F438989

General Info

Members Datasets Scaffolds Average Seq Length
417 302 314 408

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100066709|Ga0070663_1000667092
Length 464
Sequence VPNDPAKTLTKRFGVGAPAGMKALPGRFFRVTQQEKFGLRAWLKWTPVAKTNMLTLGVWGKAMKCRAAAVAVLLCMIFASSNADARGPYGTISVGNWQGGAYTNDQTGSFTHCAAGARYASGVFFLVMIDNDGGWSLGFMHEQWRLTTGAAFPLTLTFDGQQPFNVHGVPIADKLVRVPMPSNSSLIAQFRKAKAMTAFTQGQLFQFNLDQTGQLLPVLAHCVAKIRQSGVASAGDFSVLPAAKAAKPDRVLDQKGTGFLVSTNGHLVTNAHVVQGCVGDIQGNPSGEAPAKLRLVSSDETNDLALLQATGSFKDIAKIRDKAIQSGDSVVAIGYPFHGLLTSDFTVTTGIVSSLSGILNDTRFLQISAAIQPGNSGGPLLASSGDVVGVVAAKLNAIKFVRATGNIPENINFAIKTGALRDFLDNSVVPYQISDAKDELKTADIARNARAFTFLISCKETARN

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
13 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
24 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
25 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
26 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
27 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
28 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
29 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
30 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
31 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
32 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
33 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
34 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
35 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
36 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
37 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
38 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
39 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
40 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
41 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
42 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
43 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
44 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
45 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
46 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
47 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
48 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
49 2904699407
50 2906610324
51 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
52 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
53 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
54 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
55 2922368715
56 2922425934
57 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
58 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
59 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
60 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
61 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
62 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
63 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
64 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
65 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
66 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
67 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
68 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
69 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
70 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
71 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
72 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
73 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
74 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
75 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
76 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
77 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
78 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
79 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
80 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
81 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
82 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
83 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
84 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
89 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
94 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
95 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
107 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
130 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
131 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
141 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
269 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
270 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
276 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
277 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
282 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
283 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
284 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
285 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
286 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
287 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
288 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
289 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
290 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
291 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
292 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
293 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
294 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
295 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
296 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
297 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
