F438995

General Info

Members Datasets Scaffolds Average Seq Length
417 183 834 296

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100164284|Ga0070707_1001642841
Length 314
Sequence MRRYGSPANDTKTYRMKTRIAFFGVLALVLSAFFLVQIQTADSSSIIVGRSTGDSLDERVKAEITSFKGKVSLFAKNLDTGETYGLNADDRVRTASTIKIAVMVEAFARVAEDKAKWTDELVLTKEKKVSGSGVLQELSDGLHLTLRDGVNLMMLVSDNTATNLVLDVLTTDAVNARMETLGFKQIKILRKVGSGGDSMAGKEVDNKKFGLGFATPREMVMLMEKLERGEVINRVEQDHFAIGRAMWDVPMATKYGALDRLRSAVGIIYSKKGRIAMAITCDDIPEINWSVDNPAYLLISDLSKTLSDGLASRN

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.16
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 20.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100164284 3300005468 Bacteria 2163
2 SwRhRL2b_contig_3636584 2162886007 Unclassified 1630
3 CNAas_1001112 3300000532 Bacteria 2448
4 JGI24751J29686_10000178 3300002459 Bacteria 29196
5 JGI25406J46586_10005411 3300003203 Bacteria 5923
6 Ga0065714_10002184 3300005288 Bacteria 284511
7 Ga0065704_10075442 3300005289 Bacteria 5587
8 Ga0065712_10067743 3300005290 Bacteria 71369
9 Ga0065712_10068981 3300005290 Bacteria 8377
10 Ga0065715_10089027 3300005293 Bacteria 16329
11 Ga0065715_10090844 3300005293 Bacteria 6375
12 Ga0065715_10131648 3300005293 Unclassified 2004
13 Ga0065715_10148964 3300005293 Archaea 1752
14 Ga0065707_10011335 3300005295 Unclassified 2478
15 Ga0065707_10086143 3300005295 Bacteria 5631
16 Ga0065707_10099036 3300005295 Bacteria 3024
17 Ga0065707_10194441 3300005295 Bacteria 1343
18 Ga0070676_10161693 3300005328 Bacteria 1442
19 Ga0070676_10169430 3300005328 Bacteria 1411
20 Ga0070683_100190680 3300005329 Unclassified 1946
21 Ga0070690_100023567 3300005330 Bacteria 3775
22 Ga0070690_100084979 3300005330 Bacteria 2075
23 Ga0070670_100002311 3300005331 Bacteria 15721
24 Ga0070670_100018613 3300005331 Bacteria 5951
25 Ga0068869_100115142 3300005334 Unclassified 2050
26 Ga0068869_100226021 3300005334 Bacteria 1485
27 Ga0070680_100001815 3300005336 Bacteria 15671
28 Ga0070682_100005888 3300005337 Bacteria 6853
29 Ga0070682_100069515 3300005337 Bacteria 2248
30 Ga0068868_100039236 3300005338 Bacteria 3679
31 Ga0068868_100144305 3300005338 Bacteria 1956
32 Ga0070689_100000257 3300005340 Bacteria 30560
33 Ga0070689_100128953 3300005340 Unclassified 2027
34 Ga0070687_100015895 3300005343 Unclassified 3415
35 Ga0070687_100298253 3300005343 Bacteria 1021
36 Ga0070661_100411099 3300005344 Bacteria 1071
37 Ga0070692_10016942 3300005345 Bacteria 3474
38 Ga0070692_10051221 3300005345 Bacteria 2146
39 Ga0070692_10122669 3300005345 Bacteria 1451
40 Ga0070668_100008901 3300005347 Bacteria 7453
41 Ga0070669_100035238 3300005353 Bacteria 3625
42 Ga0070675_100023022 3300005354 Bacteria 4977
43 Ga0070671_100000663 3300005355 Bacteria 24729
44 Ga0070671_100051858 3300005355 Bacteria 3412
45 Ga0070671_100080798 3300005355 Bacteria 2718
46 Ga0070673_100305455 3300005364 Bacteria 1402
47 Ga0070688_100304653 3300005365 Bacteria 1153
48 Ga0070659_100014220 3300005366 Bacteria 5942
49 Ga0070659_100340831 3300005366 Unclassified 1256
50 Ga0070667_100090852 3300005367 Bacteria 2625
51 Ga0070667_100331590 3300005367 Bacteria 1375
52 Ga0070703_10005183 3300005406 Bacteria 3642
53 Ga0070703_10029264 3300005406 Bacteria 1652
54 Ga0070701_10070514 3300005438 Bacteria 1867
55 Ga0070705_100000748 3300005440 Bacteria 18444
56 Ga0070705_100007600 3300005440 Bacteria 5341
57 Ga0070705_100158053 3300005440 Bacteria 1512
58 Ga0070700_100000369 3300005441 Bacteria 23087
59 Ga0070700_100003825 3300005441 Archaea 7798
60 Ga0070700_100007799 3300005441 Bacteria 5803
61 Ga0070700_100134804 3300005441 Bacteria 1671
62 Ga0070694_100046377 3300005444 Bacteria 2917
63 Ga0070694_100064705 3300005444 Bacteria 2504
64 Ga0070694_100079745 3300005444 Bacteria 2273
65 Ga0070694_100164738 3300005444 Bacteria 1629
66 Ga0070694_100303026 3300005444 Bacteria 1225
67 Ga0070708_100001006 3300005445 Bacteria 21546
68 Ga0070708_100392951 3300005445 Unclassified 1308
69 Ga0070663_100355570 3300005455 Unclassified 1187
70 Ga0070681_10000153 3300005458 Bacteria 52587
71 Ga0070681_10002513 3300005458 Bacteria 16815
