F438962

General Info

Members Datasets Scaffolds Average Seq Length
417 198 834 192

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10330811|Ga0065715_103308112
Length 215
Sequence MSLNTACGGDQQTKVRGTTGMRRAVFIDRDGTISEEVGYINHSSRFRVFPYAAAAIKHLNDAGWLAIVVTNQAGVARGYFSEDMIQTVHAGMTKELENGGARLDAVYYCAHHPSVGEPPYRLDCDCRKPKPGLISRAARDFDIDLAGSWMVGDRYSDVELARNAGVKSMFVLSGYGRGEWEHQRSSWTEQPDLVAEDLLEAVRVIAQKEDLEGSN

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.43
Nodule 0
Rhizoplane 0.96
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 29.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10330811 3300005293 Bacteria 984
2 MBSR1b_contig_10580273 2162886012 Unclassified 843
3 JGI25406J46586_10012052 3300003203 Bacteria 3767
4 Ga0065712_10110042 3300005290 Unclassified 1843
5 Ga0065712_10215503 3300005290 Bacteria 1058
6 Ga0065715_10013824 3300005293 Bacteria 3319
7 Ga0065715_10135330 3300005293 Bacteria 1940
8 Ga0065707_10141180 3300005295 Unclassified 1770
9 Ga0065707_10329826 3300005295 Unclassified 951
10 Ga0070676_10187957 3300005328 Unclassified 1347
11 Ga0070676_10392450 3300005328 Bacteria 964
12 Ga0070676_10473574 3300005328 Bacteria 885
13 Ga0070690_100002455 3300005330 Bacteria 9966
14 Ga0070690_100039415 3300005330 Bacteria 2985
15 Ga0070690_100414911 3300005330 Unclassified 991
16 Ga0070690_100704511 3300005330 Bacteria 776
17 Ga0070670_100222525 3300005331 Bacteria 1642
18 Ga0070670_100422197 3300005331 Bacteria 1179
19 Ga0068869_100070363 3300005334 Bacteria 2588
20 Ga0068869_100101384 3300005334 Unclassified 2178
21 Ga0068869_100293309 3300005334 Bacteria 1311
22 Ga0070666_10069404 3300005335 Bacteria 2396
23 Ga0070680_100018141 3300005336 Bacteria 5560
24 Ga0068868_100029793 3300005338 Bacteria 4182
25 Ga0068868_100046496 3300005338 Bacteria 3397
26 Ga0068868_100440762 3300005338 Unclassified 1131
27 Ga0070689_100127149 3300005340 Unclassified 2040
28 Ga0070691_10240387 3300005341 Bacteria 967
29 Ga0070687_100002637 3300005343 Bacteria 6781
30 Ga0070687_100061490 3300005343 Unclassified 1985
31 Ga0070687_100455384 3300005343 Bacteria 852
32 Ga0070661_100425203 3300005344 Bacteria 1053
33 Ga0070668_100038540 3300005347 Bacteria 3653
34 Ga0070668_100576813 3300005347 Unclassified 982
35 Ga0070669_100003681 3300005353 Bacteria 11059
36 Ga0070669_100062897 3300005353 Bacteria 2730
37 Ga0070669_100322621 3300005353 Bacteria 1247
38 Ga0070669_100685826 3300005353 Bacteria 864
39 Ga0070675_100031750 3300005354 Bacteria 4271
40 Ga0070675_100036534 3300005354 Bacteria 3998
41 Ga0070675_100163952 3300005354 Unclassified 1913
42 Ga0070671_100008032 3300005355 Bacteria 8446
43 Ga0070671_100026057 3300005355 Bacteria 4802
44 Ga0070671_100116351 3300005355 Bacteria 2248
45 Ga0070674_100054015 3300005356 Bacteria 2776
46 Ga0070674_100060382 3300005356 Bacteria 2642
47 Ga0070673_100007268 3300005364 Bacteria 7292
48 Ga0070673_100029358 3300005364 Bacteria 4100
49 Ga0070688_100139429 3300005365 Bacteria 1645
50 Ga0070667_100016064 3300005367 Bacteria 6191
51 Ga0070667_100597072 3300005367 Bacteria 1017
52 Ga0070701_10008979 3300005438 Unclassified 4356
53 Ga0070701_10077135 3300005438 Unclassified 1795
54 Ga0070701_10086444 3300005438 Bacteria 1709
55 Ga0070705_100131148 3300005440 Unclassified 1635
56 Ga0070700_100023138 3300005441 Bacteria 3632
57 Ga0070700_100124559 3300005441 Unclassified 1731
58 Ga0070694_100015351 3300005444 Unclassified 4809
59 Ga0070694_100049490 3300005444 Bacteria 2831
60 Ga0070694_100131436 3300005444 Bacteria 1809
61 Ga0070694_100514319 3300005444 Bacteria 954
62 Ga0070678_100033367 3300005456 Unclassified 3573
63 Ga0070678_100102137 3300005456 Bacteria 2224
64 Ga0070678_100227268 3300005456 Bacteria 1554
65 Ga0070662_100026098 3300005457 Bacteria 4043
66 Ga0070662_100092111 3300005457 Unclassified 2277
67 Ga0070662_100341222 3300005457 Bacteria 1226
68 Ga0070681_10012645 3300005458 Bacteria 8373