298 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
299 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
300 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
301 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
302 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.03
Metatranscriptomes 0
Isolates 23.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.07
Nodule 19.9
Rhizoplane 8.15
Rhizosphere 41.49
Stem 0
Stem Tuber 0
Unclassified 14.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000275 3300003215 Bacteria 40455
2 JGI25153J46596_10005214 3300003215 Bacteria 6840
3 JGI25153J46596_10010524 3300003215 Bacteria 4176
4 JGI25153J46596_10011041 3300003215 Bacteria 4026
5 rootH2_10113424 3300003320 Bacteria 2611
6 rootL2_10003263 3300003322 Bacteria 1932
7 rootL2_10003264 3300003322 Bacteria 2354
8 JGI25160J50197_1002602 3300003354 Bacteria 8329
9 JGI25404J52841_10008322 3300003659 Bacteria 2207
10 Ga0055543_1005540 3300004625 Bacteria 3205
11 Ga0065165_1001383 3300005262 Bacteria 26627
12 Ga0065165_1002288 3300005262 Bacteria 16809
13 Ga0070658_10084487 3300005327 Bacteria 2610
14 Ga0070680_100030983 3300005336 Bacteria 4298
15 Ga0070682_100090329 3300005337 Bacteria 2003
16 Ga0068868_100002640 3300005338 Bacteria 12436
17 Ga0068868_100162208 3300005338 Bacteria 1847
18 Ga0070661_100054579 3300005344 Bacteria 2926
19 Ga0070668_100007829 3300005347 Bacteria 7935
20 Ga0070668_100051401 3300005347 Bacteria 3175
21 Ga0070671_100042177 3300005355 Bacteria 3793
22 Ga0070709_10000815 3300005434 Bacteria 17382
23 Ga0070713_100030734 3300005436 Bacteria 4269
24 Ga0070710_10003405 3300005437 Bacteria 7534
25 Ga0070711_100022636 3300005439 Bacteria 4076
26 Ga0070663_100027226 3300005455 Bacteria 3879
27 Ga0070663_100047207 3300005455 Bacteria 3050
28 Ga0070663_100066709 3300005455 Bacteria 2608
29 Ga0070678_100028544 3300005456 Bacteria 3807
30 Ga0070681_10007582 3300005458 Bacteria 10609
31 Ga0070684_100174019 3300005535 Bacteria 1956
32 Ga0068853_100154681 3300005539 Bacteria 2066
33 Ga0068853_100321204 3300005539 Bacteria 1435
34 Ga0070696_100126227 3300005546 Bacteria 1857
35 Ga0070665_100059071 3300005548 Bacteria 3844
36 Ga0070665_100083296 3300005548 Bacteria 3203
37 Ga0070665_100085503 3300005548 Bacteria 3159
38 Ga0070665_100275244 3300005548 Bacteria 1685
39 Ga0068855_100017166 3300005563 Bacteria 8708
40 Ga0068855_100018585 3300005563 Bacteria 8359
41 Ga0070664_100114910 3300005564 Bacteria 2352
42 Ga0070664_100214449 3300005564 Bacteria 1721
43 Ga0068854_100036499 3300005578 Bacteria 3446
44 Ga0068856_100122448 3300005614 Bacteria 2603
45 Ga0068856_100357628 3300005614 Bacteria 1479
46 Ga0070702_100117952 3300005615 Bacteria 1657
47 Ga0068852_100045517 3300005616 Bacteria 3733
48 Ga0068852_100134483 3300005616 Bacteria 2282
49 Ga0068859_100060081 3300005617 Bacteria 3830
50 Ga0068864_100045771 3300005618 Bacteria 3753
51 Ga0068864_100296700 3300005618 Bacteria 1512
52 Ga0068861_100021725 3300005719 Bacteria 4614
53 Ga0068861_100225051 3300005719 Bacteria 1588
54 Ga0068863_100065855 3300005841 Bacteria 3428
55 Ga0068863_100182763 3300005841 Bacteria 2013
56 Ga0068858_100060230 3300005842 Bacteria 3509
57 Ga0068858_100149794 3300005842 Bacteria 2193
58 Ga0068862_100166517 3300005844 Bacteria 1970
59 Ga0081455_10006777 3300005937 Bacteria 12222
60 Ga0081455_10014855 3300005937 Bacteria 7594
61 Ga0081540_1001002 3300005983 Bacteria 25359
62 Ga0081540_1003798 3300005983 Bacteria 11822
63 Ga0081540_1005368 3300005983 Bacteria 9588
64 Ga0081540_1018512 3300005983 Bacteria 4268
65 Ga0081540_1085025 3300005983 Bacteria 1410
66 Ga0081539_10060310 3300005985 Bacteria 2084
67 Ga0070717_10041224 3300006028 Bacteria 3764
68 Ga0075365_10021404 3300006038 Bacteria 4034
69 Ga0075365_10092474 3300006038 Bacteria 2062
70 Ga0075365_10149727 3300006038 Bacteria 1623
71 Ga0075365_10172608 3300006038 Bacteria 1509
72 Ga0075368_10045238 3300006042 Bacteria 1738
73 Ga0075363_100000579 3300006048 Bacteria 12040
74 Ga0075363_100073158 3300006048 Bacteria 1865
75 Ga0070715_10001230 3300006163 Bacteria 7370
76 Ga0070716_100001910 3300006173 Bacteria 9469
77 Ga0070712_100060212 3300006175 Unclassified 2677
78 Ga0075367_10048651 3300006178 Bacteria 2498
79 Ga0075367_10089002 3300006178 Bacteria 1876
80 Ga0075369_10004885 3300006186 Bacteria 4989
81 Ga0075369_10023141 3300006186 Bacteria 2566
82 Ga0075366_10115923 3300006195 Bacteria 1613
83 Ga0097621_100041057 3300006237 Bacteria 3722
84 Ga0075370_10005748 3300006353 Bacteria 6196
85 Ga0068871_100016689 3300006358 Bacteria 5539
86 Ga0068871_100042222 3300006358 Bacteria 3660
87 Ga0068871_100130012 3300006358 Bacteria 2134
88 Ga0068865_100085053 3300006881 Bacteria 2281
89 Ga0097620_100060080 3300006931 Bacteria 3830
90 Ga0099824_1004029 3300006942 Bacteria 21270
91 Ga0099824_1006032 3300006942 Bacteria 16811
92 Ga0099822_1001863 3300006943 Bacteria 25424
93 Ga0105240_10042923 3300009093 Bacteria 5760
94 Ga0111539_10281428 3300009094 Bacteria 1935
95 Ga0105245_10037585 3300009098 Bacteria 4305
96 Ga0105247_10043333 3300009101 Bacteria 2757
97 Ga0105247_10054924 3300009101 Bacteria 2458
98 Ga0105248_10062206 3300009177 Bacteria 4192
99 Ga0105237_10035202 3300009545 Bacteria 5068
100 Ga0105237_10074331 3300009545 Bacteria 3391
101 Ga0105237_10153814 3300009545 Bacteria 2296
102 Ga0105238_10167206 3300009551 Bacteria 2175
103 Ga0105238_10200089 3300009551 Bacteria 1973
104 Ga0105239_10034736 3300010375 Bacteria 5539
105 Ga0105246_10007907 3300011119 Bacteria 6524
106 Ga0105246_10030531 3300011119 Bacteria 3561
107 Ga0105246_10097790 3300011119 Bacteria 2131
108 Ga0157370_10167578 3300013104 Bacteria 2042
