F438969

General Info

Members Datasets Scaffolds Average Seq Length
417 244 834 157

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100056921|Ga0070683_1000569214
Length 155
Sequence MRKRLITPTPPTVRSHAEGWLDVERAAVVEITSEEKDYPIESAFVSGPGWRAAEPGPQTIRLLFDQPQRLKRISLVFEENKFSRMQEFVLRWSSGGGTSFREIVRQQWNFNPPETIREVEEYQVELANVTMLELIVTPDKSGGIARASLKSMRLS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.88
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 23.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100056921 3300005329 Bacteria 3631
2 Ga0070658_10411026 3300005327 Bacteria 1163
3 Ga0070683_100025211 3300005329 Bacteria 5337
4 Ga0070670_100012911 3300005331 Bacteria 7151
5 Ga0070666_10066988 3300005335 Bacteria 2438
6 Ga0070680_100359522 3300005336 Unclassified 1238
7 Ga0070682_100397276 3300005337 Bacteria 1042
8 Ga0068868_100040910 3300005338 Bacteria 3609
9 Ga0070660_100075054 3300005339 Bacteria 2647
10 Ga0070689_100027354 3300005340 Bacteria 4299
11 Ga0070687_100090102 3300005343 Bacteria 1694
12 Ga0070687_100326400 3300005343 Bacteria 982
13 Ga0070661_100036965 3300005344 Bacteria 3551
14 Ga0070661_100046158 3300005344 Bacteria 3187
15 Ga0070668_100150043 3300005347 Bacteria 1884
16 Ga0070668_100586114 3300005347 Bacteria 974
17 Ga0070669_100019209 3300005353 Bacteria 4882
18 Ga0070675_100036857 3300005354 Bacteria 3982
19 Ga0070675_100501777 3300005354 Unclassified 1093
20 Ga0070671_100048626 3300005355 Bacteria 3527
21 Ga0070671_100215373 3300005355 Bacteria 1629
22 Ga0070673_100021983 3300005364 Bacteria 4635
23 Ga0070659_100105738 3300005366 Bacteria 2268
24 Ga0070659_100281318 3300005366 Bacteria 1384
25 Ga0070667_100163446 3300005367 Bacteria 1962
26 Ga0070709_10072385 3300005434 Bacteria 2228
27 Ga0070709_10170476 3300005434 Bacteria 1520
28 Ga0070709_10232320 3300005434 Bacteria 1320
29 Ga0070709_10500552 3300005434 Unclassified 923
30 Ga0070714_100001429 3300005435 Bacteria 17358
31 Ga0070714_100152547 3300005435 Unclassified 2083
32 Ga0070713_100042961 3300005436 Bacteria 3693
33 Ga0070713_100164617 3300005436 Bacteria 1982
34 Ga0070713_100253430 3300005436 Bacteria 1606
35 Ga0070713_100742642 3300005436 Unclassified 938
36 Ga0070710_10026639 3300005437 Unclassified 3074
37 Ga0070710_10174946 3300005437 Bacteria 1340
38 Ga0070710_10379974 3300005437 Unclassified 942
39 Ga0070711_100047420 3300005439 Unclassified 2933
40 Ga0070711_100061154 3300005439 Unclassified 2621
41 Ga0070711_100061641 3300005439 Bacteria 2611
42 Ga0070711_100429684 3300005439 Bacteria 1078
43 Ga0070711_100476499 3300005439 Bacteria 1025
44 Ga0070705_100303305 3300005440 Unclassified 1145
45 Ga0070705_100350896 3300005440 Bacteria 1076
46 Ga0070708_100044383 3300005445 Unclassified 3908
47 Ga0070708_100431107 3300005445 Bacteria 1243
48 Ga0070708_100646903 3300005445 Bacteria 996
49 Ga0070708_100927131 3300005445 Unclassified 817
50 Ga0070663_100044599 3300005455 Bacteria 3127
51 Ga0070678_100382383 3300005456 Bacteria 1218
52 Ga0070662_101101325 3300005457 Unclassified 681
53 Ga0070681_10004925 3300005458 Bacteria 12830
54 Ga0070681_10071656 3300005458 Bacteria 3430
55 Ga0070681_10168932 3300005458 Bacteria 2109
56 Ga0068867_100004411 3300005459 Bacteria 9898
57 Ga0068867_100181650 3300005459 Bacteria 1673
58 Ga0070685_10039896 3300005466 Bacteria 2670
59 Ga0070685_10090771 3300005466 Bacteria 1848
60 Ga0070706_100014613 3300005467 Bacteria 7255
61 Ga0070706_100696020 3300005467 Bacteria 943
62 Ga0070707_101646781 3300005468 Unclassified 609
63 Ga0070699_100623001 3300005518 Unclassified 984
64 Ga0070699_101517657 3300005518 Bacteria 614
65 Ga0070679_100102984 3300005530 Unclassified 2841
66 Ga0070679_100113903 3300005530 Bacteria 2690
67 Ga0070679_100942012 3300005530 Bacteria 807
68 Ga0070684_100023567 3300005535 Bacteria 5152
69 Ga0070697_100026353 3300005536 Unclassified 4643
70 Ga0070697_100129268 3300005536 Bacteria 2117
71 Ga0068853_100624340 3300005539 Bacteria 1024
