444 3300046472 Unclassified 3770
255 Ga0495582_0013719 3300046473 Bacteria 4461
256 Ga0495582_0020128 3300046473 Bacteria 3651
257 Ga0495662_0021778 3300046476 Bacteria 3097
258 Ga0495662_0060700 3300046476 Bacteria 1826
259 Ga0495664_0125438 3300046477 Bacteria 1553
260 Ga0495594_0018883 3300046499 Bacteria 3658
261 Ga0495608_0001287 3300046511 Bacteria 17813
262 Ga0495628_0004172 3300046516 Bacteria 12861
263 Ga0495630_0161589 3300046517 Bacteria 1705
264 Ga0495666_0014356 3300046526 Bacteria 3945
265 Ga0495666_0036842 3300046526 Bacteria 2381
266 Ga0495652_0008709 3300046529 Bacteria 9244
267 Ga0495652_0092185 3300046529 Bacteria 2475
268 Ga0495665_0004888 3300046531 Bacteria 7224
269 Ga0495665_0011964 3300046531 Bacteria 4697
270 Ga0495640_0062236 3300046533 Unclassified 2532
271 Ga0495587_0000934 3300046536 Bacteria 19235
272 Ga0495645_0082593 3300046543 Bacteria 2304
273 Ga0495622_0023711 3300046557 Bacteria 2862
274 Ga0495633_0036388 3300046558 Bacteria 2359
275 Ga0495667_0001051 3300046559 Bacteria 17934
276 Ga0495667_0010254 3300046559 Bacteria 6338
277 Ga0495656_0066328 3300046615 Bacteria 1590
278 Ga0495668_0001073 3300046616 Bacteria 28832
279 Ga0495634_0023577 3300046642 Bacteria 4322
280 Ga0495634_0029042 3300046642 Bacteria 3832
281 Ga0495634_0093566 3300046642 Bacteria 1949
282 Ga0495635_0029592 3300046663 Bacteria 3809
283 Ga0495635_0037054 3300046663 Bacteria 3377
284 Ga0495588_0063379 3300046674 Bacteria 1917
285 Ga0495657_0001875 3300046675 Bacteria 17880
286 Ga0495657_0023959 3300046675 Unclassified 4354
287 Ga0495657_0088493 3300046675 Bacteria 1990
288 Ga0495657_0188624 3300046675 Bacteria 1261
289 Ga0495599_0000780 3300046678 Bacteria 17939
290 Ga0495623_0001166 3300046679 Bacteria 17826
291 Ga0495623_0071533 3300046679 Bacteria 2158
292 Ga0495646_0022956 3300046680 Bacteria 3929
293 Ga0495646_0083816 3300046680 Bacteria 1852
294 Ga0495647_0003859 3300046681 Bacteria 4830
295 Ga0495647_0138141 3300046681 Unclassified 1038
296 Ga0495658_0048987 3300046683 Bacteria 2385
297 Ga0495613_0006315 3300046689 Bacteria 8864
298 Ga0495613_0062565 3300046689 Bacteria 2723
299 Ga0495613_0091806 3300046689 Bacteria 2199
300 Ga0495624_0043422 3300046690 Bacteria 2868
301 Ga0495600_0112600 3300046809 Bacteria 1772
302 Ga0495581_0008189 3300047315 Bacteria 6055
303 Ga0495581_0020866 3300047315 Bacteria 3801
304 Ga0495604_0001722 3300047317 Bacteria 17944
305 Ga0495674_0014367 3300047319 Bacteria 7414
306 Ga0495674_0020373 3300047319 Bacteria 6141
307 Ga0495674_0214238 3300047319 Bacteria 1594
308 Ga0495676_0056777 3300047321 Bacteria 3093
309 Ga0495680_0002692 3300047322 Bacteria 17940
310 Ga0495680_0031549 3300047322 Bacteria 4310
311 Ga0495675_0003553 3300047444 Bacteria 9399
312 Ga0495675_0032164 3300047444 Bacteria 3347
313 Ga0495684_0022931 3300047471 Bacteria 4802
314 Ga0495684_0218345 3300047471 Bacteria 1399
315 Ga0495593_0001396 3300047673 Bacteria 14125
316 Ga0495593_0014114 3300047673 Bacteria 4546
317 Ga0495602_0002762 3300048088 Bacteria 17934
318 Ga0495602_0027420 3300048088 Bacteria 5473
319 Ga0495614_0016282 3300048089 Bacteria 3237