109 Ga0157369_10022963 3300013105 Bacteria 6956
110 Ga0157374_10015082 3300013296 Bacteria 6775
111 Ga0157378_10018217 3300013297 Bacteria 6164
112 Ga0163162_10013299 3300013306 Bacteria 8039
113 Ga0163162_10226519 3300013306 Bacteria 1999
114 Ga0157375_10026697 3300013308 Bacteria 5387
115 Ga0157375_10111951 3300013308 Bacteria 2829
116 Ga0157375_10143634 3300013308 Bacteria 2516
117 Ga0157375_10311717 3300013308 Bacteria 1738
118 Ga0163163_10017642 3300014325 Bacteria 6663
119 Ga0163163_10018764 3300014325 Bacteria 6483
120 Ga0157379_10035093 3300014968 Bacteria 4471
121 Ga0157379_10082986 3300014968 Bacteria 2872
122 Ga0157376_10060038 3300014969 Bacteria 3191
123 Ga0157376_10150581 3300014969 Bacteria 2098
124 Ga0213871_10001609 3300021441 Bacteria 3852
125 Ga0209563_101265 3300025230 Bacteria 6927
126 Ga0209677_100315 3300025253 Bacteria 31539
127 Ga0209233_1000462 3300025261 Bacteria 26091
128 Ga0209233_1002125 3300025261 Bacteria 7469
129 Ga0209233_1004673 3300025261 Bacteria 4620
130 Ga0209455_1008088 3300025272 Bacteria 2893
131 Ga0209758_1000182 3300025297 Bacteria 140630
132 Ga0209758_1002645 3300025297 Bacteria 17756
133 Ga0209758_1006753 3300025297 Bacteria 8068
134 Ga0209758_1009608 3300025297 Bacteria 5972
135 Ga0207426_1000391 3300025302 Bacteria 74876
136 Ga0207426_1001404 3300025302 Bacteria 20234
137 Ga0207710_10055996 3300025900 Bacteria 1779
138 Ga0207647_10029834 3300025904 Bacteria 3524
139 Ga0207699_10041492 3300025906 Bacteria 2658
140 Ga0207705_10074654 3300025909 Bacteria 2462
141 Ga0207671_10089080 3300025914 Bacteria 2322
142 Ga0207693_10000564 3300025915 Bacteria 33530
143 Ga0207693_10075920 3300025915 Unclassified 2632
144 Ga0207663_10002034 3300025916 Bacteria 9616
145 Ga0207663_10189454 3300025916 Bacteria 1476
146 Ga0207657_10225952 3300025919 Bacteria 1498
147 Ga0207649_10024340 3300025920 Bacteria 3518
148 Ga0207649_10039329 3300025920 Bacteria 2867
149 Ga0207694_10076668 3300025924 Bacteria 2618
150 Ga0207687_10019855 3300025927 Bacteria 4456
151 Ga0207700_10170335 3300025928 Bacteria 1816
152 Ga0207664_10017007 3300025929 Bacteria 5320
153 Ga0207686_10089151 3300025934 Bacteria 2033
154 Ga0207670_10104104 3300025936 Bacteria 2032
155 Ga0207665_10002339 3300025939 Bacteria 12808
156 Ga0207711_10033574 3300025941 Bacteria 4343
157 Ga0207667_10052854 3300025949 Bacteria 4276
158 Ga0207668_10023570 3300025972 Bacteria 3959
159 Ga0207640_10145755 3300025981 Bacteria 1732
160 Ga0207677_10007222 3300026023 Bacteria 6124
161 Ga0207703_10064416 3300026035 Bacteria 3008
162 Ga0207703_10174261 3300026035 Bacteria 1894
163 Ga0207678_10004282 3300026067 Bacteria 12798
164 Ga0207678_10004673 3300026067 Bacteria 12297
165 Ga0207678_10011829 3300026067 Bacteria 7662
166 Ga0207678_10026081 3300026067 Bacteria 5099
167 Ga0207678_10047626 3300026067 Bacteria 3706
168 Ga0207678_10081815 3300026067 Bacteria 2764
169 Ga0207674_10036377 3300026116 Bacteria 5132
170 Ga0207675_100036080 3300026118 Bacteria 4611
171 Ga0207698_10080607 3300026142 Bacteria 2623
172 Ga0207698_10094631 3300026142 Bacteria 2457
173 Ga0209589_1000017 3300027357 Bacteria 215546
174 Ga0209489_100018 3300027361 Bacteria 215546
175 Ga0209700_100028 3300027363 Bacteria 215546
176 Ga0209813_10030235 3300027866 Bacteria 1590
177 Ga0268266_10001398 3300028379 Bacteria 28887
178 Ga0268266_10004536 3300028379 Bacteria 13264
179 Ga0268266_10030240 3300028379 Bacteria 4603
180 Ga0268266_10079213 3300028379 Bacteria 2860
181 Ga0268266_10160215 3300028379 Bacteria 2035
182 Ga0307517_10001196 3300028786 Bacteria 43774
183 Ga0307515_10021705 3300028794 Bacteria 11364
184 Ga0265338_10029412 3300028800 Bacteria 5447
185 Ga0265330_10018286 3300031235 Bacteria 3219
186 Ga0307509_10061878 3300031507 Bacteria 3949
187 Ga0307508_10136011 3300031616 Bacteria 2061
188 Ga0307508_10206982 3300031616 Bacteria 1562
189 Ga0307516_10007189 3300031730 Bacteria 12850
190 Ga0307516_10137678 3300031730 Bacteria 2214
191 Ga0307416_100320901 3300032002 Bacteria 1551
192 Ga0307415_100012913 3300032126 Bacteria 4852
193 Ga0307507_10012119 3300033179 Bacteria 10712
194 Ga0307510_10000908 3300033180 Bacteria 31266
195 Ga0307510_10025468 3300033180 Bacteria 6821
196 Ga0307510_10111698 3300033180 Bacteria 2473
197 Ga0315911_1000018 3300033442 Bacteria 152089
198 Ga0373926_0012202 3300035083 Bacteria 2904
199 Ga0373929_0002551 3300035085 Bacteria 3347
200 Ga0373935_0012318 3300035692 Bacteria 5145
201 Ga0373927_0033321 3300035695 Bacteria 3354
202 Ga0373925_0113749 3300037068 Bacteria 2093
203 Ga0395900_0008844 3300037418 Bacteria 10338
204 Ga0395900_0280284 3300037418 Bacteria 1659
205 Ga0395898_0112922 3300037466 Bacteria 2604
206 Ga0395905_0098079 3300037471 Bacteria 2752
207 Ga0436365_1184167 3300039437 Bacteria 1958
208 Ga0436360_1173538 3300039438 Bacteria 3944
209 Ga0436361_0717092 3300039447 Bacteria 2742
210 Ga0466960_0065733 3300044901 Bacteria 1792
211 Ga0466959_0031583 3300045049 Bacteria 3918
212 Ga0466959_0097472 3300045049 Unclassified 2107
213 Ga0495629_0028304 3300046459 Bacteria 3979
214 Ga0495582_0041949 3300046473 Bacteria 2521
215 Ga0495606_0051086 3300046507 Bacteria 2699
216 Ga0495606_0075374 3300046507 Bacteria 2111
217 Ga0495631_0047410 3300046518 Bacteria 1887
218 Ga0495609_0036931 3300046538 Bacteria 2204
219 Ga0495668_0093023 3300046616 Bacteria 1651
220 Ga0495668_0122875 3300046616 Bacteria 1420
221 Ga0495661_0032289 3300046665 Bacteria 3311
222 Ga0495581_0021220 3300047315 Bacteria 3767
223 Ga0495636_0006966 3300047318 Bacteria 4448
224 Ga0496100_0002345 3300048903 Bacteria 9580
225 Ga0496101_0025769 3300048904 Bacteria 4082
226 Ga0496101_0190126 3300048904 Bacteria 1584