72 Ga0070681_10024354 3300005458 Bacteria 6093
73 Ga0068867_100008598 3300005459 Bacteria 7207
74 Ga0068867_100389501 3300005459 Bacteria 1173
75 Ga0070706_100000509 3300005467 Bacteria 45647
76 Ga0070706_100009054 3300005467 Bacteria 9267
77 Ga0070706_100036447 3300005467 Bacteria 4543
78 Ga0070706_100196342 3300005467 Bacteria 1885
79 Ga0070707_100000217 3300005468 Bacteria 57586
80 Ga0070707_100005454 3300005468 Bacteria 11893
81 Ga0070707_100161190 3300005468 Bacteria 2186
82 Ga0070707_100209317 3300005468 Bacteria 1901
83 Ga0070707_100227597 3300005468 Unclassified 1816
84 Ga0070698_100014260 3300005471 Bacteria 8403
85 Ga0070698_100024925 3300005471 Bacteria 6235
86 Ga0070698_100104305 3300005471 Bacteria 2805
87 Ga0070698_100478393 3300005471 Bacteria 1182
88 Ga0070699_100002005 3300005518 Bacteria 18382
89 Ga0070699_100003132 3300005518 Bacteria 14641
90 Ga0070699_100028842 3300005518 Bacteria 4785
91 Ga0070699_100197545 3300005518 Bacteria 1788
92 Ga0070679_100000028 3300005530 Bacteria 113940
93 Ga0070679_100015165 3300005530 Bacteria 7405
94 Ga0070679_100107759 3300005530 Unclassified 2772
95 Ga0070679_100681035 3300005530 Unclassified 971
96 Ga0070697_100005050 3300005536 Bacteria 10135
97 Ga0070697_100009797 3300005536 Bacteria 7471
98 Ga0070697_100017045 3300005536 Bacteria 5714
99 Ga0070697_100052940 3300005536 Bacteria 3299
100 Ga0070697_100162607 3300005536 Unclassified 1886
101 Ga0068853_100032137 3300005539 Bacteria 4444
102 Ga0068853_100052940 3300005539 Bacteria 3495
103 Ga0070672_100138521 3300005543 Bacteria 2005
104 Ga0070686_100017017 3300005544 Bacteria 4240
105 Ga0070686_100021391 3300005544 Bacteria 3845
106 Ga0070695_100052956 3300005545 Bacteria 2610
107 Ga0070695_100087185 3300005545 Bacteria 2076
108 Ga0070695_100127497 3300005545 Bacteria 1750
109 Ga0070695_100159059 3300005545 Bacteria 1584
110 Ga0070695_100168461 3300005545 Bacteria 1544
111 Ga0070695_100401923 3300005545 Unclassified 1039
112 Ga0070695_100469326 3300005545 Bacteria 968
113 Ga0070696_100038044 3300005546 Unclassified 3320
114 Ga0070693_100002811 3300005547 Bacteria 8010
115 Ga0070693_100003464 3300005547 Bacteria 7365
116 Ga0070693_100007842 3300005547 Bacteria 5236
117 Ga0070693_100018525 3300005547 Bacteria 3639
118 Ga0070693_100069814 3300005547 Bacteria 2066
119 Ga0070704_100000533 3300005549 Bacteria 18250
120 Ga0070704_100237970 3300005549 Bacteria 1489
121 Ga0068855_100620852 3300005563 Bacteria 1164
122 Ga0070664_100015653 3300005564 Bacteria 6206
123 Ga0070664_100237298 3300005564 Bacteria 1636
124 Ga0070664_100312289 3300005564 Bacteria 1423
125 Ga0068857_100019211 3300005577 Bacteria 5999
126 Ga0068857_100099984 3300005577 Bacteria 2602
127 Ga0068857_100213170 3300005577 Unclassified 1762
128 Ga0068854_100045790 3300005578 Bacteria 3112
129 Ga0068854_100188608 3300005578 Bacteria 1614
130 Ga0068854_100241104 3300005578 Bacteria 1440
131 Ga0068856_100126239 3300005614 Bacteria 2562
132 Ga0070702_100001801 3300005615 Bacteria 8907
133 Ga0070702_100025433 3300005615 Bacteria 3172
134 Ga0070702_100040331 3300005615 Bacteria 2611
135 Ga0070702_100103229 3300005615 Bacteria 1753
136 Ga0068859_100004672 3300005617 Bacteria 13948
137 Ga0068859_100014913 3300005617 Bacteria 7803
138 Ga0068859_100031014 3300005617 Bacteria 5365
139 Ga0068859_100067299 3300005617 Unclassified 3616
140 Ga0068859_100073750 3300005617 Bacteria 3451
141 Ga0068859_100259003 3300005617 Bacteria 1830
142 Ga0068859_100442695 3300005617 Bacteria 1396
143 Ga0068864_100005046 3300005618 Bacteria 10812
144 Ga0068864_100065423 3300005618 Bacteria 3154
145 Ga0068864_100118587 3300005618 Bacteria 2363
146 Ga0068864_100159695 3300005618 Unclassified 2048
147 Ga0068864_100165511 3300005618 Archaea 2013
148 Ga0068864_100393845 3300005618 Bacteria 1315
149 Ga0068866_10065322 3300005718 Unclassified 1903
150 Ga0068866_10078677 3300005718 Unclassified 1765
151 Ga0068861_100162390 3300005719 Unclassified 1844
152 Ga0068851_10002130 3300005834 Bacteria 8693
153 Ga0068870_10005626 3300005840 Bacteria 5480