72 Ga0070672_100024224 3300005543 Bacteria 4482
73 Ga0070672_100739186 3300005543 Bacteria 863
74 Ga0070686_100248853 3300005544 Bacteria 1297
75 Ga0070696_100108878 3300005546 Bacteria 1993
76 Ga0070693_100314852 3300005547 Bacteria 1060
77 Ga0070665_100536005 3300005548 Unclassified 1182
78 Ga0070704_100791476 3300005549 Bacteria 847
79 Ga0068855_100084497 3300005563 Bacteria 3674
80 Ga0068855_100097355 3300005563 Unclassified 3389
81 Ga0068855_100907909 3300005563 Unclassified 930
82 Ga0070664_100014691 3300005564 Bacteria 6394
83 Ga0070664_100044728 3300005564 Bacteria 3738
84 Ga0068857_100004266 3300005577 Bacteria 12052
85 Ga0068857_100007098 3300005577 Bacteria 9647
86 Ga0068857_100598805 3300005577 Bacteria 1042
87 Ga0068856_100001717 3300005614 Bacteria 22914
88 Ga0068856_100004970 3300005614 Bacteria 13164
89 Ga0068856_100700663 3300005614 Unclassified 1033
90 Ga0068856_100916277 3300005614 Unclassified 895
91 Ga0068856_101150771 3300005614 Bacteria 793
92 Ga0068852_100412357 3300005616 Bacteria 1331
93 Ga0068859_100024126 3300005617 Bacteria 6103
94 Ga0068859_100064152 3300005617 Bacteria 3705
95 Ga0068859_100763735 3300005617 Bacteria 1055
96 Ga0068864_100016748 3300005618 Bacteria 6108
97 Ga0068864_100020410 3300005618 Bacteria 5543
98 Ga0068866_10020380 3300005718 Bacteria 3037
99 Ga0068861_100309870 3300005719 Unclassified 1371
100 Ga0068851_10253879 3300005834 Bacteria 998
101 Ga0068851_10528562 3300005834 Bacteria 710
102 Ga0068870_10184838 3300005840 Bacteria 1254
103 Ga0068858_100033721 3300005842 Bacteria 4748
104 Ga0068858_100211044 3300005842 Bacteria 1837
105 Ga0068858_100558998 3300005842 Bacteria 1108
106 Ga0068860_100026758 3300005843 Bacteria 5558
107 Ga0068860_100027934 3300005843 Bacteria 5433
108 Ga0068860_100063187 3300005843 Bacteria 3517
109 Ga0068860_100171308 3300005843 Bacteria 2097
110 Ga0068862_100022830 3300005844 Bacteria 5237
111 Ga0068862_100083998 3300005844 Bacteria 2766
112 Ga0081538_10020262 3300005981 Bacteria 4905
113 Ga0070717_10049715 3300006028 Unclassified 3443
114 Ga0070717_10090317 3300006028 Bacteria 2584
115 Ga0070717_10350215 3300006028 Unclassified 1320
116 Ga0070715_10027692 3300006163 Unclassified 2266
117 Ga0070715_10051621 3300006163 Bacteria 1770
118 Ga0070715_10508645 3300006163 Unclassified 691
119 Ga0070715_10567036 3300006163 Unclassified 660
120 Ga0070716_100002663 3300006173 Bacteria 8260
121 Ga0070716_100032373 3300006173 Bacteria 2851
122 Ga0070716_100058464 3300006173 Unclassified 2219
123 Ga0070716_100239087 3300006173 Unclassified 1230
124 Ga0070716_100444277 3300006173 Unclassified 944
125 Ga0070716_101052391 3300006173 Unclassified 646
126 Ga0070712_100019378 3300006175 Unclassified 4437
127 Ga0070712_100065069 3300006175 Unclassified 2587
128 Ga0070712_100068644 3300006175 Unclassified 2527
129 Ga0070712_100081168 3300006175 Bacteria 2349
130 Ga0070712_100347348 3300006175 Bacteria 1213
131 Ga0070712_100510394 3300006175 Bacteria 1009
132 Ga0097621_100065574 3300006237 Bacteria 2989
133 Ga0097621_101570485 3300006237 Unclassified 625
134 Ga0068871_100059972 3300006358 Bacteria 3102
135 Ga0068871_100076129 3300006358 Bacteria 2771
136 Ga0075433_10085915 3300006852 Bacteria 2778
137 Ga0075434_100014895 3300006871 Bacteria 7438
138 Ga0068865_100030909 3300006881 Bacteria 3566
139 Ga0068865_100248585 3300006881 Bacteria 1403
140 Ga0075436_100011150 3300006914 Bacteria 6164
141 Ga0075436_100298498 3300006914 Unclassified 1154
142 Ga0075436_100719131 3300006914 Unclassified 740
143 Ga0097620_100024125 3300006931 Bacteria 6103
144 Ga0097620_100064160 3300006931 Bacteria 3705
145 Ga0097620_100763664 3300006931 Bacteria 1055
146 Ga0075435_100010397 3300007076 Bacteria 6807
147 Ga0099794_10640337 3300007265 Unclassified 564
148 Ga0099795_10176470 3300007788 Unclassified 890
149 Ga0105240_10059734 3300009093 Unclassified 4757
150 Ga0105240_11205493 3300009093 Bacteria 801
151 Ga0105240_11857543 3300009093 Unclassified 627