227 Ga0496102_0001939 3300048905 Bacteria 17821
228 Ga0496102_0337589 3300048905 Bacteria 1419
229 Ga0496103_0015060 3300048906 Bacteria 4597
230 Ga0496104_0049466 3300048907 Bacteria 3964
231 Ga0496105_0027521 3300048908 Bacteria 4646
232 Ga0496106_0000480 3300048909 Bacteria 28392
233 Ga0496106_0003581 3300048909 Bacteria 11573
234 Ga0496106_0072391 3300048909 Bacteria 2636
235 Ga0496106_0093179 3300048909 Bacteria 2328
236 Ga0496106_0121816 3300048909 Bacteria 2039
237 Ga0496106_0146017 3300048909 Bacteria 1863
238 Ga0496107_0114159 3300048910 Bacteria 1987
239 Ga0496107_0115180 3300048910 Bacteria 1978
240 Ga0496108_0015612 3300048911 Bacteria 6195
241 Ga0496109_0061961 3300048912 Bacteria 3420
242 Ga0496109_0065175 3300048912 Bacteria 3335
243 Ga0496110_0054615 3300048913 Bacteria 3513
244 Ga0496110_0230558 3300048913 Bacteria 1684
245 Ga0496111_0008912 3300048914 Bacteria 6670
246 Ga0496111_0012502 3300048914 Bacteria 5749
247 Ga0496112_0037425 3300048915 Bacteria 4736
248 Ga0496112_0040771 3300048915 Bacteria 4541
249 Ga0496112_0064652 3300048915 Bacteria 3610
250 Ga0496112_0130296 3300048915 Bacteria 2486
251 Ga0496113_0035269 3300048916 Bacteria 3657
252 Ga0496113_0038258 3300048916 Bacteria 3526
253 Ga0496113_0081022 3300048916 Bacteria 2487
254 Ga0496114_0016456 3300048917 Bacteria 5960
255 Ga0496115_0000422 3300048918 Bacteria 34614
256 Ga0496115_0039928 3300048918 Bacteria 3729
257 Ga0496117_0021106 3300048920 Bacteria 5285
258 Ga0496118_0000517 3300048921 Bacteria 63399
259 Ga0496118_0027449 3300048921 Bacteria 4817
260 Ga0496118_0125022 3300048921 Bacteria 1667
261 Ga0496119_0031989 3300048922 Bacteria 3514
262 Ga0496121_0000814 3300048924 Bacteria 56901
263 Ga0496121_0123155 3300048924 Bacteria 1954
264 Ga0496121_0172971 3300048924 Bacteria 1567
265 Ga0496121_0175347 3300048924 Bacteria 1553
266 Ga0496124_0001370 3300048927 Bacteria 36487
267 Ga0496125_0022712 3300048928 Bacteria 5816
268 Ga0496125_0032462 3300048928 Bacteria 4638
269 Ga0496125_0053301 3300048928 Bacteria 3317
270 Ga0496126_0009132 3300048929 Bacteria 10579
271 Ga0496126_0020556 3300048929 Bacteria 6466
272 Ga0496126_0041866 3300048929 Bacteria 4235
273 Ga0496126_0069331 3300048929 Bacteria 3146
274 Ga0496126_0080674 3300048929 Bacteria 2879
275 Ga0496126_0172096 3300048929 Bacteria 1844
276 Ga0496126_0256670 3300048929 Bacteria 1455
277 Ga0501047_0007547 3300049581 Bacteria 10238
278 Ga0501069_0092829 3300049585 Bacteria 1708
279 Ga0501070_0025676 3300049586 Bacteria 4942
280 Ga0501074_0105701 3300049590 Bacteria 2015
281 nmdc:mga03683_34679_c1 3300050489 Bacteria 2043
282 nmdc:mga03n38_300_c1 3300050490 Bacteria 11890
283 nmdc:mga0yw44_54917_c1 3300050492 Bacteria 2422
284 nmdc:mga0yw44_97130_c1 3300050492 Bacteria 1871
285 nmdc:mga06z11_13876_c1 3300050494 Bacteria 3551
286 nmdc:mga06z11_17719_c1 3300050494 Bacteria 3239
287 nmdc:mga04h51_20285_c1 3300050495 Bacteria 1982
288 nmdc:mga05p37_107221_c1 3300050507 Bacteria 3437
289 nmdc:mga0sz30_23074_c1 3300050516 Bacteria 2529
290 Ga0500566_0055768 3300053094 Bacteria 2249
291 Ga0500566_0120786 3300053094 Bacteria 1413
292 Ga0500641_0002178 3300053096 Bacteria 6941
293 Ga0500554_006908 3300053102 Bacteria 2579
294 Ga0500557_000012 3300053105 Bacteria 115728
295 Ga0500572_001683 3300053111 Bacteria 5772
296 Ga0500572_003114 3300053111 Bacteria 3845
297 Ga0500595_000484 3300053119 Bacteria 24498
298 Ga0500595_004664 3300053119 Bacteria 6097
299 Ga0500608_048446 3300053122 Bacteria 2041
300 Ga0500642_0000111 3300053130 Bacteria 38004
301 Ga0500559_0000559 3300053136 Bacteria 25786
302 Ga0500559_0009795 3300053136 Bacteria 4132
303 Ga0500559_0031780 3300053136 Bacteria 2264
304 Ga0500573_0017588 3300053140 Bacteria 4070
305 Ga0500589_025433 3300053147 Bacteria 2741
306 Ga0500603_012400 3300053150 Bacteria 1958
307 Ga0500603_017177 3300053150 Bacteria 1726
308 Ga0500604_0011187 3300053151 Bacteria 2407
309 Ga0500638_000376 3300053162 Bacteria 10431
310 Ga0500636_0007272 3300053177 Bacteria 6399
311 Ga0500636_0116315 3300053177 Bacteria 1505
312 Ga0500637_0000027 3300053178 Bacteria 58759
313 Ga0500625_003227 3300053729 Bacteria 6385
314 Ga0500596_001574 3300053735 Bacteria 4633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0112922 Ga0395898_0112922_1561_2592 311
2 3300005563 Ga0068855_100017166 Ga0068855_10001716610 322
3 3300048924 Ga0496121_0172971 Ga0496121_0172971_14_1078 330
4 3300005983 Ga0081540_1005368 Ga0081540_10053685 341
5 3300053177 Ga0500636_0116315 Ga0500636_0116315_368_1438 347
6 iso_pu_bacteria 2929615660 2929618339 347
7 iso_pu_bacteria 2929624759 2929628976 347
8 iso_pu_bacteria 2933577622 2933580947 347
9 iso_pu_bacteria 8055742211 8055751182 347
10 3300005338 Ga0068868_100162208 Ga0068868_1001622082 365
11 3300037418 Ga0395900_0280284 Ga0395900_0280284_327_1589 370
12 3300046473 Ga0495582_0041949 Ga0495582_0041949_474_1739 370
13 3300047315 Ga0495581_0021220 Ga0495581_0021220_449_1714 370
14 3300033180 Ga0307510_10025468 Ga0307510_100254684 371
15 3300013105 Ga0157369_10022963 Ga0157369_100229633 372
16 3300053094 Ga0500566_0120786 Ga0500566_0120786_38_1168 376
17 3300009177 Ga0105248_10062206 Ga0105248_100622062 377
18 3300014968 Ga0157379_10035093 Ga0157379_100350934 377
19 3300025941 Ga0207711_10033574 Ga0207711_100335743 377
20 3300050489 nmdc:mga03683_34679_c1 nmdc:mga03683_34679_c1_585_1787 378
21 3300037418 Ga0395900_0008844 Ga0395900_0008844_3585_4802 380
22 3300048909 Ga0496106_0093179 Ga0496106_0093179_1093_2316 380
23 3300025261 Ga0209233_1000462 Ga0209233_10004628 383
24 3300025261 Ga0209233_1004673 Ga0209233_10046732 386
25 3300048924 Ga0496121_0175347 Ga0496121_0175347_221_1489 386