69 Ga0068867_100003147 3300005459 Bacteria 11634
70 Ga0068867_100081216 3300005459 Bacteria 2444
71 Ga0068867_100086137 3300005459 Unclassified 2376
72 Ga0068867_101488068 3300005459 Unclassified 630
73 Ga0070685_10099495 3300005466 Unclassified 1774
74 Ga0070706_100201911 3300005467 Bacteria 1857
75 Ga0070707_100471756 3300005468 Unclassified 1216
76 Ga0070698_100016061 3300005471 Bacteria 7904
77 Ga0070698_100147413 3300005471 Unclassified 2302
78 Ga0070698_100514899 3300005471 Bacteria 1135
79 Ga0070699_100040352 3300005518 Unclassified 4041
80 Ga0070699_100401662 3300005518 Bacteria 1239
81 Ga0070679_100001494 3300005530 Bacteria 20758
82 Ga0070697_100000292 3300005536 Bacteria 40131
83 Ga0070697_100000395 3300005536 Bacteria 33783
84 Ga0070697_100037972 3300005536 Bacteria 3890
85 Ga0070697_100391012 3300005536 Archaea 1206
86 Ga0068853_100300044 3300005539 Bacteria 1485
87 Ga0070672_100191571 3300005543 Unclassified 1707
88 Ga0070672_100784455 3300005543 Unclassified 838
89 Ga0070686_100006608 3300005544 Bacteria 6454
90 Ga0070686_100015178 3300005544 Bacteria 4454
91 Ga0070686_100066064 3300005544 Bacteria 2351
92 Ga0070686_100087849 3300005544 Unclassified 2073
93 Ga0070686_100222401 3300005544 Unclassified 1365
94 Ga0070695_100095805 3300005545 Unclassified 1990
95 Ga0070696_100007841 3300005546 Bacteria 7128
96 Ga0070696_100051982 3300005546 Unclassified 2850
97 Ga0070696_100066043 3300005546 Bacteria 2537
98 Ga0070696_100182676 3300005546 Unclassified 1557
99 Ga0070665_100029896 3300005548 Bacteria 5483
100 Ga0070665_100048036 3300005548 Bacteria 4285
101 Ga0070665_100527889 3300005548 Unclassified 1192
102 Ga0070704_100086730 3300005549 Bacteria 2321
103 Ga0070704_100153116 3300005549 Bacteria 1815
104 Ga0070704_100202290 3300005549 Bacteria 1604
105 Ga0070704_100289248 3300005549 Unclassified 1361
106 Ga0070704_100302968 3300005549 Unclassified 1332
107 Ga0070664_100297421 3300005564 Bacteria 1458
108 Ga0070664_100590699 3300005564 Unclassified 1029
109 Ga0068854_100088045 3300005578 Unclassified 2305
110 Ga0068854_100134047 3300005578 Unclassified 1894
111 Ga0068854_100144413 3300005578 Bacteria 1829
112 Ga0068856_100004938 3300005614 Bacteria 13202
113 Ga0068852_100093539 3300005616 Unclassified 2695
114 Ga0068852_100191334 3300005616 Bacteria 1931
115 Ga0068852_100588432 3300005616 Bacteria 1116
116 Ga0068859_100169411 3300005617 Bacteria 2265
117 Ga0068864_100000754 3300005618 Bacteria 27198
118 Ga0068864_100328874 3300005618 Bacteria 1437
119 Ga0068864_100642192 3300005618 Bacteria 1033
120 Ga0068866_10361257 3300005718 Unclassified 926
121 Ga0068861_100008502 3300005719 Bacteria 7068
122 Ga0068861_100116931 3300005719 Bacteria 2145
123 Ga0068861_100291050 3300005719 Unclassified 1410
124 Ga0068861_100483553 3300005719 Bacteria 1116
125 Ga0068870_10018535 3300005840 Bacteria 3363
126 Ga0068870_10155127 3300005840 Bacteria 1352
127 Ga0068863_100205217 3300005841 Bacteria 1897
128 Ga0068858_100059538 3300005842 Unclassified 3530
129 Ga0068858_100322663 3300005842 Unclassified 1476
130 Ga0068860_100073527 3300005843 Unclassified 3249
131 Ga0068860_100087288 3300005843 Bacteria 2969
132 Ga0068860_100304050 3300005843 Bacteria 1563
133 Ga0068860_100386464 3300005843 Bacteria 1382
134 Ga0068860_100923770 3300005843 Unclassified 889
135 Ga0068862_100015155 3300005844 Bacteria 6402
136 Ga0068862_100056430 3300005844 Unclassified 3365
137 Ga0068862_100059417 3300005844 Bacteria 3283
138 Ga0068862_100339591 3300005844 Unclassified 1391
139 Ga0068862_100610676 3300005844 Bacteria 1048
140 Ga0081455_10010212 3300005937 Bacteria 9552
141 Ga0081539_10000156 3300005985 Bacteria 158871
142 Ga0081539_10001626 3300005985 Bacteria 36835
143 Ga0075368_10010851 3300006042 Bacteria 3303
144 Ga0075368_10026410 3300006042 Bacteria 2233
145 Ga0075363_100021699 3300006048 Bacteria 3239
146 Ga0075363_100090650 3300006048 Bacteria 1682