154 Ga0068870_10070533 3300005840 Unclassified 1904
155 Ga0068863_100036553 3300005841 Unclassified 4678
156 Ga0068863_100067278 3300005841 Unclassified 3388
157 Ga0068863_100072549 3300005841 Unclassified 3257
158 Ga0068858_100025844 3300005842 Bacteria 5461
159 Ga0068858_100082242 3300005842 Bacteria 2993
160 Ga0068858_100150102 3300005842 Bacteria 2191
161 Ga0068858_100211227 3300005842 Bacteria 1836
162 Ga0068858_100419674 3300005842 Bacteria 1287
163 Ga0068858_100555542 3300005842 Bacteria 1111
164 Ga0068860_100055054 3300005843 Bacteria 3781
165 Ga0068860_100238505 3300005843 Unclassified 1768
166 Ga0068862_100039156 3300005844 Unclassified 4024
167 Ga0068862_100073807 3300005844 Bacteria 2948
168 Ga0081540_1049651 3300005983 Unclassified 2092
169 Ga0081539_10001697 3300005985 Bacteria 35528
170 Ga0070716_100012013 3300006173 Unclassified 4376
171 Ga0097621_100006435 3300006237 Bacteria 8338
172 Ga0097621_100059964 3300006237 Bacteria 3117
173 Ga0097621_100061727 3300006237 Bacteria 3074
174 Ga0068871_100003543 3300006358 Bacteria 10739
175 Ga0068871_100029337 3300006358 Bacteria 4319
176 Ga0068871_100125162 3300006358 Bacteria 2175
177 Ga0075428_100187828 3300006844 Bacteria 2235
178 Ga0075428_100439160 3300006844 Bacteria 1398
179 Ga0075433_10042358 3300006852 Unclassified 3950
180 Ga0075433_10061461 3300006852 Bacteria 3290
181 Ga0075433_10228792 3300006852 Unclassified 1651
182 Ga0075434_100259039 3300006871 Bacteria 1758
183 Ga0075434_100349439 3300006871 Bacteria 1500
184 Ga0075434_100413572 3300006871 Bacteria 1370
185 Ga0075429_100126903 3300006880 Bacteria 2231
186 Ga0097620_100004673 3300006931 Bacteria 13948
187 Ga0097620_100014912 3300006931 Bacteria 7803
188 Ga0097620_100031014 3300006931 Bacteria 5365
189 Ga0097620_100067302 3300006931 Unclassified 3616
190 Ga0097620_100073750 3300006931 Bacteria 3451
191 Ga0097620_100119696 3300006931 Bacteria 2700
192 Ga0097620_100258994 3300006931 Bacteria 1830
193 Ga0097620_100442680 3300006931 Bacteria 1396
194 Ga0075435_100067499 3300007076 Bacteria 2912
195 Ga0105240_10033365 3300009093 Bacteria 6651
196 Ga0105240_10171784 3300009093 Bacteria 2567
197 Ga0105240_10453790 3300009093 Bacteria 1434
198 Ga0111539_10004288 3300009094 Bacteria 18652
199 Ga0111539_10043081 3300009094 Bacteria 5414
200 Ga0105245_10032970 3300009098 Bacteria 4586
201 Ga0105247_10006656 3300009101 Bacteria 7134
202 Ga0114129_10015644 3300009147 Bacteria 10789
203 Ga0114129_10052809 3300009147 Bacteria 5703
204 Ga0114129_10949664 3300009147 Unclassified 1086
205 Ga0105243_10026433 3300009148 Bacteria 4442
206 Ga0105243_10038459 3300009148 Bacteria 3726
207 Ga0105243_10115830 3300009148 Bacteria 2251
208 Ga0105243_10222146 3300009148 Unclassified 1671
209 Ga0105243_10639920 3300009148 Unclassified 1029
210 Ga0105241_10017062 3300009174 Bacteria 5331
211 Ga0105242_10004496 3300009176 Bacteria 10834
212 Ga0105248_10003659 3300009177 Bacteria 17054
213 Ga0105248_10582963 3300009177 Bacteria 1262
214 Ga0105237_10004546 3300009545 Bacteria 16029
215 Ga0105237_10058515 3300009545 Unclassified 3857
216 Ga0105237_10393521 3300009545 Bacteria 1390
217 Ga0105238_10005175 3300009551 Bacteria 12889
218 Ga0105238_10474377 3300009551 Bacteria 1250
219 Ga0105249_10000956 3300009553 Bacteria 25551
220 Ga0105249_10028452 3300009553 Bacteria 5044
221 Ga0105249_10067444 3300009553 Bacteria 3296
222 Ga0105249_10126127 3300009553 Bacteria 2438
223 Ga0105249_10175043 3300009553 Bacteria 2084
224 Ga0105239_10021414 3300010375 Bacteria 7127
225 Ga0105239_10215391 3300010375 Bacteria 2153
226 Ga0105239_10537574 3300010375 Bacteria 1330
227 Ga0105246_10072764 3300011119 Bacteria 2424
228 Ga0105246_10081191 3300011119 Unclassified 2310
229 Ga0105246_10291601 3300011119 Unclassified 1313
230 Ga0157373_10003104 3300013100 Bacteria 12551
231 Ga0157373_10027866 3300013100 Bacteria 4075
232 Ga0157374_10233812 3300013296 Bacteria 1806
233 Ga0157374_10425974 3300013296 Bacteria 1326
234 Ga0157378_10010173 3300013297 Bacteria 8205
235 Ga0157378_10034234 3300013297 Bacteria 4492
236 Ga0157378_10098269 3300013297 Bacteria 2669