320 Ga0495614_0017563 3300048089 Bacteria 3107
321 Ga0496101_0055273 3300048904 Bacteria 2867
322 Ga0496104_0011660 3300048907 Bacteria 7880
323 Ga0496104_0119821 3300048907 Bacteria 2526
324 Ga0496104_0216339 3300048907 Bacteria 1828
325 Ga0496105_0009212 3300048908 Bacteria 7709
326 Ga0496105_0104537 3300048908 Bacteria 2338
327 Ga0496107_0209369 3300048910 Bacteria 1450
328 Ga0496108_0137492 3300048911 Bacteria 2103
329 Ga0496112_0027024 3300048915 Bacteria 5532
330 Ga0496112_0131017 3300048915 Bacteria 2478
331 Ga0496113_0034571 3300048916 Bacteria 3688
332 Ga0496114_0047930 3300048917 Bacteria 3554
333 Ga0496115_0081282 3300048918 Bacteria 2639
334 Ga0496115_0171125 3300048918 Bacteria 1796
335 Ga0496125_0092952 3300048928 Bacteria 2253
336 Ga0501031_0001483 3300049568 Bacteria 14587
337 Ga0501032_0061152 3300049569 Bacteria 2525
338 Ga0501033_0021833 3300049570 Bacteria 4830
339 Ga0501034_0006251 3300049571 Bacteria 12818
340 Ga0501034_0011465 3300049571 Bacteria 9185
341 Ga0501034_0045258 3300049571 Bacteria 4447
342 Ga0501034_0085818 3300049571 Bacteria 3149
343 Ga0501036_0011096 3300049572 Bacteria 7451
344 Ga0501037_0015024 3300049573 Bacteria 5694
345 Ga0501039_0040826 3300049575 Bacteria 3581
346 Ga0501039_0195042 3300049575 Unclassified 1592
347 Ga0501039_0221526 3300049575 Bacteria 1487
348 Ga0501040_0012018 3300049576 Bacteria 5664
349 Ga0501041_0085600 3300049577 Unclassified 1944
350 Ga0501042_0006647 3300049578 Bacteria 7532
351 Ga0501043_0004657 3300049579 Bacteria 11118
352 Ga0501043_0115196 3300049579 Bacteria 2110
353 Ga0501046_0007880 3300049580 Bacteria 9334
354 Ga0501046_0054456 3300049580 Bacteria 3147
355 Ga0501046_0228648 3300049580 Bacteria 1375
356 Ga0501047_0015562 3300049581 Bacteria 7247
357 Ga0501047_0066692 3300049581 Bacteria 3469
358 Ga0501047_0346613 3300049581 Bacteria 1322
359 Ga0501048_0011702 3300049582 Bacteria 6544
360 Ga0501048_0011946 3300049582 Bacteria 6473
361 Ga0501048_0168426 3300049582 Bacteria 1551
362 Ga0501067_0041267 3300049583 Bacteria 2562
363 Ga0501067_0304992 3300049583 Bacteria 887
364 Ga0501070_0006400 3300049586 Bacteria 10019
365 Ga0501070_0081032 3300049586 Bacteria 2685
366 Ga0501071_0019527 3300049587 Bacteria 4703
367 Ga0501071_0048284 3300049587 Bacteria 3061
368 Ga0501072_0011909 3300049588 Bacteria 6642
369 Ga0501073_0106431 3300049589 Bacteria 1946
370 Ga0501073_0135028 3300049589 Bacteria 1710
371 Ga0501073_0158874 3300049589 Bacteria 1566
372 Ga0501074_0090721 3300049590 Bacteria 2188
373 Ga0501076_0028370 3300049592 Bacteria 4346
374 Ga0501222_009722 3300049662 Bacteria 1271
375 Ga0501223_005618 3300049663 Unclassified 2627
376 Ga0501224_003489 3300049664 Unclassified 2198
377 Ga0501235_000448 3300049669 Bacteria 8033
378 Ga0501253_002728 3300049683 Unclassified 2026
379 Ga0501261_006007 3300049690 Unclassified 1540
380 Ga0501079_0348305 3300049741 Bacteria 1160
381 Ga0501080_0070647 3300049742 Bacteria 3247
382 Ga0501081_0031828 3300049743 Bacteria 3575
383 Ga0501081_0367968 3300049743 Unclassified 1061
384 Ga0501083_0002725 3300049744 Bacteria 12202
385 Ga0501265_006171 3300049762 Bacteria 1393