152 Ga0105245_10263189 3300009098 Bacteria 1679
153 Ga0105245_10306970 3300009098 Bacteria 1559
154 Ga0105245_10429301 3300009098 Bacteria 1326
155 Ga0105247_10100187 3300009101 Bacteria 1851
156 Ga0114129_10009645 3300009147 Bacteria 13776
157 Ga0114129_10250057 3300009147 Bacteria 2380
158 Ga0105243_10052539 3300009148 Bacteria 3228
159 Ga0105241_10131750 3300009174 Bacteria 2025
160 Ga0105242_10061773 3300009176 Bacteria 3082
161 Ga0105248_10068520 3300009177 Bacteria 3983
162 Ga0105248_10135664 3300009177 Bacteria 2776
163 Ga0105248_10713467 3300009177 Bacteria 1132
164 Ga0105237_10422975 3300009545 Unclassified 1338
165 Ga0105237_11093682 3300009545 Unclassified 804
166 Ga0105249_10811141 3300009553 Unclassified 1000
167 Ga0105239_10232822 3300010375 Bacteria 2067
168 Ga0105239_11679505 3300010375 Bacteria 735
169 Ga0105246_10242145 3300011119 Bacteria 1426
170 Ga0157373_10589251 3300013100 Unclassified 809
171 Ga0157370_10718125 3300013104 Bacteria 912
172 Ga0157369_10416502 3300013105 Bacteria 1393
173 Ga0157374_10000879 3300013296 Bacteria 26216
174 Ga0157374_10164545 3300013296 Bacteria 2161
175 Ga0157374_10497180 3300013296 Bacteria 1224
176 Ga0157378_10000612 3300013297 Bacteria 33518
177 Ga0157378_10035251 3300013297 Bacteria 4425
178 Ga0157378_10077857 3300013297 Bacteria 2990
179 Ga0163162_10023925 3300013306 Bacteria 6028
180 Ga0163162_10054763 3300013306 Bacteria 4013
181 Ga0157372_10027846 3300013307 Bacteria 6159
182 Ga0157372_10246107 3300013307 Bacteria 2075
183 Ga0157372_10332032 3300013307 Bacteria 1771
184 Ga0157372_10970061 3300013307 Bacteria 985
185 Ga0157375_10073410 3300013308 Unclassified 3440
186 Ga0163163_10021461 3300014325 Bacteria 6095
187 Ga0163163_10171319 3300014325 Bacteria 2217
188 Ga0157379_10016500 3300014968 Bacteria 6496
189 Ga0157379_10064848 3300014968 Unclassified 3264
190 Ga0157379_11047603 3300014968 Bacteria 779
191 Ga0157376_10021757 3300014969 Bacteria 4983
192 Ga0163161_10833351 3300017792 Unclassified 777
193 Ga0206350_11349264 3300020080 Bacteria 778
194 Ga0206353_11269726 3300020082 Bacteria 841
195 Ga0213874_10115844 3300021377 Bacteria 906
196 Ga0224712_10427211 3300022467 Bacteria 634
197 Ga0224572_1023444 3300024225 Bacteria 1185
198 Ga0228598_1001302 3300024227 Bacteria 5483
199 Ga0228598_1019776 3300024227 Unclassified 1326
200 Ga0207656_10392145 3300025321 Bacteria 697
201 Ga0207692_10145357 3300025898 Unclassified 1353
202 Ga0207642_10007581 3300025899 Bacteria 3673
203 Ga0207642_10256502 3300025899 Bacteria 995
204 Ga0207688_10078930 3300025901 Bacteria 1877
205 Ga0207688_10420234 3300025901 Bacteria 831
206 Ga0207680_10117960 3300025903 Bacteria 1732
207 Ga0207647_10013807 3300025904 Bacteria 5593
208 Ga0207685_10060745 3300025905 Bacteria 1496
209 Ga0207685_10074799 3300025905 Bacteria 1384
210 Ga0207685_10098210 3300025905 Bacteria 1247
211 Ga0207685_10447784 3300025905 Unclassified 671
212 Ga0207699_10121765 3300025906 Bacteria 1688
213 Ga0207699_10341899 3300025906 Bacteria 1054
214 Ga0207643_10108112 3300025908 Bacteria 1636
215 Ga0207684_10003462 3300025910 Bacteria 15399
216 Ga0207684_10064978 3300025910 Bacteria 3098
217 Ga0207684_10674719 3300025910 Bacteria 879
218 Ga0207654_10936795 3300025911 Bacteria 629
219 Ga0207707_10037365 3300025912 Bacteria 4244
220 Ga0207695_10100264 3300025913 Unclassified 2892
221 Ga0207671_10700827 3300025914 Unclassified 805
222 Ga0207693_10004147 3300025915 Bacteria 12297
223 Ga0207693_10035361 3300025915 Bacteria 3939
224 Ga0207693_10069767 3300025915 Unclassified 2750
225 Ga0207693_10130245 3300025915 Unclassified 1977
226 Ga0207693_10161946 3300025915 Unclassified 1760
227 Ga0207693_10179940 3300025915 Bacteria 1663
228 Ga0207693_10317665 3300025915 Bacteria 1219
229 Ga0207663_10071074 3300025916 Bacteria 2245
230 Ga0207663_10121674 3300025916 Bacteria 1788
231 Ga0207663_10280268 3300025916 Bacteria 1238
232 Ga0207663_11332112 3300025916 Unclassified 578