237 Ga0163162_10000006 3300013306 Bacteria 410012
238 Ga0163162_10007137 3300013306 Bacteria 10844
239 Ga0163162_10159799 3300013306 Unclassified 2375
240 Ga0163162_10173821 3300013306 Bacteria 2279
241 Ga0163162_10270996 3300013306 Bacteria 1829
242 Ga0163162_10318903 3300013306 Bacteria 1687
243 Ga0163162_10388130 3300013306 Unclassified 1529
244 Ga0163162_10390058 3300013306 Bacteria 1525
245 Ga0157372_10012879 3300013307 Bacteria 8916
246 Ga0157372_10656376 3300013307 Bacteria 1221
247 Ga0157375_10148361 3300013308 Bacteria 2478
248 Ga0157375_10189068 3300013308 Bacteria 2213
249 Ga0163163_10001852 3300014325 Bacteria 17859
250 Ga0163163_10018967 3300014325 Bacteria 6453
251 Ga0163163_10058734 3300014325 Unclassified 3804
252 Ga0163163_10127484 3300014325 Bacteria 2583
253 Ga0163163_10199573 3300014325 Archaea 2049
254 Ga0163163_10205846 3300014325 Bacteria 2016
255 Ga0163163_10564276 3300014325 Bacteria 1201
256 Ga0157380_10013345 3300014326 Bacteria 5988
257 Ga0157380_10013769 3300014326 Bacteria 5905
258 Ga0157380_10765445 3300014326 Bacteria 979
259 Ga0157377_10070335 3300014745 Unclassified 2021
260 Ga0157379_10446677 3300014968 Bacteria 1193
261 Ga0157379_10568774 3300014968 Unclassified 1056
262 Ga0157376_10044005 3300014969 Bacteria 3668
263 Ga0207697_10128660 3300025315 Unclassified 1093
264 Ga0207653_10006401 3300025885 Bacteria 3672
265 Ga0207653_10052849 3300025885 Bacteria 1356
266 Ga0207642_10052270 3300025899 Bacteria 1853
267 Ga0207642_10068485 3300025899 Bacteria 1679
268 Ga0207688_10107928 3300025901 Bacteria 1613
269 Ga0207647_10030535 3300025904 Bacteria 3474
270 Ga0207647_10075387 3300025904 Bacteria 2030
271 Ga0207647_10097200 3300025904 Bacteria 1751
272 Ga0207647_10255395 3300025904 Unclassified 1004
273 Ga0207685_10000019 3300025905 Bacteria 145568
274 Ga0207643_10001625 3300025908 Bacteria 12672
275 Ga0207643_10009596 3300025908 Bacteria 5198
276 Ga0207643_10035925 3300025908 Bacteria 2779
277 Ga0207643_10136009 3300025908 Unclassified 1465
278 Ga0207684_10000753 3300025910 Bacteria 37762
279 Ga0207684_10063124 3300025910 Bacteria 3145
280 Ga0207684_10141149 3300025910 Unclassified 2071
281 Ga0207684_10158336 3300025910 Bacteria 1949
282 Ga0207684_10262310 3300025910 Bacteria 1491
283 Ga0207684_10270367 3300025910 Unclassified 1466
284 Ga0207654_10058781 3300025911 Unclassified 2240
285 Ga0207707_10000014 3300025912 Bacteria 261972
286 Ga0207707_10005889 3300025912 Bacteria 10718
287 Ga0207707_10026748 3300025912 Archaea 5042
288 Ga0207707_10051273 3300025912 Bacteria 3593
289 Ga0207695_10035828 3300025913 Bacteria 5372
290 Ga0207671_10087090 3300025914 Unclassified 2348
291 Ga0207671_10140880 3300025914 Bacteria 1858
292 Ga0207660_10002289 3300025917 Bacteria 12615
293 Ga0207662_10017399 3300025918 Bacteria 4066
294 Ga0207662_10084446 3300025918 Unclassified 1942
295 Ga0207662_10289537 3300025918 Bacteria 1086
296 Ga0207652_10000220 3300025921 Bacteria 60440
297 Ga0207652_10059149 3300025921 Bacteria 3303
298 Ga0207646_10000931 3300025922 Bacteria 37686
299 Ga0207646_10061430 3300025922 Bacteria 3354
300 Ga0207646_10070312 3300025922 Bacteria 3126
301 Ga0207681_10018127 3300025923 Unclassified 4432
302 Ga0207694_10003703 3300025924 Bacteria 12105
303 Ga0207650_10000022 3300025925 Bacteria 318878
304 Ga0207650_10009318 3300025925 Bacteria 6709
305 Ga0207650_10229603 3300025925 Unclassified 1496
306 Ga0207687_10058783 3300025927 Bacteria 2706
307 Ga0207644_10001359 3300025931 Bacteria 15733
308 Ga0207644_10027216 3300025931 Bacteria 3950
309 Ga0207690_10115990 3300025932 Bacteria 1936
310 Ga0207686_10001036 3300025934 Bacteria 16450
311 Ga0207686_10430818 3300025934 Bacteria 1011
312 Ga0207709_10040002 3300025935 Bacteria 2804
313 Ga0207709_10053422 3300025935 Unclassified 2486
314 Ga0207709_10297041 3300025935 Bacteria 1200
315 Ga0207670_10000490 3300025936 Bacteria 21813
316 Ga0207669_10210855 3300025937 Unclassified 1418
317 Ga0207704_10096749 3300025938 Bacteria 1956
318 Ga0207704_10383664 3300025938 Bacteria 1104
319 Ga0207665_10052663 3300025939 Bacteria 2742