147 Ga0075364_10045684 3300006051 Bacteria 2850
148 Ga0075364_10125952 3300006051 Bacteria 1717
149 Ga0075364_10282822 3300006051 Bacteria 1128
150 Ga0075367_10045999 3300006178 Bacteria 2563
151 Ga0075367_10084857 3300006178 Bacteria 1921
152 Ga0075367_10131862 3300006178 Bacteria 1545
153 Ga0075367_10406318 3300006178 Bacteria 861
154 Ga0075366_10003475 3300006195 Bacteria 8320
155 Ga0075366_10003710 3300006195 Bacteria 8109
156 Ga0075366_10425896 3300006195 Bacteria 818
157 Ga0097621_100008544 3300006237 Bacteria 7378
158 Ga0097621_100038660 3300006237 Bacteria 3829
159 Ga0075370_10048943 3300006353 Bacteria 2396
160 Ga0075370_10049916 3300006353 Bacteria 2373
161 Ga0068871_100009530 3300006358 Bacteria 7044
162 Ga0068871_100040242 3300006358 Unclassified 3744
163 Ga0075428_100015008 3300006844 Bacteria 8607
164 Ga0075428_100042070 3300006844 Bacteria 5025
165 Ga0075428_100912242 3300006844 Unclassified 932
166 Ga0075430_100576007 3300006846 Unclassified 929
167 Ga0075431_100023451 3300006847 Bacteria 6313
168 Ga0075431_100617503 3300006847 Bacteria 1067
169 Ga0075431_100802417 3300006847 Unclassified 914
170 Ga0075433_10008155 3300006852 Bacteria 8341
171 Ga0075433_10096362 3300006852 Unclassified 2618
172 Ga0075433_10331111 3300006852 Unclassified 1347
173 Ga0075433_10449071 3300006852 Unclassified 1137
174 Ga0075433_10550085 3300006852 Unclassified 1015
175 Ga0075434_100234266 3300006871 Bacteria 1856
176 Ga0075434_101024676 3300006871 Unclassified 839
177 Ga0075429_100679941 3300006880 Unclassified 902
178 Ga0068865_100724579 3300006881 Unclassified 852
179 Ga0097620_100169401 3300006931 Bacteria 2265
180 Ga0075435_100513828 3300007076 Bacteria 1036
181 Ga0105240_10807458 3300009093 Unclassified 1016
182 Ga0111539_10027594 3300009094 Bacteria 6934
183 Ga0105245_10025462 3300009098 Bacteria 5203
184 Ga0114129_10004840 3300009147 Bacteria 19014
185 Ga0114129_10008038 3300009147 Bacteria 15030
186 Ga0114129_10164830 3300009147 Bacteria 3025
187 Ga0114129_10325635 3300009147 Bacteria 2042
188 Ga0105243_10076690 3300009148 Bacteria 2717
189 Ga0105243_10115932 3300009148 Unclassified 2250
190 Ga0105243_10386514 3300009148 Unclassified 1296
191 Ga0105243_10505165 3300009148 Bacteria 1146
192 Ga0105243_10847728 3300009148 Bacteria 905
193 Ga0105241_10019105 3300009174 Bacteria 5054
194 Ga0105241_10181758 3300009174 Unclassified 1745
195 Ga0105242_10034080 3300009176 Bacteria 4081
196 Ga0105242_10663200 3300009176 Bacteria 1016
197 Ga0105248_10005655 3300009177 Bacteria 13732
198 Ga0105248_10011968 3300009177 Bacteria 9568
199 Ga0105249_10035863 3300009553 Unclassified 4497
200 Ga0105249_10061308 3300009553 Bacteria 3451
201 Ga0105249_10106584 3300009553 Unclassified 2644
202 Ga0105249_10683567 3300009553 Bacteria 1085
203 Ga0105239_10014381 3300010375 Bacteria 8781
204 Ga0105246_10253379 3300011119 Unclassified 1398
205 Ga0105246_10508860 3300011119 Bacteria 1024
206 Ga0157373_10003543 3300013100 Bacteria 11791
207 Ga0157371_10293920 3300013102 Bacteria 1175
208 Ga0157374_10040918 3300013296 Bacteria 4269
209 Ga0157374_10101540 3300013296 Unclassified 2758
210 Ga0157378_10006731 3300013297 Bacteria 10038
211 Ga0157378_10046217 3300013297 Unclassified 3870
212 Ga0157378_10103942 3300013297 Unclassified 2596
213 Ga0157378_10118575 3300013297 Unclassified 2436
214 Ga0157378_10127298 3300013297 Bacteria 2354
215 Ga0157378_10483562 3300013297 Bacteria 1234
216 Ga0157378_10923700 3300013297 Unclassified 904
217 Ga0163162_10003809 3300013306 Bacteria 14465
218 Ga0163162_10141972 3300013306 Bacteria 2515
219 Ga0163162_10554583 3300013306 Unclassified 1277
220 Ga0157372_10093717 3300013307 Unclassified 3418
221 Ga0157375_10081019 3300013308 Unclassified 3285
222 Ga0157375_10228379 3300013308 Unclassified 2020
223 Ga0157375_10585623 3300013308 Bacteria 1276
224 Ga0163163_10002341 3300014325 Bacteria 16030