233 Ga0207660_10308145 3300025917 Unclassified 1262
234 Ga0207657_10055732 3300025919 Bacteria 3413
235 Ga0207649_10031446 3300025920 Bacteria 3155
236 Ga0207652_10088032 3300025921 Bacteria 2724
237 Ga0207652_11153703 3300025921 Bacteria 676
238 Ga0207646_10034057 3300025922 Unclassified 4603
239 Ga0207646_11023283 3300025922 Unclassified 729
240 Ga0207681_10023444 3300025923 Bacteria 3948
241 Ga0207694_10027612 3300025924 Unclassified 4323
242 Ga0207650_10000090 3300025925 Bacteria 118973
243 Ga0207650_10014974 3300025925 Bacteria 5394
244 Ga0207659_10113162 3300025926 Bacteria 2066
245 Ga0207687_10358774 3300025927 Unclassified 1189
246 Ga0207700_10140471 3300025928 Bacteria 1984
247 Ga0207700_10251205 3300025928 Bacteria 1511
248 Ga0207700_10575491 3300025928 Unclassified 1001
249 Ga0207664_10000033 3300025929 Bacteria 176549
250 Ga0207664_10538285 3300025929 Unclassified 1047
251 Ga0207644_10078457 3300025931 Bacteria 2434
252 Ga0207690_10144706 3300025932 Bacteria 1756
253 Ga0207690_10509411 3300025932 Unclassified 974
254 Ga0207686_10125226 3300025934 Bacteria 1755
255 Ga0207709_10106592 3300025935 Bacteria 1864
256 Ga0207670_10119215 3300025936 Bacteria 1915
257 Ga0207704_10012412 3300025938 Bacteria 4230
258 Ga0207704_11361010 3300025938 Bacteria 608
259 Ga0207665_10000173 3300025939 Bacteria 43183
260 Ga0207665_10002360 3300025939 Bacteria 12747
261 Ga0207665_10015628 3300025939 Bacteria 4982
262 Ga0207665_10022136 3300025939 Bacteria 4178
263 Ga0207665_10051002 3300025939 Bacteria 2784
264 Ga0207665_10104926 3300025939 Bacteria 1979
265 Ga0207665_10474500 3300025939 Bacteria 963
266 Ga0207691_10037179 3300025940 Bacteria 4510
267 Ga0207711_10127042 3300025941 Bacteria 2282
268 Ga0207711_10159595 3300025941 Bacteria 2040
269 Ga0207689_10058806 3300025942 Bacteria 3162
270 Ga0207689_10071960 3300025942 Bacteria 2840
271 Ga0207661_10013851 3300025944 Bacteria 5894
272 Ga0207661_10234769 3300025944 Unclassified 1625
273 Ga0207679_10004118 3300025945 Bacteria 9029
274 Ga0207679_10068753 3300025945 Bacteria 2662
275 Ga0207667_10003088 3300025949 Bacteria 20634
276 Ga0207667_10267053 3300025949 Bacteria 1749
277 Ga0207667_10495953 3300025949 Bacteria 1239
278 Ga0207667_10680360 3300025949 Bacteria 1032
279 Ga0207651_10044357 3300025960 Bacteria 2975
280 Ga0207658_10254456 3300025986 Bacteria 1494
281 Ga0207658_10505324 3300025986 Bacteria 1077
282 Ga0207703_10022398 3300026035 Bacteria 4955
283 Ga0207703_10600440 3300026035 Bacteria 1041
284 Ga0207639_12029067 3300026041 Bacteria 536
285 Ga0207678_10046048 3300026067 Bacteria 3772
286 Ga0207708_11556565 3300026075 Unclassified 581
287 Ga0207702_10004569 3300026078 Bacteria 12264
288 Ga0207702_10041387 3300026078 Bacteria 3864
289 Ga0207702_10904760 3300026078 Unclassified 874
290 Ga0207641_10001842 3300026088 Bacteria 20372
291 Ga0207648_10010690 3300026089 Bacteria 8674
292 Ga0207648_10199814 3300026089 Bacteria 1773
293 Ga0207676_10004619 3300026095 Bacteria 9750
294 Ga0207674_10002952 3300026116 Bacteria 21117
295 Ga0207674_10022509 3300026116 Bacteria 6766
296 Ga0207674_10206906 3300026116 Bacteria 1911
297 Ga0207675_101521835 3300026118 Unclassified 690
298 Ga0207698_10012430 3300026142 Bacteria 5570
299 Ga0207698_10457260 3300026142 Bacteria 1234
300 Ga0209179_1071857 3300027512 Bacteria 759
301 Ga0265356_1000486 3300028017 Bacteria 7176
302 Ga0268266_10007211 3300028379 Bacteria 10055
303 Ga0268265_10053823 3300028380 Bacteria 3050
304 Ga0268265_10229677 3300028380 Bacteria 1630
305 Ga0268264_10017076 3300028381 Bacteria 5943
306 Ga0268264_10033007 3300028381 Bacteria 4249
307 Ga0268264_10212737 3300028381 Bacteria 1776
308 Ga0265762_1002800 3300030760 Bacteria 3118
309 Ga0316576_10043438 3300031727 Bacteria 3243
310 Ga0373926_0100502 3300035083 Bacteria 1081
311 Ga0373926_0308623 3300035083 Bacteria 618
312 Ga0373923_0017358 3300035111 Unclassified 2752
313 Ga0373936_0003175 3300035113 Bacteria 6152
314 Ga0373936_0220213 3300035113 Unclassified 842