26 3300048929 Ga0496126_0020556 Ga0496126_0020556_970_2238 387
27 3300048929 Ga0496126_0080674 Ga0496126_0080674_572_1831 387
28 3300028794 Ga0307515_10021705 Ga0307515_100217057 388
29 3300031730 Ga0307516_10137678 Ga0307516_101376781 388
30 3300005455 Ga0070663_100047207 Ga0070663_1000472072 389
31 3300005548 Ga0070665_100083296 Ga0070665_1000832965 389
32 3300005983 Ga0081540_1003798 Ga0081540_10037985 389
33 3300006042 Ga0075368_10045238 Ga0075368_100452382 389
34 3300006048 Ga0075363_100000579 Ga0075363_10000057911 389
35 3300006178 Ga0075367_10048651 Ga0075367_100486514 389
36 3300006353 Ga0075370_10005748 Ga0075370_100057488 389
37 3300026067 Ga0207678_10004282 Ga0207678_100042822 389
38 3300027866 Ga0209813_10030235 Ga0209813_100302351 389
39 3300028379 Ga0268266_10001398 Ga0268266_1000139812 389
40 3300028786 Ga0307517_10001196 Ga0307517_1000119611 389
41 3300048924 Ga0496121_0123155 Ga0496121_0123155_335_1576 389
42 3300048929 Ga0496126_0256670 Ga0496126_0256670_164_1417 389
43 3300050490 nmdc:mga03n38_300_c1 nmdc:mga03n38_300_c1_2640_3893 389
44 3300050494 nmdc:mga06z11_13876_c1 nmdc:mga06z11_13876_c1_2102_3355 389
45 3300050495 nmdc:mga04h51_20285_c1 nmdc:mga04h51_20285_c1_356_1609 389
46 3300005439 Ga0070711_100022636 Ga0070711_1000226362 390
47 3300048909 Ga0496106_0072391 Ga0496106_0072391_89_1366 390
48 3300048910 Ga0496107_0114159 Ga0496107_0114159_658_1923 390
49 3300005842 Ga0068858_100149794 Ga0068858_1001497942 391
50 3300005937 Ga0081455_10006777 Ga0081455_100067777 391
51 3300009101 Ga0105247_10054924 Ga0105247_100549241 391
52 3300025900 Ga0207710_10055996 Ga0207710_100559962 391
53 3300025934 Ga0207686_10089151 Ga0207686_100891512 391
54 3300026035 Ga0207703_10174261 Ga0207703_101742612 391
55 3300026142 Ga0207698_10080607 Ga0207698_100806073 391
56 3300033442 Ga0315911_1000018 Ga0315911_100001863 391
57 3300035085 Ga0373929_0002551 Ga0373929_0002551_17_1267 391
58 3300048908 Ga0496105_0027521 Ga0496105_0027521_712_1962 391
59 3300048914 Ga0496111_0008912 Ga0496111_0008912_725_1975 391
60 3300048915 Ga0496112_0040771 Ga0496112_0040771_2136_3386 391
61 3300048916 Ga0496113_0038258 Ga0496113_0038258_266_1516 391
62 3300005355 Ga0070671_100042177 Ga0070671_1000421772 392
63 3300005456 Ga0070678_100028544 Ga0070678_1000285442 392
64 3300005546 Ga0070696_100126227 Ga0070696_1001262271 392
65 3300005563 Ga0068855_100018585 Ga0068855_1000185855 392
66 3300005614 Ga0068856_100357628 Ga0068856_1003576281 392
67 3300005615 Ga0070702_100117952 Ga0070702_1001179522 392
68 3300005618 Ga0068864_100045771 Ga0068864_1000457711 392
69 3300005719 Ga0068861_100021725 Ga0068861_1000217253 392
70 3300005844 Ga0068862_100166517 Ga0068862_1001665172 392
71 3300006942 Ga0099824_1006032 Ga0099824_10060322 392
72 3300009545 Ga0105237_10074331 Ga0105237_100743314 392
73 3300009551 Ga0105238_10167206 Ga0105238_101672061 392
74 3300011119 Ga0105246_10030531 Ga0105246_100305312 392
75 3300014325 Ga0163163_10018764 Ga0163163_100187644 392
76 3300037471 Ga0395905_0098079 Ga0395905_0098079_1328_2608 392
77 3300048905 Ga0496102_0337589 Ga0496102_0337589_14_1234 392
78 3300048909 Ga0496106_0121816 Ga0496106_0121816_12_1232 392
79 3300053140 Ga0500573_0017588 Ga0500573_0017588_1012_2256 392
80 3300053735 Ga0500596_001574 Ga0500596_001574_287_1531 392
81 3300005841 Ga0068863_100065855 Ga0068863_1000658554 393
82 3300006943 Ga0099822_1001863 Ga0099822_10018633 393
83 3300013308 Ga0157375_10143634 Ga0157375_101436342 393
84 3300025904 Ga0207647_10029834 Ga0207647_100298342 393
85 3300025914 Ga0207671_10089080 Ga0207671_100890801 393
86 3300025949 Ga0207667_10052854 Ga0207667_100528546 393
87 3300026035 Ga0207703_10064416 Ga0207703_100644164 393
88 3300026116 Ga0207674_10036377 Ga0207674_100363774 393
89 3300026118 Ga0207675_100036080 Ga0207675_1000360803 393
90 3300027357 Ga0209589_1000017 Ga0209589_100001745 393
91 3300027361 Ga0209489_100018 Ga0209489_10001845 393
92 3300027363 Ga0209700_100028 Ga0209700_10002845 393
93 3300031616 Ga0307508_10206982 Ga0307508_102069822 393
94 3300032002 Ga0307416_100320901 Ga0307416_1003209011 393
95 3300033179 Ga0307507_10012119 Ga0307507_100121193 393
96 3300035083 Ga0373926_0012202 Ga0373926_0012202_1068_2312 393
97 3300035692 Ga0373935_0012318 Ga0373935_0012318_2166_3410 393
98 3300035695 Ga0373927_0033321 Ga0373927_0033321_1023_2267 393
99 3300037068 Ga0373925_0113749 Ga0373925_0113749_406_1650 393
100 3300048921 Ga0496118_0125022 Ga0496118_0125022_135_1394 393
101 3300050492 nmdc:mga0yw44_97130_c1 nmdc:mga0yw44_97130_c1_524_1783 393
102 3300053094 Ga0500566_0055768 Ga0500566_0055768_360_1604 393
103 3300053150 Ga0500603_012400 Ga0500603_012400_558_1802 393
104 iso_pu_bacteria 2874604998 2874610423 393
105 3300005455 Ga0070663_100066709 Ga0070663_1000667092 394
106 3300005548 Ga0070665_100059071 Ga0070665_1000590712 394
107 3300005617 Ga0068859_100060081 Ga0068859_1000600812 394
108 3300005719 Ga0068861_100225051 Ga0068861_1002250512 394
109 3300005842 Ga0068858_100060230 Ga0068858_1000602304 394
110 3300006881 Ga0068865_100085053 Ga0068865_1000850532 394
111 3300006931 Ga0097620_100060080 Ga0097620_1000600802 394
112 3300013308 Ga0157375_10311717 Ga0157375_103117171 394
113 3300014968 Ga0157379_10082986 Ga0157379_100829864 394
114 3300021441 Ga0213871_10001609 Ga0213871_100016094 394
115 3300003215 JGI25153J46596_10005214 JGI25153J46596_100052147 395
116 3300025253 Ga0209677_100315 Ga0209677_1003157 395
117 3300025297 Ga0209758_1009608 Ga0209758_10096085 395
118 3300026067 Ga0207678_10004673 Ga0207678_100046739 395
119 3300026067 Ga0207678_10081815 Ga0207678_100818152 395
120 3300028379 Ga0268266_10004536 Ga0268266_100045365 395