225 Ga0163163_10070003 3300014325 Bacteria 3493
226 Ga0163163_10284134 3300014325 Unclassified 1706
227 Ga0163163_10314404 3300014325 Unclassified 1619
228 Ga0163163_10787519 3300014325 Unclassified 1014
229 Ga0163163_11002760 3300014325 Bacteria 898
230 Ga0157380_10000379 3300014326 Bacteria 26814
231 Ga0157380_10001895 3300014326 Bacteria 13871
232 Ga0157380_10005187 3300014326 Bacteria 9105
233 Ga0157380_10023073 3300014326 Bacteria 4692
234 Ga0157380_10131908 3300014326 Bacteria 2133
235 Ga0157380_10537784 3300014326 Unclassified 1143
236 Ga0157380_10660279 3300014326 Unclassified 1044
237 Ga0157380_10705286 3300014326 Bacteria 1015
238 Ga0157380_11329571 3300014326 Bacteria 767
239 Ga0157377_10088968 3300014745 Unclassified 1819
240 Ga0157377_10112481 3300014745 Bacteria 1638
241 Ga0157377_10118614 3300014745 Unclassified 1600
242 Ga0157379_10357893 3300014968 Bacteria 1337
243 Ga0157376_10035653 3300014969 Unclassified 4025
244 Ga0163161_10047155 3300017792 Bacteria 3112
245 Ga0163161_10207580 3300017792 Bacteria 1512
246 Ga0163161_10363515 3300017792 Bacteria 1153
247 Ga0163161_11310312 3300017792 Unclassified 630
248 Ga0213876_10000159 3300021384 Bacteria 70556
249 Ga0213876_10002337 3300021384 Bacteria 11182
250 Ga0213876_10064165 3300021384 Unclassified 1939
251 Ga0207697_10014416 3300025315 Bacteria 3277
252 Ga0207653_10045637 3300025885 Bacteria 1448
253 Ga0207688_10166918 3300025901 Bacteria 1307
254 Ga0207647_10253555 3300025904 Unclassified 1009
255 Ga0207645_10101134 3300025907 Unclassified 1860
256 Ga0207643_10043538 3300025908 Bacteria 2534
257 Ga0207684_10079194 3300025910 Bacteria 2795
258 Ga0207654_10145963 3300025911 Bacteria 1514
259 Ga0207654_10337277 3300025911 Bacteria 1035
260 Ga0207707_10000080 3300025912 Bacteria 96693
261 Ga0207660_10516683 3300025917 Bacteria 970
262 Ga0207662_10032989 3300025918 Bacteria 3015
263 Ga0207662_10132941 3300025918 Bacteria 1570
264 Ga0207652_10001473 3300025921 Bacteria 20844
265 Ga0207681_10069023 3300025923 Bacteria 2457
266 Ga0207681_10114950 3300025923 Unclassified 1964
267 Ga0207681_10599980 3300025923 Bacteria 910
268 Ga0207681_10769497 3300025923 Bacteria 803
269 Ga0207650_10209268 3300025925 Unclassified 1566
270 Ga0207659_10007465 3300025926 Bacteria 6725
271 Ga0207687_10274999 3300025927 Unclassified 1348
272 Ga0207644_10035191 3300025931 Bacteria 3508
273 Ga0207644_10212898 3300025931 Unclassified 1529
274 Ga0207706_10053187 3300025933 Bacteria 3574
275 Ga0207706_10112520 3300025933 Bacteria 2395
276 Ga0207706_10112784 3300025933 Bacteria 2392
277 Ga0207706_10123450 3300025933 Unclassified 2278
278 Ga0207686_10150153 3300025934 Unclassified 1621
279 Ga0207709_10215001 3300025935 Bacteria 1382
280 Ga0207709_10561644 3300025935 Unclassified 899
281 Ga0207709_10789605 3300025935 Unclassified 766
282 Ga0207670_10050139 3300025936 Bacteria 2796
283 Ga0207670_10316253 3300025936 Unclassified 1227
284 Ga0207669_10129020 3300025937 Bacteria 1733
285 Ga0207704_10464231 3300025938 Bacteria 1013
286 Ga0207691_10011275 3300025940 Bacteria 8575
287 Ga0207691_10188773 3300025940 Bacteria 1798
288 Ga0207711_10031842 3300025941 Unclassified 4455
289 Ga0207689_10002378 3300025942 Bacteria 17562
290 Ga0207689_10036034 3300025942 Bacteria 4108
291 Ga0207689_10056133 3300025942 Bacteria 3240
292 Ga0207689_10063644 3300025942 Bacteria 3034
293 Ga0207689_10101681 3300025942 Bacteria 2361
294 Ga0207689_10107582 3300025942 Bacteria 2291
295 Ga0207679_10056672 3300025945 Bacteria 2895
296 Ga0207679_10687670 3300025945 Unclassified 927
297 Ga0207679_10865294 3300025945 Bacteria 826
298 Ga0207651_10115904 3300025960 Bacteria 2021
299 Ga0207712_10029693 3300025961 Bacteria 3670
300 Ga0207712_10277231 3300025961 Unclassified 1367
301 Ga0207712_10340042 3300025961 Bacteria 1244
302 Ga0207668_10038775 3300025972 Bacteria 3201
303 Ga0207640_10128833 3300025981 Bacteria 1826