320 Ga0207691_10002804 3300025940 Bacteria 16987
321 Ga0207711_10005731 3300025941 Bacteria 10482
322 Ga0207711_10031126 3300025941 Unclassified 4503
323 Ga0207711_10071050 3300025941 Unclassified 3020
324 Ga0207711_10220882 3300025941 Unclassified 1733
325 Ga0207689_10008271 3300025942 Bacteria 9068
326 Ga0207689_10014696 3300025942 Bacteria 6648
327 Ga0207689_10114310 3300025942 Archaea 2219
328 Ga0207689_10226373 3300025942 Unclassified 1546
329 Ga0207689_10263689 3300025942 Unclassified 1426
330 Ga0207689_10437263 3300025942 Unclassified 1092
331 Ga0207651_10012401 3300025960 Bacteria 4823
332 Ga0207651_10096032 3300025960 Bacteria 2185
333 Ga0207651_10424986 3300025960 Unclassified 1135
334 Ga0207712_10012260 3300025961 Bacteria 5477
335 Ga0207712_10015897 3300025961 Unclassified 4862
336 Ga0207668_10013255 3300025972 Bacteria 5070
337 Ga0207640_10517027 3300025981 Bacteria 997
338 Ga0207677_10113669 3300026023 Bacteria 2021
339 Ga0207703_10017736 3300026035 Bacteria 5558
340 Ga0207703_10210972 3300026035 Bacteria 1731
341 Ga0207708_10001052 3300026075 Bacteria 20653
342 Ga0207708_10017517 3300026075 Bacteria 5393
343 Ga0207708_10026844 3300026075 Bacteria 4359
344 Ga0207708_10030706 3300026075 Bacteria 4075
345 Ga0207708_10043230 3300026075 Bacteria 3434
346 Ga0207708_10517913 3300026075 Bacteria 1002
347 Ga0207702_10023537 3300026078 Bacteria 5109
348 Ga0207641_10109300 3300026088 Unclassified 2449
349 Ga0207641_10196550 3300026088 Unclassified 1857
350 Ga0207648_10078878 3300026089 Unclassified 2873
351 Ga0207648_10133129 3300026089 Bacteria 2189
352 Ga0207676_10010328 3300026095 Bacteria 6647
353 Ga0207676_10162458 3300026095 Bacteria 1936
354 Ga0207676_10195660 3300026095 Bacteria 1783
355 Ga0207676_10215744 3300026095 Bacteria 1705
356 Ga0207676_10217032 3300026095 Unclassified 1701
357 Ga0207676_10237033 3300026095 Unclassified 1634
358 Ga0207676_10450010 3300026095 Bacteria 1214
359 Ga0207674_10000841 3300026116 Bacteria 40016
360 Ga0207674_10069870 3300026116 Bacteria 3531
361 Ga0207674_10188693 3300026116 Unclassified 2011
362 Ga0207674_10287745 3300026116 Bacteria 1592
363 Ga0207675_100077431 3300026118 Bacteria 3115
364 Ga0207675_100092090 3300026118 Archaea 2851
365 Ga0207675_100231822 3300026118 Unclassified 1782
366 Ga0207428_10022791 3300027907 Bacteria 5278
367 Ga0207428_10134948 3300027907 Bacteria 1887
368 Ga0268265_10257669 3300028380 Unclassified 1549
369 Ga0268264_10017971 3300028381 Bacteria 5784
370 Ga0268264_10034746 3300028381 Bacteria 4148
371 Ga0268264_10156062 3300028381 Unclassified 2051
372 Ga0268264_10258097 3300028381 Bacteria 1622
373 Ga0268264_10379443 3300028381 Unclassified 1353
374 Ga0307405_10027972 3300031731 Bacteria 3277
375 Ga0307412_10045049 3300031911 Bacteria 2881
376 Ga0307416_100026249 3300032002 Unclassified 4288
377 Ga0307414_10054027 3300032004 Bacteria 2805
378 Ga0307414_10072717 3300032004 Unclassified 2485
379 Ga0307415_100028382 3300032126 Bacteria 3559
380 Ga0373951_0047693 3300035091 Unclassified 1047
381 Ga0373941_0016034 3300035115 Bacteria 2029
382 Ga0373942_0020002 3300035207 Bacteria 1677
383 Ga0395900_0126821 3300037418 Unclassified 2618
384 Ga0395901_0538266 3300038443 Unclassified 1185
385 Ga0242419_001899 3300038698 Bacteria 1327
386 Ga0436365_0725683 3300039437 Unclassified 1233
387 Ga0451576_0361772 3300045051 Bacteria 1520
388 Ga0451576_0546749 3300045051 Bacteria 1217
389 Ga0496105_0228486 3300048908 Bacteria 1513
390 Ga0496106_0411173 3300048909 Unclassified 1087
391 Ga0496108_0042010 3300048911 Bacteria 3816
392 Ga0496108_0344514 3300048911 Bacteria 1300
393 Ga0496109_0648501 3300048912 Bacteria 993
394 Ga0496110_0729412 3300048913 Bacteria 893
395 Ga0496112_0304230 3300048915 Bacteria 1540
396 Ga0496112_0662076 3300048915 Bacteria 973
397 Ga0496113_0014075 3300048916 Bacteria 5445
398 Ga0501296_006507 3300049519 Unclassified 1326
399 Ga0501223_016175 3300049663 Bacteria 1475
400 Ga0501223_022711 3300049663 Bacteria 1225
401 Ga0501224_012134 3300049664 Bacteria 1268
402 Ga0501227_012981 3300049665 Bacteria 1830