315 Ga0373945_0001135 3300035116 Bacteria 8053
316 Ga0373945_0194897 3300035116 Unclassified 839
317 Ga0373953_0034451 3300035117 Bacteria 1985
318 Ga0373953_0074487 3300035117 Bacteria 1404
319 Ga0373954_0059584 3300035118 Bacteria 1799
320 Ga0373943_0000108 3300035170 Bacteria 30482
321 Ga0373943_0365398 3300035170 Unclassified 829
322 Ga0373955_0306230 3300035172 Bacteria 958
323 Ga0316574_0471151 3300035398 Unclassified 785
324 Ga0373924_0020763 3300035410 Bacteria 2556
325 Ga0373924_0368980 3300035410 Unclassified 640
326 Ga0373931_0338856 3300035691 Unclassified 938
327 Ga0373935_0001684 3300035692 Bacteria 12353
328 Ga0373935_0133435 3300035692 Bacteria 1671
329 Ga0373927_0000122 3300035695 Bacteria 59292
330 Ga0373927_0073244 3300035695 Bacteria 2218
331 Ga0373927_0107747 3300035695 Unclassified 1815
332 Ga0373933_0092172 3300035724 Bacteria 1871
333 Ga0373933_0104264 3300035724 Unclassified 1762
334 Ga0373933_0661426 3300035724 Bacteria 687
335 Ga0373947_0001126 3300035725 Bacteria 16399
336 Ga0373947_0701205 3300035725 Unclassified 691
337 Ga0373937_0028039 3300036401 Bacteria 5094
338 Ga0373937_0189223 3300036401 Bacteria 1934
339 Ga0373937_0626776 3300036401 Bacteria 1020
340 Ga0373937_1215201 3300036401 Unclassified 702
341 Ga0316584_0127812 3300036712 Bacteria 1898
342 Ga0373925_0000661 3300037068 Bacteria 32361
343 Ga0373925_0474387 3300037068 Bacteria 1026
344 Ga0395900_0721254 3300037418 Unclassified 929
345 Ga0395905_0005416 3300037471 Bacteria 13042
346 Ga0436365_1094976 3300039437 Bacteria 1381
347 Ga0436360_0997819 3300039438 Bacteria 1257
348 Ga0436361_0408950 3300039447 Bacteria 1066
349 Ga0436363_0589771 3300039450 Bacteria 3868
350 Ga0439441_093081 3300042001 Bacteria 668
351 Ga0439455_0024009 3300042012 Bacteria 1472
352 Ga0439458_0077632 3300042157 Bacteria 844
353 Ga0453683_0467804 3300044673 Unclassified 816
354 Ga0453684_0000539 3300044712 Bacteria 143526
355 Ga0453684_0218432 3300044712 Bacteria 2210
356 Ga0451576_0249511 3300045051 Unclassified 1855
357 Ga0451576_0479270 3300045051 Unclassified 1307
358 Ga0495651_0164054 3300046462 Bacteria 1589
359 Ga0495653_0504080 3300046463 Unclassified 754
360 Ga0495580_0016206 3300046472 Bacteria 5600
361 Ga0495580_0023540 3300046472 Bacteria 4520
362 Ga0495580_0034298 3300046472 Bacteria 3654
363 Ga0495580_0248489 3300046472 Unclassified 1218
364 Ga0495582_0090979 3300046473 Unclassified 1701
365 Ga0495664_0171661 3300046477 Bacteria 1315
366 Ga0495594_0072856 3300046499 Bacteria 1911
367 Ga0495608_0277113 3300046511 Bacteria 1042
368 Ga0495630_0061409 3300046517 Bacteria 2822
369 Ga0495630_0712767 3300046517 Bacteria 767
370 Ga0495665_0029792 3300046531 Plasmid 2923
371 Ga0495665_0468426 3300046531 Unclassified 636
372 Ga0495587_0010998 3300046536 Bacteria 5741
373 Ga0495587_0169562 3300046536 Bacteria 1240
374 Ga0495667_0221517 3300046559 Unclassified 1207
375 Ga0495635_0646284 3300046663 Unclassified 688
376 Ga0495623_0364795 3300046679 Unclassified 784
377 Ga0495646_0348725 3300046680 Unclassified 776
378 Ga0495658_0580808 3300046683 Unclassified 718
379 Ga0495669_0002467 3300046684 Bacteria 7553
380 Ga0495604_0016648 3300047317 Bacteria 5879
381 Ga0495604_0407850 3300047317 Bacteria 894
382 Ga0495674_0104446 3300047319 Unclassified 2408
383 Ga0495674_0248231 3300047319 Unclassified 1465
384 Ga0495684_0588436 3300047471 Unclassified 752
385 Ga0495602_0117896 3300048088 Bacteria 2142
386 Ga0495602_0665106 3300048088 Bacteria 710
387 Ga0496102_0024700 3300048905 Bacteria 5345
388 Ga0496102_1245551 3300048905 Unclassified 663
389 Ga0496103_0119061 3300048906 Bacteria 1681
390 Ga0496104_0151383 3300048907 Bacteria 2227
391 Ga0496106_0099059 3300048909 Bacteria 2259
392 Ga0496107_0105503 3300048910 Unclassified 2069
393 Ga0496108_0096729 3300048911 Bacteria 2515
394 Ga0496110_0043752 3300048913 Bacteria 3910
395 Ga0496111_0074367 3300048914 Bacteria 2475
396 Ga0496112_0014309 3300048915 Bacteria 7351