304 Ga0207640_10232662 3300025981 Bacteria 1419
305 Ga0207658_10140267 3300025986 Bacteria 1955
306 Ga0207658_10456370 3300025986 Bacteria 1132
307 Ga0207658_11243871 3300025986 Bacteria 681
308 Ga0207677_10038248 3300026023 Unclassified 3144
309 Ga0207677_10194154 3300026023 Unclassified 1608
310 Ga0207677_10428802 3300026023 Unclassified 1128
311 Ga0207639_10064790 3300026041 Bacteria 2834
312 Ga0207678_10093071 3300026067 Bacteria 2576
313 Ga0207708_10038679 3300026075 Bacteria 3634
314 Ga0207708_10201817 3300026075 Bacteria 1587
315 Ga0207708_10292698 3300026075 Bacteria 1322
316 Ga0207708_10381923 3300026075 Unclassified 1162
317 Ga0207708_10460819 3300026075 Bacteria 1060
318 Ga0207641_10129079 3300026088 Bacteria 2267
319 Ga0207641_11141425 3300026088 Bacteria 778
320 Ga0207648_10014293 3300026089 Bacteria 7338
321 Ga0207648_10036802 3300026089 Unclassified 4311
322 Ga0207648_10096075 3300026089 Bacteria 2593
323 Ga0207648_10361720 3300026089 Unclassified 1309
324 Ga0207648_11050662 3300026089 Bacteria 763
325 Ga0207676_10073757 3300026095 Unclassified 2747
326 Ga0207676_10432275 3300026095 Bacteria 1237
327 Ga0207675_100041738 3300026118 Unclassified 4283
328 Ga0207675_100044861 3300026118 Unclassified 4131
329 Ga0207675_100067120 3300026118 Bacteria 3353
330 Ga0207675_100082234 3300026118 Bacteria 3020
331 Ga0207675_100238856 3300026118 Bacteria 1755
332 Ga0207675_100362113 3300026118 Unclassified 1423
333 Ga0207683_10029600 3300026121 Bacteria 4742
334 Ga0207683_10045387 3300026121 Unclassified 3843
335 Ga0207698_10223665 3300026142 Bacteria 1703
336 Ga0209813_10125011 3300027866 Bacteria 899
337 Ga0207428_10112431 3300027907 Unclassified 2094
338 Ga0268266_10026633 3300028379 Bacteria 4920
339 Ga0268266_10240015 3300028379 Bacteria 1672
340 Ga0268265_10076596 3300028380 Bacteria 2624
341 Ga0268265_10103937 3300028380 Bacteria 2301
342 Ga0268265_10835814 3300028380 Unclassified 900
343 Ga0268264_10091948 3300028381 Unclassified 2618
344 Ga0268264_10340003 3300028381 Bacteria 1425
345 Ga0268264_10430406 3300028381 Unclassified 1274
346 Ga0307513_10000792 3300031456 Bacteria 45967
347 Ga0307409_101326994 3300031995 Unclassified 745
348 Ga0307416_100364175 3300032002 Bacteria 1469
349 Ga0307416_100610056 3300032002 Bacteria 1172
350 Ga0307416_101089530 3300032002 Bacteria 903
351 Ga0395905_0002371 3300037471 Bacteria 20992
352 Ga0242420_001220 3300038996 Bacteria 3365
353 Ga0436365_0067166 3300039437 Bacteria 157821
354 Ga0436365_0350389 3300039437 Bacteria 3217
355 Ga0436365_0915988 3300039437 Bacteria 51495
356 Ga0436365_1043858 3300039437 Bacteria 852
357 Ga0439462_0145427 3300042015 Unclassified 665
358 Ga0450908_006063 3300042184 Bacteria 2306
359 Ga0495653_0105167 3300046463 Bacteria 2038
360 Ga0495632_0017313 3300046519 Unclassified 3982
361 Ga0495642_0215133 3300046528 Unclassified 839
362 Ga0495636_0128417 3300047318 Unclassified 1126
363 Ga0495672_0032966 3300047320 Unclassified 3214
364 Ga0496104_0054243 3300048907 Bacteria 3789
365 Ga0496106_0056376 3300048909 Bacteria 2970
366 Ga0496109_0000050 3300048912 Bacteria 126918
367 Ga0496109_0589638 3300048912 Unclassified 1047
368 Ga0501032_0271287 3300049569 Bacteria 1099
369 Ga0501036_0165226 3300049572 Bacteria 1866
370 Ga0501038_0182426 3300049574 Bacteria 1693
371 Ga0501042_0094979 3300049578 Bacteria 2141
372 Ga0501043_0379544 3300049579 Bacteria 1070
373 Ga0501048_0093393 3300049582 Bacteria 2122
374 Ga0501071_0364993 3300049587 Bacteria 1100
375 Ga0501072_0151312 3300049588 Bacteria 1850
376 Ga0501072_0304051 3300049588 Unclassified 1268
377 Ga0501073_0250946 3300049589 Bacteria 1221
378 Ga0501075_0133723 3300049591 Bacteria 1889
379 Ga0501076_0035788 3300049592 Bacteria 3885
380 Ga0501076_0054884 3300049592 Bacteria 3158
381 Ga0501225_0062919 3300049705 Bacteria 1046
382 Ga0501079_0149111 3300049741 Bacteria 1823
383 Ga0501079_0611452 3300049741 Bacteria 858