121 3300039438 Ga0436360_1173538 Ga0436360_1173538_1352_2677 395
122 3300039447 Ga0436361_0717092 Ga0436361_0717092_1357_2682 395
123 3300046518 Ga0495631_0047410 Ga0495631_0047410_44_1306 395
124 3300046538 Ga0495609_0036931 Ga0495609_0036931_644_1936 395
125 3300046665 Ga0495661_0032289 Ga0495661_0032289_975_2267 395
126 3300048912 Ga0496109_0065175 Ga0496109_0065175_1006_2259 395
127 3300048929 Ga0496126_0041866 Ga0496126_0041866_1520_2788 395
128 3300053136 Ga0500559_0009795 Ga0500559_0009795_105_1349 395
129 3300005539 Ga0068853_100154681 Ga0068853_1001546812 396
130 3300006038 Ga0075365_10092474 Ga0075365_100924742 396
131 3300006038 Ga0075365_10149727 Ga0075365_101497272 396
132 3300006358 Ga0068871_100130012 Ga0068871_1001300122 396
133 3300014969 Ga0157376_10150581 Ga0157376_101505811 396
134 3300053122 Ga0500608_048446 Ga0500608_048446_782_1972 396
135 3300053136 Ga0500559_0031780 Ga0500559_0031780_459_1649 396
136 3300005564 Ga0070664_100114910 Ga0070664_1001149101 397
137 3300006038 Ga0075365_10021404 Ga0075365_100214043 397
138 3300006195 Ga0075366_10115923 Ga0075366_101159232 397
139 3300009551 Ga0105238_10200089 Ga0105238_102000892 397
140 3300025924 Ga0207694_10076668 Ga0207694_100766683 397
141 3300032126 Ga0307415_100012913 Ga0307415_1000129132 397
142 3300046616 Ga0495668_0093023 Ga0495668_0093023_21_1289 397
143 3300048921 Ga0496118_0027449 Ga0496118_0027449_3055_4296 397
144 3300050492 nmdc:mga0yw44_54917_c1 nmdc:mga0yw44_54917_c1_732_2000 397
145 iso_pu_bacteria 2874620515 2874624560 397
146 iso_pu_bacteria 2904666416 2904672101 397
147 3300003354 JGI25160J50197_1002602 JGI25160J50197_10026026 398
148 3300006038 Ga0075365_10172608 Ga0075365_101726081 398
149 3300006186 Ga0075369_10004885 Ga0075369_100048852 398
150 3300013308 Ga0157375_10026697 Ga0157375_100266976 398
151 3300025302 Ga0207426_1000391 Ga0207426_100039141 398
152 3300048904 Ga0496101_0190126 Ga0496101_0190126_61_1323 398
153 3300048928 Ga0496125_0022712 Ga0496125_0022712_558_1802 398
154 3300050516 nmdc:mga0sz30_23074_c1 nmdc:mga0sz30_23074_c1_192_1436 398
155 3300053096 Ga0500641_0002178 Ga0500641_0002178_1126_2385 398
156 3300053147 Ga0500589_025433 Ga0500589_025433_644_1903 398
157 3300053151 Ga0500604_0011187 Ga0500604_0011187_983_2242 398
158 iso_pu_bacteria 2513237096 2513658156 398
159 iso_pu_bacteria 2513237137 2513860239 398
160 iso_pu_bacteria 2513237145 2513920352 398
161 iso_pu_bacteria 2517572143 2517889229 398
162 iso_pu_bacteria 2791355197 2793073257 398
163 iso_pu_bacteria 2885374607 2885376043 398
164 iso_pu_bacteria 2904690495 2904695136 398
165 iso_pu_bacteria 2908739725 2908747824 398
166 iso_pu_bacteria 2908756301 2908756849 398
167 iso_pu_bacteria 2935630451 2935634840 398
168 iso_pu_bacteria 2941507105 2941511830 398
169 iso_pu_bacteria 2941515067 2941519532 398
170 iso_pu_bacteria 2941523033 2941527776 398
171 3300005344 Ga0070661_100054579 Ga0070661_1000545792 399
172 3300005434 Ga0070709_10000815 Ga0070709_1000081519 399
173 3300005436 Ga0070713_100030734 Ga0070713_1000307342 399
174 3300005437 Ga0070710_10003405 Ga0070710_100034052 399
175 3300006163 Ga0070715_10001230 Ga0070715_100012303 399
176 3300006173 Ga0070716_100001910 Ga0070716_1000019109 399
177 3300025906 Ga0207699_10041492 Ga0207699_100414922 399
178 3300025915 Ga0207693_10000564 Ga0207693_1000056416 399
179 3300025916 Ga0207663_10002034 Ga0207663_100020343 399
180 3300025920 Ga0207649_10024340 Ga0207649_100243404 399
181 3300025928 Ga0207700_10170335 Ga0207700_101703352 399
182 3300025929 Ga0207664_10017007 Ga0207664_100170073 399
183 3300025939 Ga0207665_10002339 Ga0207665_100023392 399
184 3300026067 Ga0207678_10047626 Ga0207678_100476263 399
185 iso_pu_bacteria 2728368998 2728754729 399
186 iso_pu_bacteria 2906610324 2906613298 399
187 iso_pu_bacteria 2922425934 2922433794 399
188 iso_pu_bacteria 3005474847 3005475466 399
189 iso_pu_bacteria 8019555841 8019562956 399
190 3300005327 Ga0070658_10084487 Ga0070658_100844872 400
191 3300005337 Ga0070682_100090329 Ga0070682_1000903292 400
192 3300005338 Ga0068868_100002640 Ga0068868_10000264010 400
193 3300005455 Ga0070663_100027226 Ga0070663_1000272263 400
194 3300005535 Ga0070684_100174019 Ga0070684_1001740191 400
195 3300005539 Ga0068853_100321204 Ga0068853_1003212041 400
196 3300005548 Ga0070665_100275244 Ga0070665_1002752442 400
197 3300005564 Ga0070664_100214449 Ga0070664_1002144492 400
198 3300005616 Ga0068852_100045517 Ga0068852_1000455172 400
199 3300005841 Ga0068863_100182763 Ga0068863_1001827633 400
200 3300006237 Ga0097621_100041057 Ga0097621_1000410574 400
201 3300006358 Ga0068871_100042222 Ga0068871_1000422223 400
202 3300009098 Ga0105245_10037585 Ga0105245_100375856 400
203 3300009545 Ga0105237_10153814 Ga0105237_101538142 400
204 3300010375 Ga0105239_10034736 Ga0105239_100347362 400
205 3300011119 Ga0105246_10007907 Ga0105246_100079074 400
206 3300011119 Ga0105246_10097790 Ga0105246_100977902 400
207 3300013296 Ga0157374_10015082 Ga0157374_100150825 400
208 3300013297 Ga0157378_10018217 Ga0157378_100182176 400
209 3300013306 Ga0163162_10013299 Ga0163162_100132992 400
210 3300014325 Ga0163163_10017642 Ga0163163_100176422 400
211 3300014969 Ga0157376_10060038 Ga0157376_100600382 400
212 3300025909 Ga0207705_10074654 Ga0207705_100746542 400
213 3300025920 Ga0207649_10039329 Ga0207649_100393291 400
214 3300025927 Ga0207687_10019855 Ga0207687_100198552 400
215 3300025981 Ga0207640_10145755 Ga0207640_101457552 400
216 3300026023 Ga0207677_10007222 Ga0207677_100072222 400
217 3300026067 Ga0207678_10011829 Ga0207678_100118293 400
218 3300026142 Ga0207698_10094631 Ga0207698_100946312 400