397 Ga0496113_0016771 3300048916 Bacteria 5067
398 Ga0496115_1130642 3300048918 Unclassified 592
399 Ga0501036_1038004 3300049572 Bacteria 670
400 Ga0501039_0169423 3300049575 Bacteria 1717
401 Ga0501040_0009954 3300049576 Bacteria 6209
402 Ga0501042_0185447 3300049578 Bacteria 1501
403 Ga0501048_0034385 3300049582 Bacteria 3657
404 Ga0501071_1233801 3300049587 Bacteria 578
405 Ga0501073_0250371 3300049589 Bacteria 1223
406 Ga0501075_0020636 3300049591 Bacteria 4795
407 Ga0501076_0066494 3300049592 Bacteria 2877
408 Ga0501077_0942327 3300049593 Bacteria 555
409 Ga0501079_0022277 3300049741 Bacteria 4857
410 Ga0501080_0069788 3300049742 Bacteria 3269
411 Ga0501081_0016274 3300049743 Bacteria 4915
412 Ga0501045_0271939 3300049824 Bacteria 1261
413 nmdc:mga0rr50_8445_c1 3300050513 Bacteria 6413
414 nmdc:mga08x19_11743_c1 3300050514 Bacteria 5275
415 nmdc:mga0a205_21363_c1 3300050515 Bacteria 6124
416 Ga0501084_0017399 3300054114 Bacteria 5976
417 Ga0501082_1570411 3300060353 Bacteria 574
418 Ga0070683_100056921
419 Ga0070658_10411026
420 Ga0070683_100025211
421 Ga0070670_100012911
422 Ga0070666_10066988
423 Ga0070680_100359522
424 Ga0070682_100397276
425 Ga0068868_100040910
426 Ga0070660_100075054
427 Ga0070689_100027354
428 Ga0070687_100090102
429 Ga0070687_100326400
430 Ga0070661_100036965
431 Ga0070661_100046158
432 Ga0070668_100150043
433 Ga0070668_100586114
434 Ga0070669_100019209
435 Ga0070675_100036857
436 Ga0070675_100501777
437 Ga0070671_100048626
438 Ga0070671_100215373
439 Ga0070673_100021983
440 Ga0070659_100105738
441 Ga0070659_100281318
442 Ga0070667_100163446
443 Ga0070709_10072385
444 Ga0070709_10170476
445 Ga0070709_10232320
446 Ga0070709_10500552
447 Ga0070714_100001429
448 Ga0070714_100152547
449 Ga0070713_100042961
450 Ga0070713_100164617
451 Ga0070713_100253430
452 Ga0070713_100742642
453 Ga0070710_10026639
454 Ga0070710_10174946
455 Ga0070710_10379974
456 Ga0070711_100047420
457 Ga0070711_100061154
458 Ga0070711_100061641
459 Ga0070711_100429684
460 Ga0070711_100476499
461 Ga0070705_100303305
462 Ga0070705_100350896
463 Ga0070708_100044383
464 Ga0070708_100431107
465 Ga0070708_100646903
466 Ga0070708_100927131
467 Ga0070663_100044599
468 Ga0070678_100382383
469 Ga0070662_101101325
470 Ga0070681_10004925
471 Ga0070681_10071656
472 Ga0070681_10168932
473 Ga0068867_100004411
474 Ga0068867_100181650
475 Ga0070685_10039896
476 Ga0070685_10090771
477 Ga0070706_100014613
478 Ga0070706_100696020
479 Ga0070707_101646781
480 Ga0070699_100623001
481 Ga0070699_101517657
482 Ga0070679_100102984
483 Ga0070679_100113903
484 Ga0070679_100942012
485 Ga0070684_100023567
486 Ga0070697_100026353
487 Ga0070697_100129268
488 Ga0068853_100624340
489 Ga0070672_100024224
490 Ga0070672_100739186
491 Ga0070686_100248853
492 Ga0070696_100108878
493 Ga0070693_100314852
494 Ga0070665_100536005
495 Ga0070704_100791476
496 Ga0068855_100084497
497 Ga0068855_100097355
498 Ga0068855_100907909
499 Ga0070664_100014691
500 Ga0070664_100044728
501 Ga0068857_100004266
502 Ga0068857_100007098
503 Ga0068857_100598805
504 Ga0068856_100001717
505 Ga0068856_100004970
506 Ga0068856_100700663
507 Ga0068856_100916277
508 Ga0068856_101150771
509 Ga0068852_100412357
510 Ga0068859_100024126
511 Ga0068859_100064152
512 Ga0068859_100763735
513 Ga0068864_100016748
514 Ga0068864_100020410
515 Ga0068866_10020380
516 Ga0068861_100309870
517 Ga0068851_10253879
518 Ga0068851_10528562
519 Ga0068870_10184838
520 Ga0068858_100033721
521 Ga0068858_100211044
522 Ga0068858_100558998
523 Ga0068860_100026758
524 Ga0068860_100027934
525 Ga0068860_100063187
526 Ga0068860_100171308
527 Ga0068862_100022830
528 Ga0068862_100083998
529 Ga0081538_10020262
530 Ga0070717_10049715
531 Ga0070717_10090317
532 Ga0070717_10350215
533 Ga0070715_10027692
534 Ga0070715_10051621
535 Ga0070715_10508645
536 Ga0070715_10567036
537 Ga0070716_100002663
538 Ga0070716_100032373
539 Ga0070716_100058464
540 Ga0070716_100239087
541 Ga0070716_100444277