386 Ga0501275_000013 3300049772 Bacteria 20392
387 Ga0501035_0078033 3300049822 Bacteria 2926
388 Ga0501044_0017605 3300049823 Bacteria 7664
389 Ga0501045_0041783 3300049824 Bacteria 3337
390 Ga0501045_0057877 3300049824 Bacteria 2837
391 nmdc:mga05p37_144157_c1 3300050507 Bacteria 2609
392 nmdc:mga05p37_150405_c1 3300050507 Unclassified 2848
393 nmdc:mga05p37_15579_c1 3300050507 Bacteria 9137
394 nmdc:mga05p37_1842_c1 3300050507 Bacteria 24712
395 nmdc:mga05p37_222067_c1 3300050507 Bacteria 2280
396 nmdc:mga09592_14723_c1 3300050508 Bacteria 6382
397 nmdc:mga09592_25541_c2 3300050508 Bacteria 3299
398 nmdc:mga0qj67_5997_c1 3300050509 Bacteria 8905
399 nmdc:mga08y16_127719_c1 3300050511 Bacteria 2644
400 nmdc:mga08y16_148369_c1 3300050511 Bacteria 2438
401 nmdc:mga0n895_20143_c1 3300050512 Bacteria 6214
402 nmdc:mga0n895_340981_c1 3300050512 Bacteria 1518
403 nmdc:mga0a205_98693_c1 3300050515 Unclassified 2819
404 Ga0495601_0006776 3300053077 Bacteria 6710
405 Ga0495612_0016919 3300053078 Bacteria 2921
406 Ga0495595_0057186 3300053084 Bacteria 1819
407 Ga0495619_0001594 3300053085 Bacteria 14900
408 Ga0495619_0055630 3300053085 Bacteria 2621
409 Ga0501084_0321016 3300054114 Bacteria 1308
410 Ga0590075_031697 3300059424 Unclassified 1341
411 Ga0501082_0023931 3300060353 Bacteria 5267
412 Ga0501082_0279916 3300060353 Unclassified 1452
413 2643735703 2643221543 Bacteria 6628015
414 2809236286 2808606448 Bacteria 8656184
415 2867352922 2867346516 Bacteria 7608576
416 2883071811 2883068021 Bacteria 6192739
417 8055070693 8055066027 Bacteria 9479577
418 Ga0070698_100048706
419 Ga0070658_10291372
420 Ga0070683_100414192
421 Ga0070690_100012052
422 Ga0070670_100002059
423 Ga0068869_100098360
424 Ga0070666_10010930
425 Ga0068868_100002282
426 Ga0068868_100034627
427 Ga0068868_100160301
428 Ga0070689_100286751
429 Ga0070675_100014145
430 Ga0070675_100345866
431 Ga0070673_100003205
432 Ga0070673_100145169
433 Ga0070673_100422429
434 Ga0070667_100004279
435 Ga0070709_10022433
436 Ga0070709_10077376
437 Ga0070709_10184513
438 Ga0070709_10207699
439 Ga0070714_100000805
440 Ga0070714_100013839
441 Ga0070714_100355505
442 Ga0070714_100374731
443 Ga0070713_100037119
444 Ga0070713_100292872
445 Ga0070713_100346998
446 Ga0070710_10002137
447 Ga0070711_100257116
448 Ga0070708_100037511
449 Ga0070708_100053437
450 Ga0070685_10137879
451 Ga0070707_100013968
452 Ga0070707_100026542
453 Ga0070707_100198294
454 Ga0070698_100060695
455 Ga0070698_100061931
456 Ga0070698_100194228
457 Ga0070698_100238977
458 Ga0070699_100081519
459 Ga0070699_100145036
460 Ga0070679_100050567
461 Ga0070684_100078710
462 Ga0070697_100055579
463 Ga0070697_100159612
464 Ga0070672_100216516
465 Ga0070686_100013113
466 Ga0070665_100276305
467 Ga0068856_100066566
468 Ga0068856_100139023
469 Ga0068859_100141138
470 Ga0068864_100022153
471 Ga0068864_100041193
472 Ga0068864_100153584
473 Ga0068863_100001362
474 Ga0068863_100130561
475 Ga0068858_100020020
476 Ga0081455_10130979
477 Ga0070717_10020938
478 Ga0070717_10062576
479 Ga0070717_10099499
480 Ga0070717_10107677
481 Ga0070717_10176496
482 Ga0070717_10257426
483 Ga0070715_10004284