384 Ga0501080_0315576 3300049742 Bacteria 1416
385 Ga0501081_0032702 3300049743 Bacteria 3530
386 Ga0501081_0109273 3300049743 Bacteria 1962
387 Ga0501045_0459666 3300049824 Bacteria 946
388 nmdc:mga03n38_57004_c1 3300050490 Bacteria 1765
389 nmdc:mga00v17_206746_c1 3300050491 Bacteria 1270
390 nmdc:mga00v17_82847_c2 3300050491 Bacteria 1548
391 nmdc:mga0yw44_127901_c1 3300050492 Bacteria 1642
392 nmdc:mga0k408_20574_c2 3300050493 Bacteria 3155
393 nmdc:mga0k408_236856_c1 3300050493 Bacteria 1090
394 nmdc:mga0k408_77356_c1 3300050493 Bacteria 1946
395 nmdc:mga06z11_108870_c1 3300050494 Bacteria 1531
396 nmdc:mga06z11_26452_c1 3300050494 Bacteria 2761
397 nmdc:mga06z11_33785_c1 3300050494 Bacteria 2505
398 nmdc:mga04h51_11445_c1 3300050495 Bacteria 2462
399 nmdc:mga04h51_64116_c1 3300050495 Bacteria 1267
400 nmdc:mga07m45_121162_c1 3300050496 Bacteria 1511
401 nmdc:mga07m45_23667_c1 3300050496 Bacteria 3359
402 nmdc:mga05p37_5687_c1 3300050507 Bacteria 14654
403 nmdc:mga05p37_9380_c1 3300050507 Bacteria 10377
404 nmdc:mga09592_980759_c1 3300050508 Unclassified 707
405 nmdc:mga06r32_34239_c1 3300050510 Bacteria 4789
406 nmdc:mga06r32_418225_c1 3300050510 Unclassified 1322
407 nmdc:mga08y16_593075_c1 3300050511 Bacteria 1117
408 nmdc:mga08y16_99021_c1 3300050511 Bacteria 3036
409 nmdc:mga0n895_106298_c1 3300050512 Bacteria 2819
410 nmdc:mga0n895_305064_c1 3300050512 Bacteria 1614
411 nmdc:mga0rr50_792128_c1 3300050513 Bacteria 809
412 nmdc:mga0a205_2078_c1 3300050515 Bacteria 17510
413 nmdc:mga0a205_221690_c1 3300050515 Bacteria 1776
414 nmdc:mga0a205_323340_c1 3300050515 Bacteria 1413
415 Ga0501082_0167431 3300060353 Bacteria 1910
416 Ga0530510_0158977 3300061734 Bacteria 1671
417 Ga0530510_0228811 3300061734 Bacteria 1383
418 Ga0065715_10330811
419 MBSR1b_contig_10580273
420 JGI25406J46586_10012052
421 Ga0065712_10110042
422 Ga0065712_10215503
423 Ga0065715_10013824
424 Ga0065715_10135330
425 Ga0065707_10141180
426 Ga0065707_10329826
427 Ga0070676_10187957
428 Ga0070676_10392450
429 Ga0070676_10473574
430 Ga0070690_100002455
431 Ga0070690_100039415
432 Ga0070690_100414911
433 Ga0070690_100704511
434 Ga0070670_100222525
435 Ga0070670_100422197
436 Ga0068869_100070363
437 Ga0068869_100101384
438 Ga0068869_100293309
439 Ga0070666_10069404
440 Ga0070680_100018141
441 Ga0068868_100029793
442 Ga0068868_100046496
443 Ga0068868_100440762
444 Ga0070689_100127149
445 Ga0070691_10240387
446 Ga0070687_100002637
447 Ga0070687_100061490
448 Ga0070687_100455384
449 Ga0070661_100425203
450 Ga0070668_100038540
451 Ga0070668_100576813
452 Ga0070669_100003681
453 Ga0070669_100062897
454 Ga0070669_100322621
455 Ga0070669_100685826
456 Ga0070675_100031750
457 Ga0070675_100036534
458 Ga0070675_100163952
459 Ga0070671_100008032
460 Ga0070671_100026057
461 Ga0070671_100116351
462 Ga0070674_100054015
463 Ga0070674_100060382
464 Ga0070673_100007268
465 Ga0070673_100029358
466 Ga0070688_100139429
467 Ga0070667_100016064
468 Ga0070667_100597072
469 Ga0070701_10008979
470 Ga0070701_10077135
471 Ga0070701_10086444
472 Ga0070705_100131148
473 Ga0070700_100023138
474 Ga0070700_100124559
475 Ga0070694_100015351
476 Ga0070694_100049490
477 Ga0070694_100131436
478 Ga0070694_100514319
479 Ga0070678_100033367
480 Ga0070678_100102137
481 Ga0070678_100227268
482 Ga0070662_100026098
483 Ga0070662_100092111
484 Ga0070662_100341222
485 Ga0070681_10012645
486 Ga0068867_100003147
487 Ga0068867_100081216
488 Ga0068867_100086137
489 Ga0068867_101488068
490 Ga0070685_10099495
491 Ga0070706_100201911
492 Ga0070707_100471756
493 Ga0070698_100016061
494 Ga0070698_100147413
495 Ga0070698_100514899
496 Ga0070699_100040352
497 Ga0070699_100401662
498 Ga0070679_100001494
499 Ga0070697_100000292
500 Ga0070697_100000395
501 Ga0070697_100037972
502 Ga0070697_100391012
503 Ga0068853_100300044
504 Ga0070672_100191571
505 Ga0070672_100784455