542 Ga0070716_101052391
543 Ga0070712_100019378
544 Ga0070712_100065069
545 Ga0070712_100068644
546 Ga0070712_100081168
547 Ga0070712_100347348
548 Ga0070712_100510394
549 Ga0097621_100065574
550 Ga0097621_101570485
551 Ga0068871_100059972
552 Ga0068871_100076129
553 Ga0075433_10085915
554 Ga0075434_100014895
555 Ga0068865_100030909
556 Ga0068865_100248585
557 Ga0075436_100011150
558 Ga0075436_100298498
559 Ga0075436_100719131
560 Ga0097620_100024125
561 Ga0097620_100064160
562 Ga0097620_100763664
563 Ga0075435_100010397
564 Ga0099794_10640337
565 Ga0099795_10176470
566 Ga0105240_10059734
567 Ga0105240_11205493
568 Ga0105240_11857543
569 Ga0105245_10263189
570 Ga0105245_10306970
571 Ga0105245_10429301
572 Ga0105247_10100187
573 Ga0114129_10009645
574 Ga0114129_10250057
575 Ga0105243_10052539
576 Ga0105241_10131750
577 Ga0105242_10061773
578 Ga0105248_10068520
579 Ga0105248_10135664
580 Ga0105248_10713467
581 Ga0105237_10422975
582 Ga0105237_11093682
583 Ga0105249_10811141
584 Ga0105239_10232822
585 Ga0105239_11679505
586 Ga0105246_10242145
587 Ga0157373_10589251
588 Ga0157370_10718125
589 Ga0157369_10416502
590 Ga0157374_10000879
591 Ga0157374_10164545
592 Ga0157374_10497180
593 Ga0157378_10000612
594 Ga0157378_10035251
595 Ga0157378_10077857
596 Ga0163162_10023925
597 Ga0163162_10054763
598 Ga0157372_10027846
599 Ga0157372_10246107
600 Ga0157372_10332032
601 Ga0157372_10970061
602 Ga0157375_10073410
603 Ga0163163_10021461
604 Ga0163163_10171319
605 Ga0157379_10016500
606 Ga0157379_10064848
607 Ga0157379_11047603
608 Ga0157376_10021757
609 Ga0163161_10833351
610 Ga0206350_11349264
611 Ga0206353_11269726
612 Ga0213874_10115844
613 Ga0224712_10427211
614 Ga0224572_1023444
615 Ga0228598_1001302
616 Ga0228598_1019776
617 Ga0207656_10392145
618 Ga0207692_10145357
619 Ga0207642_10007581
620 Ga0207642_10256502
621 Ga0207688_10078930
622 Ga0207688_10420234
623 Ga0207680_10117960
624 Ga0207647_10013807
625 Ga0207685_10060745
626 Ga0207685_10074799
627 Ga0207685_10098210
628 Ga0207685_10447784
629 Ga0207699_10121765
630 Ga0207699_10341899
631 Ga0207643_10108112
632 Ga0207684_10003462
633 Ga0207684_10064978
634 Ga0207684_10674719
635 Ga0207654_10936795
636 Ga0207707_10037365
637 Ga0207695_10100264
638 Ga0207671_10700827
639 Ga0207693_10004147
640 Ga0207693_10035361
641 Ga0207693_10069767
642 Ga0207693_10130245
643 Ga0207693_10161946
644 Ga0207693_10179940
645 Ga0207693_10317665
646 Ga0207663_10071074
647 Ga0207663_10121674
648 Ga0207663_10280268
649 Ga0207663_11332112
650 Ga0207660_10308145
651 Ga0207657_10055732
652 Ga0207649_10031446
653 Ga0207652_10088032
654 Ga0207652_11153703
655 Ga0207646_10034057
656 Ga0207646_11023283
657 Ga0207681_10023444
658 Ga0207694_10027612
659 Ga0207650_10000090
660 Ga0207650_10014974
661 Ga0207659_10113162
662 Ga0207687_10358774
663 Ga0207700_10140471
664 Ga0207700_10251205
665 Ga0207700_10575491
666 Ga0207664_10000033
667 Ga0207664_10538285
668 Ga0207644_10078457
669 Ga0207690_10144706
670 Ga0207690_10509411
671 Ga0207686_10125226
672 Ga0207709_10106592
673 Ga0207670_10119215
674 Ga0207704_10012412
675 Ga0207704_11361010
676 Ga0207665_10000173
677 Ga0207665_10002360
678 Ga0207665_10015628
679 Ga0207665_10022136
680 Ga0207665_10051002
681 Ga0207665_10104926
682 Ga0207665_10474500
683 Ga0207691_10037179
684 Ga0207711_10127042
685 Ga0207711_10159595
686 Ga0207689_10058806
687 Ga0207689_10071960
688 Ga0207661_10013851
689 Ga0207661_10234769
690 Ga0207679_10004118
691 Ga0207679_10068753
692 Ga0207667_10003088
693 Ga0207667_10267053
694 Ga0207667_10495953
695 Ga0207667_10680360
696 Ga0207651_10044357
697 Ga0207658_10254456
698 Ga0207658_10505324
699 Ga0207703_10022398
700 Ga0207703_10600440
701 Ga0207639_12029067
702 Ga0207678_10046048
703 Ga0207708_11556565
704 Ga0207702_10004569
705 Ga0207702_10041387
706 Ga0207702_10904760
707 Ga0207641_10001842
708 Ga0207648_10010690
709 Ga0207648_10199814
710 Ga0207676_10004619
711 Ga0207674_10002952
712 Ga0207674_10022509