219 3300028379 Ga0268266_10030240 Ga0268266_100302404 400
220 3300046507 Ga0495606_0075374 Ga0495606_0075374_188_1447 400
221 3300048903 Ga0496100_0002345 Ga0496100_0002345_569_1828 400
222 3300048904 Ga0496101_0025769 Ga0496101_0025769_1990_3249 400
223 3300048905 Ga0496102_0001939 Ga0496102_0001939_7436_8695 400
224 3300048906 Ga0496103_0015060 Ga0496103_0015060_2229_3488 400
225 3300048907 Ga0496104_0049466 Ga0496104_0049466_1821_3080 400
226 3300048909 Ga0496106_0003581 Ga0496106_0003581_8452_9711 400
227 3300048910 Ga0496107_0115180 Ga0496107_0115180_542_1801 400
228 3300048911 Ga0496108_0015612 Ga0496108_0015612_4114_5373 400
229 3300048912 Ga0496109_0061961 Ga0496109_0061961_1991_3250 400
230 3300048913 Ga0496110_0054615 Ga0496110_0054615_2107_3366 400
231 3300048914 Ga0496111_0012502 Ga0496111_0012502_3477_4736 400
232 3300048915 Ga0496112_0037425 Ga0496112_0037425_2773_4032 400
233 3300048916 Ga0496113_0081022 Ga0496113_0081022_136_1395 400
234 3300048917 Ga0496114_0016456 Ga0496114_0016456_3314_4573 400
235 3300048918 Ga0496115_0000422 Ga0496115_0000422_18910_20169 400
236 3300050507 nmdc:mga05p37_107221_c1 nmdc:mga05p37_107221_c1_289_1545 400
237 iso_pu_bacteria 2513237098 2513676704 400
238 iso_pu_bacteria 2667528175 2671121489 400
239 iso_pu_bacteria 2903748898 2903758572 400
240 iso_pu_bacteria 2903768456 2903772365 400
241 iso_pu_bacteria 8019565922 8019573037 400
242 iso_pu_bacteria 8056689827 8056694890 400
243 3300006358 Ga0068871_100016689 Ga0068871_1000166897 401
244 iso_pu_bacteria 2524023228 2524536501 401
245 iso_pu_bacteria 2876808645 2876815617 401
246 iso_pu_bacteria 2879110137 2879116476 401
247 iso_pu_bacteria 2885383462 2885384365 401
248 iso_pu_bacteria 2904699407 2904709088 401
249 iso_pu_bacteria 8006933436 8006935831 401
250 iso_pu_bacteria 8006973647 8006975750 401
251 iso_pu_bacteria 8006984368 8006988380 401
252 iso_pu_bacteria 8006994254 8007000765 401
253 3300005983 Ga0081540_1085025 Ga0081540_10850251 402
254 3300046459 Ga0495629_0028304 Ga0495629_0028304_1634_2890 402
255 3300046616 Ga0495668_0122875 Ga0495668_0122875_65_1321 402
256 3300048929 Ga0496126_0172096 Ga0496126_0172096_31_1287 402
257 3300053119 Ga0500595_004664 Ga0500595_004664_1928_3184 402
258 iso_pu_bacteria 2513237101 2513694985 402
259 iso_pu_bacteria 2524023210 2524469770 402
260 iso_pu_bacteria 2721755755 2723841968 402
261 iso_pu_bacteria 2889033259 2889035134 402
262 iso_pu_bacteria 8056673599 8056678543 402
263 iso_pu_bacteria 8056681323 8056685121 402
264 3300005347 Ga0070668_100007829 Ga0070668_1000078297 403
265 3300031730 Ga0307516_10007189 Ga0307516_1000718914 403
266 3300033180 Ga0307510_10000908 Ga0307510_100009086 403
267 3300047318 Ga0495636_0006966 Ga0495636_0006966_894_2144 403
268 3300048909 Ga0496106_0146017 Ga0496106_0146017_310_1521 403
269 3300053729 Ga0500625_003227 Ga0500625_003227_2292_3509 403
270 iso_pu_bacteria 2888388044 2888390901 403
271 3300026067 Ga0207678_10026081 Ga0207678_100260813 404
272 3300028379 Ga0268266_10160215 Ga0268266_101602152 404
273 3300028800 Ga0265338_10029412 Ga0265338_100294122 404
274 3300048928 Ga0496125_0053301 Ga0496125_0053301_983_2236 404
275 3300048929 Ga0496126_0069331 Ga0496126_0069331_1585_2838 404
276 iso_pu_bacteria 2922361189 2922363396 404
277 3300009094 Ga0111539_10281428 Ga0111539_102814283 405
278 3300025916 Ga0207663_10189454 Ga0207663_101894541 405
279 3300028379 Ga0268266_10079213 Ga0268266_100792132 405
280 3300031616 Ga0307508_10136011 Ga0307508_101360112 405
281 3300003659 JGI25404J52841_10008322 JGI25404J52841_100083222 406
282 3300005347 Ga0070668_100051401 Ga0070668_1000514012 406
283 3300005548 Ga0070665_100085503 Ga0070665_1000855032 406
284 3300005578 Ga0068854_100036499 Ga0068854_1000364992 406
285 3300005983 Ga0081540_1001002 Ga0081540_100100210 406
286 3300006048 Ga0075363_100073158 Ga0075363_1000731582 406
287 3300006178 Ga0075367_10089002 Ga0075367_100890022 406
288 3300025972 Ga0207668_10023570 Ga0207668_100235703 406
289 3300033180 Ga0307510_10111698 Ga0307510_101116982 406
290 3300049585 Ga0501069_0092829 Ga0501069_0092829_321_1634 406
291 3300050494 nmdc:mga06z11_17719_c1 nmdc:mga06z11_17719_c1_202_1461 406
292 3300003322 rootL2_10003264 rootL2_100032642 407
293 3300005616 Ga0068852_100134483 Ga0068852_1001344832 407
294 3300009545 Ga0105237_10035202 Ga0105237_100352023 407
295 3300053102 Ga0500554_006908 Ga0500554_006908_375_1661 407
296 3300053119 Ga0500595_000484 Ga0500595_000484_9572_10858 407
297 3300053150 Ga0500603_017177 Ga0500603_017177_97_1383 407
298 3300053162 Ga0500638_000376 Ga0500638_000376_757_2043 407
299 3300053178 Ga0500637_0000027 Ga0500637_0000027_38937_40223 407
300 iso_pu_bacteria 8006926726 8006932835 407
301 3300005336 Ga0070680_100030983 Ga0070680_1000309832 408
302 3300005458 Ga0070681_10007582 Ga0070681_1000758211 408
303 3300005614 Ga0068856_100122448 Ga0068856_1001224482 408
304 3300005618 Ga0068864_100296700 Ga0068864_1002967001 408
305 3300005937 Ga0081455_10014855 Ga0081455_100148552 408
306 3300006175 Ga0070712_100060212 Ga0070712_1000602122 408
307 3300009093 Ga0105240_10042923 Ga0105240_100429236 408
308 3300009101 Ga0105247_10043333 Ga0105247_100433332 408
309 3300013104 Ga0157370_10167578 Ga0157370_101675782 408
310 3300013306 Ga0163162_10226519 Ga0163162_102265192 408
311 3300013308 Ga0157375_10111951 Ga0157375_101119514 408
312 3300025272 Ga0209455_1008088 Ga0209455_10080881 408
313 3300025915 Ga0207693_10075920 Ga0207693_100759203 408
314 3300025936 Ga0207670_10104104 Ga0207670_101041042 408
315 3300045049 Ga0466959_0031583 Ga0466959_0031583_1309_2547 408
316 3300045049 Ga0466959_0097472 Ga0466959_0097472_677_1927 408