403 Ga0501235_019725 3300049669 Bacteria 1496
404 Ga0501255_006883 3300049684 Bacteria 1188
405 Ga0501221_012065 3300049704 Bacteria 1567
406 Ga0501225_0013976 3300049705 Bacteria 2244
407 nmdc:mga05p37_463988_c1 3300050507 Bacteria 1463
408 nmdc:mga05p37_516542_c1 3300050507 Unclassified 1367
409 nmdc:mga05p37_66214_c1 3300050507 Bacteria 4444
410 nmdc:mga08y16_5000_c1 3300050511 Bacteria 13866
411 nmdc:mga08y16_67333_c1 3300050511 Bacteria 3735
412 nmdc:mga0n895_47838_c1 3300050512 Bacteria 4183
413 nmdc:mga0rr50_248176_c1 3300050513 Unclassified 1477
414 nmdc:mga0rr50_389036_c1 3300050513 Unclassified 1177
415 nmdc:mga0rr50_65372_c1 3300050513 Bacteria 2755
416 nmdc:mga0a205_175226_c1 3300050515 Bacteria 2040
417 nmdc:mga0a205_92985_c1 3300050515 Bacteria 2914
418 Ga0070707_100164284
419 SwRhRL2b_contig_3636584
420 CNAas_1001112
421 JGI24751J29686_10000178
422 JGI25406J46586_10005411
423 Ga0065714_10002184
424 Ga0065704_10075442
425 Ga0065712_10067743
426 Ga0065712_10068981
427 Ga0065715_10089027
428 Ga0065715_10090844
429 Ga0065715_10131648
430 Ga0065715_10148964
431 Ga0065707_10011335
432 Ga0065707_10086143
433 Ga0065707_10099036
434 Ga0065707_10194441
435 Ga0070676_10161693
436 Ga0070676_10169430
437 Ga0070683_100190680
438 Ga0070690_100023567
439 Ga0070690_100084979
440 Ga0070670_100002311
441 Ga0070670_100018613
442 Ga0068869_100115142
443 Ga0068869_100226021
444 Ga0070680_100001815
445 Ga0070682_100005888
446 Ga0070682_100069515
447 Ga0068868_100039236
448 Ga0068868_100144305
449 Ga0070689_100000257
450 Ga0070689_100128953
451 Ga0070687_100015895
452 Ga0070687_100298253
453 Ga0070661_100411099
454 Ga0070692_10016942
455 Ga0070692_10051221
456 Ga0070692_10122669
457 Ga0070668_100008901
458 Ga0070669_100035238
459 Ga0070675_100023022
460 Ga0070671_100000663
461 Ga0070671_100051858
462 Ga0070671_100080798
463 Ga0070673_100305455
464 Ga0070688_100304653
465 Ga0070659_100014220
466 Ga0070659_100340831
467 Ga0070667_100090852
468 Ga0070667_100331590
469 Ga0070703_10005183
470 Ga0070703_10029264
471 Ga0070701_10070514
472 Ga0070705_100000748
473 Ga0070705_100007600
474 Ga0070705_100158053
475 Ga0070700_100000369
476 Ga0070700_100003825
477 Ga0070700_100007799
478 Ga0070700_100134804
479 Ga0070694_100046377
480 Ga0070694_100064705
481 Ga0070694_100079745
482 Ga0070694_100164738
483 Ga0070694_100303026
484 Ga0070708_100001006
485 Ga0070708_100392951
486 Ga0070663_100355570
487 Ga0070681_10000153
488 Ga0070681_10002513
489 Ga0070681_10024354
490 Ga0068867_100008598
491 Ga0068867_100389501
492 Ga0070706_100000509
493 Ga0070706_100009054
494 Ga0070706_100036447
495 Ga0070706_100196342
496 Ga0070707_100000217
497 Ga0070707_100005454
498 Ga0070707_100161190
499 Ga0070707_100209317
500 Ga0070707_100227597
501 Ga0070698_100014260
502 Ga0070698_100024925
503 Ga0070698_100104305
504 Ga0070698_100478393
505 Ga0070699_100002005
506 Ga0070699_100003132
507 Ga0070699_100028842
508 Ga0070699_100197545
509 Ga0070679_100000028
510 Ga0070679_100015165
511 Ga0070679_100107759
512 Ga0070679_100681035
513 Ga0070697_100005050
514 Ga0070697_100009797
515 Ga0070697_100017045
516 Ga0070697_100052940
517 Ga0070697_100162607
518 Ga0068853_100032137
519 Ga0068853_100052940
520 Ga0070672_100138521
521 Ga0070686_100017017
522 Ga0070686_100021391
523 Ga0070695_100052956
524 Ga0070695_100087185
525 Ga0070695_100127497
526 Ga0070695_100159059
527 Ga0070695_100168461
528 Ga0070695_100401923
529 Ga0070695_100469326
530 Ga0070696_100038044
531 Ga0070693_100002811
532 Ga0070693_100003464
533 Ga0070693_100007842
534 Ga0070693_100018525
535 Ga0070693_100069814
536 Ga0070704_100000533
537 Ga0070704_100237970
538 Ga0068855_100620852
539 Ga0070664_100015653
540 Ga0070664_100237298
541 Ga0070664_100312289
542 Ga0068857_100019211
543 Ga0068857_100099984
544 Ga0068857_100213170
545 Ga0068854_100045790
546 Ga0068854_100188608
547 Ga0068854_100241104
548 Ga0068856_100126239
549 Ga0070702_100001801
550 Ga0070702_100025433
551 Ga0070702_100040331
552 Ga0070702_100103229
553 Ga0068859_100004672
554 Ga0068859_100014913
555 Ga0068859_100031014