484 Ga0070715_10043940
485 Ga0070716_100000988
486 Ga0070716_100003527
487 Ga0070716_100012104
488 Ga0070716_100036307
489 Ga0070716_100062751
490 Ga0070712_100023895
491 Ga0070712_100024412
492 Ga0070712_100064795
493 Ga0097621_100052414
494 Ga0075428_100213965
495 Ga0075430_100023455
496 Ga0075431_100009896
497 Ga0075429_100009499
498 Ga0075429_100027674
499 Ga0075429_100153680
500 Ga0097620_100141136
501 Ga0075435_100063568
502 Ga0105240_10180007
503 Ga0111539_10076839
504 Ga0111539_10105972
505 Ga0114129_10001178
506 Ga0114129_10063150
507 Ga0114129_10068631
508 Ga0114129_10078779
509 Ga0114129_10098726
510 Ga0114129_10185251
511 Ga0105248_10002102
512 Ga0105239_10656898
513 Ga0105246_10086950
514 Ga0105246_10123459
515 Ga0163162_10001234
516 Ga0157372_10130418
517 Ga0157375_10031852
518 Ga0163163_10016847
519 Ga0163163_10028128
520 Ga0163163_10076056
521 Ga0157377_10077886
522 Ga0157376_10143728
523 Ga0157376_10619924
524 Ga0183360_10001
525 Ga0207692_10000678
526 Ga0207692_10040439
527 Ga0207680_10004493
528 Ga0207699_10013311
529 Ga0207699_10061198
530 Ga0207699_10068527
531 Ga0207699_10083802
532 Ga0207699_10233972
533 Ga0207705_10235674
534 Ga0207684_10089538
535 Ga0207684_10139459
536 Ga0207684_10340179
537 Ga0207693_10030393
538 Ga0207693_10080740
539 Ga0207693_10136929
540 Ga0207663_10021785
541 Ga0207663_10054980
542 Ga0207652_10193905
543 Ga0207646_10019949
544 Ga0207646_10093435
545 Ga0207694_10090933
546 Ga0207650_10069066
547 Ga0207659_10002098
548 Ga0207659_10187922
549 Ga0207700_10000171
550 Ga0207700_10002722
551 Ga0207700_10004312
552 Ga0207700_10089007
553 Ga0207700_10101485
554 Ga0207700_10309277
555 Ga0207700_10379239
556 Ga0207664_10002296
557 Ga0207664_10018645
558 Ga0207664_10038582
559 Ga0207664_10061852
560 Ga0207644_10010812
561 Ga0207665_10001616
562 Ga0207665_10008850
563 Ga0207665_10017204
564 Ga0207665_10023432
565 Ga0207691_10100565
566 Ga0207689_10068356
567 Ga0207689_10114235
568 Ga0207661_10376307
569 Ga0207651_10470609
570 Ga0207658_10032958
571 Ga0207677_10000050
572 Ga0207702_10180898
573 Ga0207641_10056978
574 Ga0207641_10316292
575 Ga0207676_10003402
576 Ga0207676_10487079
577 Ga0207674_10395286
578 Ga0207675_100098642
579 Ga0207683_10041026
580 Ga0265319_1003294
581 Ga0307515_10081466
582 Ga0265332_10013091
583 Ga0265340_10009270
584 Ga0265316_10026071
585 Ga0307408_100150315
586 Ga0316575_10019031
587 Ga0316579_10000356
588 Ga0316579_10038348
589 Ga0265342_10016412
590 Ga0316576_10000265
591 Ga0316576_10002533
592 Ga0316576_10003993
593 Ga0316576_10023757
594 Ga0316576_10203392
595 Ga0316578_10038048
596 Ga0307405_10008477
597 Ga0307410_10341842
598 Ga0307416_100057830
599 Ga0307414_10309224
600 Ga0307415_100099464
601 Ga0316583_10008766
602 Ga0316585_10004623
603 Ga0373926_0002508
604 Ga0373934_0004322
605 Ga0373934_0031616
606 Ga0373923_0007814
607 Ga0373923_0034494
608 Ga0373936_0002027
609 Ga0373945_0001532
610 Ga0373953_0000421
611 Ga0373953_0001114
612 Ga0373954_0014202
613 Ga0373956_0001991
614 Ga0373956_0043733
615 Ga0373957_0000144
616 Ga0373957_0032088
617 Ga0373943_0053360
618 Ga0373946_0000454
619 Ga0373946_0042222