713 Ga0207674_10206906
714 Ga0207675_101521835
715 Ga0207698_10012430
716 Ga0207698_10457260
717 Ga0209179_1071857
718 Ga0265356_1000486
719 Ga0268266_10007211
720 Ga0268265_10053823
721 Ga0268265_10229677
722 Ga0268264_10017076
723 Ga0268264_10033007
724 Ga0268264_10212737
725 Ga0265762_1002800
726 Ga0316576_10043438
727 Ga0373926_0100502
728 Ga0373926_0308623
729 Ga0373923_0017358
730 Ga0373936_0003175
731 Ga0373936_0220213
732 Ga0373945_0001135
733 Ga0373945_0194897
734 Ga0373953_0034451
735 Ga0373953_0074487
736 Ga0373954_0059584
737 Ga0373943_0000108
738 Ga0373943_0365398
739 Ga0373955_0306230
740 Ga0316574_0471151
741 Ga0373924_0020763
742 Ga0373924_0368980
743 Ga0373931_0338856
744 Ga0373935_0001684
745 Ga0373935_0133435
746 Ga0373927_0000122
747 Ga0373927_0073244
748 Ga0373927_0107747
749 Ga0373933_0092172
750 Ga0373933_0104264
751 Ga0373933_0661426
752 Ga0373947_0001126
753 Ga0373947_0701205
754 Ga0373937_0028039
755 Ga0373937_0189223
756 Ga0373937_0626776
757 Ga0373937_1215201
758 Ga0316584_0127812
759 Ga0373925_0000661
760 Ga0373925_0474387
761 Ga0395900_0721254
762 Ga0395905_0005416
763 Ga0436365_1094976
764 Ga0436360_0997819
765 Ga0436361_0408950
766 Ga0436363_0589771
767 Ga0439441_093081
768 Ga0439455_0024009
769 Ga0439458_0077632
770 Ga0453683_0467804
771 Ga0453684_0000539
772 Ga0453684_0218432
773 Ga0451576_0249511
774 Ga0451576_0479270
775 Ga0495651_0164054
776 Ga0495653_0504080
777 Ga0495580_0016206
778 Ga0495580_0023540
779 Ga0495580_0034298
780 Ga0495580_0248489
781 Ga0495582_0090979
782 Ga0495664_0171661
783 Ga0495594_0072856
784 Ga0495608_0277113
785 Ga0495630_0061409
786 Ga0495630_0712767
787 Ga0495665_0029792
788 Ga0495665_0468426
789 Ga0495587_0010998
790 Ga0495587_0169562
791 Ga0495667_0221517
792 Ga0495635_0646284
793 Ga0495623_0364795
794 Ga0495646_0348725
795 Ga0495658_0580808
796 Ga0495669_0002467
797 Ga0495604_0016648
798 Ga0495604_0407850
799 Ga0495674_0104446
800 Ga0495674_0248231
801 Ga0495684_0588436
802 Ga0495602_0117896
803 Ga0495602_0665106
804 Ga0496102_0024700
805 Ga0496102_1245551
806 Ga0496103_0119061
807 Ga0496104_0151383
808 Ga0496106_0099059
809 Ga0496107_0105503
810 Ga0496108_0096729
811 Ga0496110_0043752
812 Ga0496111_0074367
813 Ga0496112_0014309
814 Ga0496113_0016771
815 Ga0496115_1130642
816 Ga0501036_1038004
817 Ga0501039_0169423
818 Ga0501040_0009954
819 Ga0501042_0185447
820 Ga0501048_0034385
821 Ga0501071_1233801
822 Ga0501073_0250371
823 Ga0501075_0020636
824 Ga0501076_0066494
825 Ga0501077_0942327
826 Ga0501079_0022277
827 Ga0501080_0069788
828 Ga0501081_0016274
829 Ga0501045_0271939
830 nmdc:mga0rr50_8445_c1
831 nmdc:mga08x19_11743_c1
832 nmdc:mga0a205_21363_c1
833 Ga0501084_0017399
834 Ga0501082_1570411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.8141 22 157
2yc4-assembly1.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.791 20 157
4a42-assembly2.cif.gz_B cpgh89cbm32-6 produced by clostridium perfringens 0.775 26 157
2yc4-assembly1.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.7703 20 157
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.7701 22 157
ID Description Score Start End Superfamily
4a42B00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.775 26 157 2.60.120.260
af_Q61087_15_252_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7709 38 156 2.60.120.260
2jdaA00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7608 26 157 2.60.120.260
af_Q3TV70_9_139_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7502 27 157 2.60.120.260
af_A0A1D6EW30_590_725_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7471 32 157 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A2U3LEF6-F1-model_v4 Carbohydrate-binding protein 0.9997 29 157
AF-A0A2U3LEF6-F1-model_v4 Carbohydrate-binding protein 0.9845 29 157
AF-A0A2V7HYK2-F1-model_v4 Carbohydrate-binding protein 0.9765 20 157
AF-A0A2V9WIE0-F1-model_v4 Uncharacterized protein 0.976 79 157
AF-A0A2S8K3A8-F1-model_v4 deleted 0.975 47 157

Map