506 Ga0070686_100006608
507 Ga0070686_100015178
508 Ga0070686_100066064
509 Ga0070686_100087849
510 Ga0070686_100222401
511 Ga0070695_100095805
512 Ga0070696_100007841
513 Ga0070696_100051982
514 Ga0070696_100066043
515 Ga0070696_100182676
516 Ga0070665_100029896
517 Ga0070665_100048036
518 Ga0070665_100527889
519 Ga0070704_100086730
520 Ga0070704_100153116
521 Ga0070704_100202290
522 Ga0070704_100289248
523 Ga0070704_100302968
524 Ga0070664_100297421
525 Ga0070664_100590699
526 Ga0068854_100088045
527 Ga0068854_100134047
528 Ga0068854_100144413
529 Ga0068856_100004938
530 Ga0068852_100093539
531 Ga0068852_100191334
532 Ga0068852_100588432
533 Ga0068859_100169411
534 Ga0068864_100000754
535 Ga0068864_100328874
536 Ga0068864_100642192
537 Ga0068866_10361257
538 Ga0068861_100008502
539 Ga0068861_100116931
540 Ga0068861_100291050
541 Ga0068861_100483553
542 Ga0068870_10018535
543 Ga0068870_10155127
544 Ga0068863_100205217
545 Ga0068858_100059538
546 Ga0068858_100322663
547 Ga0068860_100073527
548 Ga0068860_100087288
549 Ga0068860_100304050
550 Ga0068860_100386464
551 Ga0068860_100923770
552 Ga0068862_100015155
553 Ga0068862_100056430
554 Ga0068862_100059417
555 Ga0068862_100339591
556 Ga0068862_100610676
557 Ga0081455_10010212
558 Ga0081539_10000156
559 Ga0081539_10001626
560 Ga0075368_10010851
561 Ga0075368_10026410
562 Ga0075363_100021699
563 Ga0075363_100090650
564 Ga0075364_10045684
565 Ga0075364_10125952
566 Ga0075364_10282822
567 Ga0075367_10045999
568 Ga0075367_10084857
569 Ga0075367_10131862
570 Ga0075367_10406318
571 Ga0075366_10003475
572 Ga0075366_10003710
573 Ga0075366_10425896
574 Ga0097621_100008544
575 Ga0097621_100038660
576 Ga0075370_10048943
577 Ga0075370_10049916
578 Ga0068871_100009530
579 Ga0068871_100040242
580 Ga0075428_100015008
581 Ga0075428_100042070
582 Ga0075428_100912242
583 Ga0075430_100576007
584 Ga0075431_100023451
585 Ga0075431_100617503
586 Ga0075431_100802417
587 Ga0075433_10008155
588 Ga0075433_10096362
589 Ga0075433_10331111
590 Ga0075433_10449071
591 Ga0075433_10550085
592 Ga0075434_100234266
593 Ga0075434_101024676
594 Ga0075429_100679941
595 Ga0068865_100724579
596 Ga0097620_100169401
597 Ga0075435_100513828
598 Ga0105240_10807458
599 Ga0111539_10027594
600 Ga0105245_10025462
601 Ga0114129_10004840
602 Ga0114129_10008038
603 Ga0114129_10164830
604 Ga0114129_10325635
605 Ga0105243_10076690
606 Ga0105243_10115932
607 Ga0105243_10386514
608 Ga0105243_10505165
609 Ga0105243_10847728
610 Ga0105241_10019105
611 Ga0105241_10181758
612 Ga0105242_10034080
613 Ga0105242_10663200
614 Ga0105248_10005655
615 Ga0105248_10011968
616 Ga0105249_10035863
617 Ga0105249_10061308
618 Ga0105249_10106584
619 Ga0105249_10683567
620 Ga0105239_10014381
621 Ga0105246_10253379
622 Ga0105246_10508860
623 Ga0157373_10003543
624 Ga0157371_10293920
625 Ga0157374_10040918
626 Ga0157374_10101540
627 Ga0157378_10006731
628 Ga0157378_10046217
629 Ga0157378_10103942
630 Ga0157378_10118575
631 Ga0157378_10127298
632 Ga0157378_10483562
633 Ga0157378_10923700
634 Ga0163162_10003809
635 Ga0163162_10141972
636 Ga0163162_10554583
637 Ga0157372_10093717
638 Ga0157375_10081019
639 Ga0157375_10228379
640 Ga0157375_10585623
641 Ga0163163_10002341
642 Ga0163163_10070003
643 Ga0163163_10284134
644 Ga0163163_10314404
645 Ga0163163_10787519
646 Ga0163163_11002760
647 Ga0157380_10000379
648 Ga0157380_10001895
649 Ga0157380_10005187
650 Ga0157380_10023073
651 Ga0157380_10131908
652 Ga0157380_10537784
653 Ga0157380_10660279
654 Ga0157380_10705286
655 Ga0157380_11329571
656 Ga0157377_10088968
657 Ga0157377_10112481
658 Ga0157377_10118614
659 Ga0157379_10357893
660 Ga0157376_10035653
661 Ga0163161_10047155
662 Ga0163161_10207580
663 Ga0163161_10363515
664 Ga0163161_11310312
665 Ga0213876_10000159
666 Ga0213876_10002337
667 Ga0213876_10064165
668 Ga0207697_10014416
669 Ga0207653_10045637
670 Ga0207688_10166918
671 Ga0207647_10253555
672 Ga0207645_10101134