620 Ga0373955_0000420
621 Ga0373955_0125900
622 Ga0373924_0033812
623 Ga0373924_0043811
624 Ga0373931_0073932
625 Ga0373935_0002642
626 Ga0373927_0009990
627 Ga0373933_0000169
628 Ga0373933_0213997
629 Ga0373933_0279082
630 Ga0373937_0001816
631 Ga0373937_0015076
632 Ga0373937_0041354
633 Ga0373937_0135501
634 Ga0373937_0287198
635 Ga0373937_0418680
636 Ga0316582_0049862
637 Ga0316584_0004697
638 Ga0373925_0101230
639 Ga0373925_0311846
640 Ga0395898_0046047
641 Ga0395898_0101962
642 Ga0316581_0012924
643 Ga0436364_1563566
644 Ga0395901_0012594
645 Ga0400484_27485
646 Ga0400483_066153
647 Ga0400483_163479
648 Ga0400483_275050
649 Ga0436362_1082278
650 Ga0439442_017641
651 Ga0439449_0086769
652 Ga0450907_029209
653 Ga0439434_0047768
654 Ga0451577_0141496
655 Ga0451577_0143864
656 Ga0453683_0020768
657 Ga0451576_0010284
658 Ga0451576_0118269
659 Ga0495592_0001208
660 Ga0495603_0252875
661 Ga0495629_0018619
662 Ga0495629_0034117
663 Ga0495629_0135554
664 Ga0495641_0012938
665 Ga0495641_0019145
666 Ga0495651_0001519
667 Ga0495651_0121915
668 Ga0495653_0042513
669 Ga0495653_0110305
670 Ga0495580_0010814
671 Ga0495580_0032444
672 Ga0495582_0013719
673 Ga0495582_0020128
674 Ga0495662_0021778
675 Ga0495662_0060700
676 Ga0495664_0125438
677 Ga0495594_0018883
678 Ga0495608_0001287
679 Ga0495628_0004172
680 Ga0495630_0161589
681 Ga0495666_0014356
682 Ga0495666_0036842
683 Ga0495652_0008709
684 Ga0495652_0092185
685 Ga0495665_0004888
686 Ga0495665_0011964
687 Ga0495640_0062236
688 Ga0495587_0000934
689 Ga0495645_0082593
690 Ga0495622_0023711
691 Ga0495633_0036388
692 Ga0495667_0001051
693 Ga0495667_0010254
694 Ga0495656_0066328
695 Ga0495668_0001073
696 Ga0495634_0023577
697 Ga0495634_0029042
698 Ga0495634_0093566
699 Ga0495635_0029592
700 Ga0495635_0037054
701 Ga0495588_0063379
702 Ga0495657_0001875
703 Ga0495657_0023959
704 Ga0495657_0088493
705 Ga0495657_0188624
706 Ga0495599_0000780
707 Ga0495623_0001166
708 Ga0495623_0071533
709 Ga0495646_0022956
710 Ga0495646_0083816
711 Ga0495647_0003859
712 Ga0495647_0138141
713 Ga0495658_0048987
714 Ga0495613_0006315
715 Ga0495613_0062565
716 Ga0495613_0091806
717 Ga0495624_0043422
718 Ga0495600_0112600
719 Ga0495581_0008189
720 Ga0495581_0020866
721 Ga0495604_0001722
722 Ga0495674_0014367
723 Ga0495674_0020373
724 Ga0495674_0214238
725 Ga0495676_0056777
726 Ga0495680_0002692
727 Ga0495680_0031549
728 Ga0495675_0003553
729 Ga0495675_0032164
730 Ga0495684_0022931
731 Ga0495684_0218345
732 Ga0495593_0001396
733 Ga0495593_0014114
734 Ga0495602_0002762
735 Ga0495602_0027420
736 Ga0495614_0016282
737 Ga0495614_0017563
738 Ga0496101_0055273
739 Ga0496104_0011660
740 Ga0496104_0119821
741 Ga0496104_0216339
742 Ga0496105_0009212
743 Ga0496105_0104537
744 Ga0496107_0209369
745 Ga0496108_0137492
746 Ga0496112_0027024
747 Ga0496112_0131017
748 Ga0496113_0034571
749 Ga0496114_0047930
750 Ga0496115_0081282
751 Ga0496115_0171125
752 Ga0496125_0092952
753 Ga0501031_0001483
754 Ga0501032_0061152
755 Ga0501033_0021833
756 Ga0501034_0006251
757 Ga0501034_0011465
758 Ga0501034_0045258
759 Ga0501034_0085818
760 Ga0501036_0011096
761 Ga0501037_0015024
762 Ga0501039_0040826