317 3300048913 Ga0496110_0230558 Ga0496110_0230558_155_1429 408
318 3300048915 Ga0496112_0130296 Ga0496112_0130296_1117_2391 408
319 3300053111 Ga0500572_001683 Ga0500572_001683_2525_3763 408
320 3300053136 Ga0500559_0000559 Ga0500559_0000559_4994_6232 408
321 3300025297 Ga0209758_1002645 Ga0209758_100264513 409
322 3300039437 Ga0436365_1184167 Ga0436365_1184167_212_1453 409
323 3300005985 Ga0081539_10060310 Ga0081539_100603101 410
324 3300031235 Ga0265330_10018286 Ga0265330_100182861 410
325 3300031507 Ga0307509_10061878 Ga0307509_100618785 410
326 3300048909 Ga0496106_0000480 Ga0496106_0000480_17605_18849 410
327 3300048920 Ga0496117_0021106 Ga0496117_0021106_3130_4374 410
328 3300048921 Ga0496118_0000517 Ga0496118_0000517_41832_43076 410
329 3300048922 Ga0496119_0031989 Ga0496119_0031989_651_1895 410
330 3300048924 Ga0496121_0000814 Ga0496121_0000814_15608_16852 410
331 3300048927 Ga0496124_0001370 Ga0496124_0001370_12612_13856 410
332 3300048928 Ga0496125_0032462 Ga0496125_0032462_2343_3587 410
333 3300048929 Ga0496126_0009132 Ga0496126_0009132_1645_2889 410
334 3300049581 Ga0501047_0007547 Ga0501047_0007547_1624_2877 410
335 3300049586 Ga0501070_0025676 Ga0501070_0025676_3496_4749 410
336 3300049590 Ga0501074_0105701 Ga0501074_0105701_578_1831 410
337 iso_pu_bacteria 2508501042 2508695269 410
338 iso_pu_bacteria 2511231028 2511400128 410
339 iso_pu_bacteria 2513237095 2513647819 410
340 iso_pu_bacteria 2515154112 2515625720 410
341 iso_pu_bacteria 2528768022 2528854106 410
342 iso_pu_bacteria 2816332527 2818237425 410
343 iso_pu_bacteria 2824661429 2824666087 410
344 iso_pu_bacteria 2874590934 2874597009 410
345 iso_pu_bacteria 2874628541 2874629038 410
346 iso_pu_bacteria 2874645413 2874648142 410
347 iso_pu_bacteria 2876771140 2876777473 410
348 iso_pu_bacteria 2876818435 2876825555 410
349 iso_pu_bacteria 2879074833 2879077831 410
350 iso_pu_bacteria 2879127579 2879131344 410
351 iso_pu_bacteria 2879142872 2879145206 410
352 iso_pu_bacteria 2888378607 2888379818 410
353 iso_pu_bacteria 2906626472 2906626574 410
354 iso_pu_bacteria 2922368715 2922378654 410
355 iso_pu_bacteria 2935684952 2935689763 410
356 iso_pu_bacteria 2935713505 2935717283 410
357 iso_pu_bacteria 2935722832 2935724048 410
358 iso_pu_bacteria 2935732158 2935738698 410
359 iso_pu_bacteria 2935741537 2935749054 410
360 iso_pu_bacteria 2935750917 2935757117 410
361 iso_pu_bacteria 2935810662 2935815283 410
362 iso_pu_bacteria 2935908558 2935910208 410
363 iso_pu_bacteria 2935916978 2935918495 410
364 iso_pu_bacteria 2935926038 2935927881 410
365 iso_pu_bacteria 2935934488 2935936247 410
366 iso_pu_bacteria 2935942939 2935944200 410
367 iso_pu_bacteria 2935951376 2935952637 410
368 iso_pu_bacteria 2935967501 2935969477 410
369 iso_pu_bacteria 2935975950 2935977764 410
370 iso_pu_bacteria 2935984226 2935984928 410
371 iso_pu_bacteria 2936037263 2936043350 410
372 iso_pu_bacteria 2936055302 2936056097 410
373 iso_pu_bacteria 2940556831 2940563031 410
374 iso_pu_bacteria 3005506211 3005509399 410
375 iso_pu_bacteria 8016630954 8016635907 410
376 iso_pu_bacteria 8019619141 8019622714 410
377 iso_pu_bacteria 8019629233 8019630389 410
378 iso_pu_bacteria 8019638758 8019640222 410
379 iso_pu_bacteria 8019659431 8019667214 410
380 iso_pu_bacteria 8019668869 8019677000 410
381 iso_pu_bacteria 8019678201 8019678984 410
382 3300005262 Ga0065165_1001383 Ga0065165_100138317 411
383 3300006028 Ga0070717_10041224 Ga0070717_100412242 411
384 3300025302 Ga0207426_1001404 Ga0207426_10014048 411
385 iso_pu_bacteria 2513237092 2513623321 411
386 iso_pu_bacteria 2824600985 2824607875 411
387 iso_pu_bacteria 2824609381 2824615921 411
388 iso_pu_bacteria 2824653114 2824654554 411
389 iso_pu_bacteria 2874612657 2874618738 411
390 iso_pu_bacteria 2885366525 2885371257 411
391 iso_pu_bacteria 2888419890 2888420538 411
392 3300003215 JGI25153J46596_10011041 JGI25153J46596_100110414 414
393 3300004625 Ga0055543_1005540 Ga0055543_10055403 414
394 3300005262 Ga0065165_1002288 Ga0065165_100228817 414
395 3300005983 Ga0081540_1018512 Ga0081540_10185124 414
396 3300006186 Ga0075369_10023141 Ga0075369_100231414 414
397 3300006942 Ga0099824_1004029 Ga0099824_10040292 414
398 3300025230 Ga0209563_101265 Ga0209563_1012658 414
399 3300025261 Ga0209233_1002125 Ga0209233_10021257 414
400 3300025297 Ga0209758_1006753 Ga0209758_10067533 414
401 3300025919 Ga0207657_10225952 Ga0207657_102259521 414
402 3300044901 Ga0466960_0065733 Ga0466960_0065733_241_1485 414
403 3300046507 Ga0495606_0051086 Ga0495606_0051086_306_1550 414
404 3300048915 Ga0496112_0064652 Ga0496112_0064652_489_1733 414
405 3300048916 Ga0496113_0035269 Ga0496113_0035269_1249_2493 414
406 3300048918 Ga0496115_0039928 Ga0496115_0039928_1607_2851 414
407 3300053105 Ga0500557_000012 Ga0500557_000012_71830_73080 414
408 3300053111 Ga0500572_003114 Ga0500572_003114_1471_2721 414
409 3300053130 Ga0500642_0000111 Ga0500642_0000111_32924_34174 414
410 3300053177 Ga0500636_0007272 Ga0500636_0007272_948_2198 414
411 iso_pu_bacteria 2508501009 2508546333 414
412 iso_pu_bacteria 8019687851 8019696537 414
413 3300003215 JGI25153J46596_10000275 JGI25153J46596_100002752 415
414 3300003215 JGI25153J46596_10010524 JGI25153J46596_100105242 415
415 3300003320 rootH2_10113424 rootH2_101134243 415
416 3300003322 rootL2_10003263 rootL2_100032632 415
417 3300025297 Ga0209758_1000182 Ga0209758_100018247 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13365

Trypsin_2

Trypsin-like peptidase domain

256

390

0.85

PF00089

Trypsin

Trypsin

241

422

0.76

Feature Viewer

pLDDT pTM Quality
70.02 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map