556 Ga0068859_100067299
557 Ga0068859_100073750
558 Ga0068859_100259003
559 Ga0068859_100442695
560 Ga0068864_100005046
561 Ga0068864_100065423
562 Ga0068864_100118587
563 Ga0068864_100159695
564 Ga0068864_100165511
565 Ga0068864_100393845
566 Ga0068866_10065322
567 Ga0068866_10078677
568 Ga0068861_100162390
569 Ga0068851_10002130
570 Ga0068870_10005626
571 Ga0068870_10070533
572 Ga0068863_100036553
573 Ga0068863_100067278
574 Ga0068863_100072549
575 Ga0068858_100025844
576 Ga0068858_100082242
577 Ga0068858_100150102
578 Ga0068858_100211227
579 Ga0068858_100419674
580 Ga0068858_100555542
581 Ga0068860_100055054
582 Ga0068860_100238505
583 Ga0068862_100039156
584 Ga0068862_100073807
585 Ga0081540_1049651
586 Ga0081539_10001697
587 Ga0070716_100012013
588 Ga0097621_100006435
589 Ga0097621_100059964
590 Ga0097621_100061727
591 Ga0068871_100003543
592 Ga0068871_100029337
593 Ga0068871_100125162
594 Ga0075428_100187828
595 Ga0075428_100439160
596 Ga0075433_10042358
597 Ga0075433_10061461
598 Ga0075433_10228792
599 Ga0075434_100259039
600 Ga0075434_100349439
601 Ga0075434_100413572
602 Ga0075429_100126903
603 Ga0097620_100004673
604 Ga0097620_100014912
605 Ga0097620_100031014
606 Ga0097620_100067302
607 Ga0097620_100073750
608 Ga0097620_100119696
609 Ga0097620_100258994
610 Ga0097620_100442680
611 Ga0075435_100067499
612 Ga0105240_10033365
613 Ga0105240_10171784
614 Ga0105240_10453790
615 Ga0111539_10004288
616 Ga0111539_10043081
617 Ga0105245_10032970
618 Ga0105247_10006656
619 Ga0114129_10015644
620 Ga0114129_10052809
621 Ga0114129_10949664
622 Ga0105243_10026433
623 Ga0105243_10038459
624 Ga0105243_10115830
625 Ga0105243_10222146
626 Ga0105243_10639920
627 Ga0105241_10017062
628 Ga0105242_10004496
629 Ga0105248_10003659
630 Ga0105248_10582963
631 Ga0105237_10004546
632 Ga0105237_10058515
633 Ga0105237_10393521
634 Ga0105238_10005175
635 Ga0105238_10474377
636 Ga0105249_10000956
637 Ga0105249_10028452
638 Ga0105249_10067444
639 Ga0105249_10126127
640 Ga0105249_10175043
641 Ga0105239_10021414
642 Ga0105239_10215391
643 Ga0105239_10537574
644 Ga0105246_10072764
645 Ga0105246_10081191
646 Ga0105246_10291601
647 Ga0157373_10003104
648 Ga0157373_10027866
649 Ga0157374_10233812
650 Ga0157374_10425974
651 Ga0157378_10010173
652 Ga0157378_10034234
653 Ga0157378_10098269
654 Ga0163162_10000006
655 Ga0163162_10007137
656 Ga0163162_10159799
657 Ga0163162_10173821
658 Ga0163162_10270996
659 Ga0163162_10318903
660 Ga0163162_10388130
661 Ga0163162_10390058
662 Ga0157372_10012879
663 Ga0157372_10656376
664 Ga0157375_10148361
665 Ga0157375_10189068
666 Ga0163163_10001852
667 Ga0163163_10018967
668 Ga0163163_10058734
669 Ga0163163_10127484
670 Ga0163163_10199573
671 Ga0163163_10205846
672 Ga0163163_10564276
673 Ga0157380_10013345
674 Ga0157380_10013769
675 Ga0157380_10765445
676 Ga0157377_10070335
677 Ga0157379_10446677
678 Ga0157379_10568774
679 Ga0157376_10044005
680 Ga0207697_10128660
681 Ga0207653_10006401
682 Ga0207653_10052849
683 Ga0207642_10052270
684 Ga0207642_10068485
685 Ga0207688_10107928
686 Ga0207647_10030535
687 Ga0207647_10075387
688 Ga0207647_10097200
689 Ga0207647_10255395
690 Ga0207685_10000019
691 Ga0207643_10001625
692 Ga0207643_10009596
693 Ga0207643_10035925
694 Ga0207643_10136009
695 Ga0207684_10000753
696 Ga0207684_10063124
697 Ga0207684_10141149
698 Ga0207684_10158336
699 Ga0207684_10262310
700 Ga0207684_10270367
701 Ga0207654_10058781
702 Ga0207707_10000014
703 Ga0207707_10005889
704 Ga0207707_10026748
705 Ga0207707_10051273
706 Ga0207695_10035828
707 Ga0207671_10087090
708 Ga0207671_10140880
709 Ga0207660_10002289
710 Ga0207662_10017399
711 Ga0207662_10084446
712 Ga0207662_10289537
713 Ga0207652_10000220
714 Ga0207652_10059149
715 Ga0207646_10000931
716 Ga0207646_10061430
717 Ga0207646_10070312
718 Ga0207681_10018127
719 Ga0207694_10003703
720 Ga0207650_10000022
721 Ga0207650_10009318
722 Ga0207650_10229603
723 Ga0207687_10058783
724 Ga0207644_10001359
725 Ga0207644_10027216
726 Ga0207690_10115990
727 Ga0207686_10001036
728 Ga0207686_10430818
729 Ga0207709_10040002
730 Ga0207709_10053422