763 Ga0501039_0195042
764 Ga0501039_0221526
765 Ga0501040_0012018
766 Ga0501041_0085600
767 Ga0501042_0006647
768 Ga0501043_0004657
769 Ga0501043_0115196
770 Ga0501046_0007880
771 Ga0501046_0054456
772 Ga0501046_0228648
773 Ga0501047_0015562
774 Ga0501047_0066692
775 Ga0501047_0346613
776 Ga0501048_0011702
777 Ga0501048_0011946
778 Ga0501048_0168426
779 Ga0501067_0041267
780 Ga0501067_0304992
781 Ga0501070_0006400
782 Ga0501070_0081032
783 Ga0501071_0019527
784 Ga0501071_0048284
785 Ga0501072_0011909
786 Ga0501073_0106431
787 Ga0501073_0135028
788 Ga0501073_0158874
789 Ga0501074_0090721
790 Ga0501076_0028370
791 Ga0501222_009722
792 Ga0501223_005618
793 Ga0501224_003489
794 Ga0501235_000448
795 Ga0501253_002728
796 Ga0501261_006007
797 Ga0501079_0348305
798 Ga0501080_0070647
799 Ga0501081_0031828
800 Ga0501081_0367968
801 Ga0501083_0002725
802 Ga0501265_006171
803 Ga0501275_000013
804 Ga0501035_0078033
805 Ga0501044_0017605
806 Ga0501045_0041783
807 Ga0501045_0057877
808 nmdc:mga05p37_144157_c1
809 nmdc:mga05p37_150405_c1
810 nmdc:mga05p37_15579_c1
811 nmdc:mga05p37_1842_c1
812 nmdc:mga05p37_222067_c1
813 nmdc:mga09592_14723_c1
814 nmdc:mga09592_25541_c2
815 nmdc:mga0qj67_5997_c1
816 nmdc:mga08y16_127719_c1
817 nmdc:mga08y16_148369_c1
818 nmdc:mga0n895_20143_c1
819 nmdc:mga0n895_340981_c1
820 nmdc:mga0a205_98693_c1
821 Ga0495601_0006776
822 Ga0495612_0016919
823 Ga0495595_0057186
824 Ga0495619_0001594
825 Ga0495619_0055630
826 Ga0501084_0321016
827 Ga0590075_031697
828 Ga0501082_0023931
829 Ga0501082_0279916
830 2643735703
831 2809236286
832 2867352922
833 2883071811
834 8055070693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

212

303

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

73

172

0.85

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

243

380

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9007 1 319
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8964 1 319
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8937 1 319
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8899 1 319
5doz-assembly1.cif.gz_A crystal structure of jamj enoyl reductase (nadph bound) 0.8867 2 318
ID Description Score Start End Superfamily
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9498 144 178 3.50.50.60
af_Q75JT6_127_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9136 133 237 3.40.50.720
af_P96826_1_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9091 1 127 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9074 1 124 3.90.180.10
af_O74489_2_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9068 2 131 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4Q2JFA4-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9793 1 180 GO:0003723
GO:0008270
GO:0016491
AF-A0A534MG64-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9768 67 317 GO:0008270
GO:0016491
AF-A0A7W3T1W3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9707 1 136
AF-A0A7W0L208-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9675 1 148 GO:0016491
AF-A0A661TMC0-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9646 1 213 GO:0008270
GO:0016491

Map