731 Ga0207709_10297041
732 Ga0207670_10000490
733 Ga0207669_10210855
734 Ga0207704_10096749
735 Ga0207704_10383664
736 Ga0207665_10052663
737 Ga0207691_10002804
738 Ga0207711_10005731
739 Ga0207711_10031126
740 Ga0207711_10071050
741 Ga0207711_10220882
742 Ga0207689_10008271
743 Ga0207689_10014696
744 Ga0207689_10114310
745 Ga0207689_10226373
746 Ga0207689_10263689
747 Ga0207689_10437263
748 Ga0207651_10012401
749 Ga0207651_10096032
750 Ga0207651_10424986
751 Ga0207712_10012260
752 Ga0207712_10015897
753 Ga0207668_10013255
754 Ga0207640_10517027
755 Ga0207677_10113669
756 Ga0207703_10017736
757 Ga0207703_10210972
758 Ga0207708_10001052
759 Ga0207708_10017517
760 Ga0207708_10026844
761 Ga0207708_10030706
762 Ga0207708_10043230
763 Ga0207708_10517913
764 Ga0207702_10023537
765 Ga0207641_10109300
766 Ga0207641_10196550
767 Ga0207648_10078878
768 Ga0207648_10133129
769 Ga0207676_10010328
770 Ga0207676_10162458
771 Ga0207676_10195660
772 Ga0207676_10215744
773 Ga0207676_10217032
774 Ga0207676_10237033
775 Ga0207676_10450010
776 Ga0207674_10000841
777 Ga0207674_10069870
778 Ga0207674_10188693
779 Ga0207674_10287745
780 Ga0207675_100077431
781 Ga0207675_100092090
782 Ga0207675_100231822
783 Ga0207428_10022791
784 Ga0207428_10134948
785 Ga0268265_10257669
786 Ga0268264_10017971
787 Ga0268264_10034746
788 Ga0268264_10156062
789 Ga0268264_10258097
790 Ga0268264_10379443
791 Ga0307405_10027972
792 Ga0307412_10045049
793 Ga0307416_100026249
794 Ga0307414_10054027
795 Ga0307414_10072717
796 Ga0307415_100028382
797 Ga0373951_0047693
798 Ga0373941_0016034
799 Ga0373942_0020002
800 Ga0395900_0126821
801 Ga0395901_0538266
802 Ga0242419_001899
803 Ga0436365_0725683
804 Ga0451576_0361772
805 Ga0451576_0546749
806 Ga0496105_0228486
807 Ga0496106_0411173
808 Ga0496108_0042010
809 Ga0496108_0344514
810 Ga0496109_0648501
811 Ga0496110_0729412
812 Ga0496112_0304230
813 Ga0496112_0662076
814 Ga0496113_0014075
815 Ga0501296_006507
816 Ga0501223_016175
817 Ga0501223_022711
818 Ga0501224_012134
819 Ga0501227_012981
820 Ga0501235_019725
821 Ga0501255_006883
822 Ga0501221_012065
823 Ga0501225_0013976
824 nmdc:mga05p37_463988_c1
825 nmdc:mga05p37_516542_c1
826 nmdc:mga05p37_66214_c1
827 nmdc:mga08y16_5000_c1
828 nmdc:mga08y16_67333_c1
829 nmdc:mga0n895_47838_c1
830 nmdc:mga0rr50_248176_c1
831 nmdc:mga0rr50_389036_c1
832 nmdc:mga0rr50_65372_c1
833 nmdc:mga0a205_175226_c1
834 nmdc:mga0a205_92985_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13354

Beta-lactamase2

Beta-lactamase enzyme family

72

281

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbx-assembly1.cif.gz_A crystal structure of d179y kpc-2 beta-lactamase 0.8941 28 298
5glc-assembly1.cif.gz_A crystal structure of the class a beta-lactamase penl-ttr11 containing 20 residues insertion in omega-loop 0.8874 26 296
2j8y-assembly2.cif.gz_B structure of pbp-a acyl-enzyme complex with penicillin-g 0.8871 31 295
7tbx-assembly1.cif.gz_A crystal structure of d179y kpc-2 beta-lactamase 0.8871 28 298
5tw6-assembly1.cif.gz_A ctx-m-14 p167s:e166a mutant with acylated ceftazidime molecule 0.8859 31 294
ID Description Score Start End Superfamily
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8955 31 295 3.40.710.10
4yfmB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8701 32 295 3.40.710.10
1g6aA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8698 28 296 3.40.710.10
4ewfA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8677 25 297 3.40.710.10
4hesD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8619 28 294 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2G4HJJ2-F1-model_v4 Serine hydrolase 0.9797 32 297 GO:0008800
GO:0030655
GO:0046677
AF-A0A359LPX7-F1-model_v4 Uncharacterized protein 0.9751 32 297 GO:0008658
GO:0008800
GO:0030655
GO:0046677
AF-A0A257B752-F1-model_v4 Serine hydrolase 0.969 24 300 GO:0008800
GO:0030655
GO:0046677
AF-A0A3D2WA80-F1-model_v4 Beta-lactamase class A catalytic domain-containing protein 0.9637 34 167 GO:0008800
GO:0030655
GO:0046677
AF-W0RMR3-F1-model_v4 Putative beta-lactamase 0.9624 30 296 GO:0008800
GO:0030655
GO:0046677

Map