673 Ga0207643_10043538
674 Ga0207684_10079194
675 Ga0207654_10145963
676 Ga0207654_10337277
677 Ga0207707_10000080
678 Ga0207660_10516683
679 Ga0207662_10032989
680 Ga0207662_10132941
681 Ga0207652_10001473
682 Ga0207681_10069023
683 Ga0207681_10114950
684 Ga0207681_10599980
685 Ga0207681_10769497
686 Ga0207650_10209268
687 Ga0207659_10007465
688 Ga0207687_10274999
689 Ga0207644_10035191
690 Ga0207644_10212898
691 Ga0207706_10053187
692 Ga0207706_10112520
693 Ga0207706_10112784
694 Ga0207706_10123450
695 Ga0207686_10150153
696 Ga0207709_10215001
697 Ga0207709_10561644
698 Ga0207709_10789605
699 Ga0207670_10050139
700 Ga0207670_10316253
701 Ga0207669_10129020
702 Ga0207704_10464231
703 Ga0207691_10011275
704 Ga0207691_10188773
705 Ga0207711_10031842
706 Ga0207689_10002378
707 Ga0207689_10036034
708 Ga0207689_10056133
709 Ga0207689_10063644
710 Ga0207689_10101681
711 Ga0207689_10107582
712 Ga0207679_10056672
713 Ga0207679_10687670
714 Ga0207679_10865294
715 Ga0207651_10115904
716 Ga0207712_10029693
717 Ga0207712_10277231
718 Ga0207712_10340042
719 Ga0207668_10038775
720 Ga0207640_10128833
721 Ga0207640_10232662
722 Ga0207658_10140267
723 Ga0207658_10456370
724 Ga0207658_11243871
725 Ga0207677_10038248
726 Ga0207677_10194154
727 Ga0207677_10428802
728 Ga0207639_10064790
729 Ga0207678_10093071
730 Ga0207708_10038679
731 Ga0207708_10201817
732 Ga0207708_10292698
733 Ga0207708_10381923
734 Ga0207708_10460819
735 Ga0207641_10129079
736 Ga0207641_11141425
737 Ga0207648_10014293
738 Ga0207648_10036802
739 Ga0207648_10096075
740 Ga0207648_10361720
741 Ga0207648_11050662
742 Ga0207676_10073757
743 Ga0207676_10432275
744 Ga0207675_100041738
745 Ga0207675_100044861
746 Ga0207675_100067120
747 Ga0207675_100082234
748 Ga0207675_100238856
749 Ga0207675_100362113
750 Ga0207683_10029600
751 Ga0207683_10045387
752 Ga0207698_10223665
753 Ga0209813_10125011
754 Ga0207428_10112431
755 Ga0268266_10026633
756 Ga0268266_10240015
757 Ga0268265_10076596
758 Ga0268265_10103937
759 Ga0268265_10835814
760 Ga0268264_10091948
761 Ga0268264_10340003
762 Ga0268264_10430406
763 Ga0307513_10000792
764 Ga0307409_101326994
765 Ga0307416_100364175
766 Ga0307416_100610056
767 Ga0307416_101089530
768 Ga0395905_0002371
769 Ga0242420_001220
770 Ga0436365_0067166
771 Ga0436365_0350389
772 Ga0436365_0915988
773 Ga0436365_1043858
774 Ga0439462_0145427
775 Ga0450908_006063
776 Ga0495653_0105167
777 Ga0495632_0017313
778 Ga0495642_0215133
779 Ga0495636_0128417
780 Ga0495672_0032966
781 Ga0496104_0054243
782 Ga0496106_0056376
783 Ga0496109_0000050
784 Ga0496109_0589638
785 Ga0501032_0271287
786 Ga0501036_0165226
787 Ga0501038_0182426
788 Ga0501042_0094979
789 Ga0501043_0379544
790 Ga0501048_0093393
791 Ga0501071_0364993
792 Ga0501072_0151312
793 Ga0501072_0304051
794 Ga0501073_0250946
795 Ga0501075_0133723
796 Ga0501076_0035788
797 Ga0501076_0054884
798 Ga0501225_0062919
799 Ga0501079_0149111
800 Ga0501079_0611452
801 Ga0501080_0315576
802 Ga0501081_0032702
803 Ga0501081_0109273
804 Ga0501045_0459666
805 nmdc:mga03n38_57004_c1
806 nmdc:mga00v17_206746_c1
807 nmdc:mga00v17_82847_c2
808 nmdc:mga0yw44_127901_c1
809 nmdc:mga0k408_20574_c2
810 nmdc:mga0k408_236856_c1
811 nmdc:mga0k408_77356_c1
812 nmdc:mga06z11_108870_c1
813 nmdc:mga06z11_26452_c1
814 nmdc:mga06z11_33785_c1
815 nmdc:mga04h51_11445_c1
816 nmdc:mga04h51_64116_c1
817 nmdc:mga07m45_121162_c1
818 nmdc:mga07m45_23667_c1
819 nmdc:mga05p37_5687_c1
820 nmdc:mga05p37_9380_c1
821 nmdc:mga09592_980759_c1
822 nmdc:mga06r32_34239_c1
823 nmdc:mga06r32_418225_c1
824 nmdc:mga08y16_593075_c1
825 nmdc:mga08y16_99021_c1
826 nmdc:mga0n895_106298_c1
827 nmdc:mga0n895_305064_c1
828 nmdc:mga0rr50_792128_c1
829 nmdc:mga0a205_2078_c1
830 nmdc:mga0a205_221690_c1
831 nmdc:mga0a205_323340_c1
832 Ga0501082_0167431
833 Ga0530510_0158977
834 Ga0530510_0228811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

125

201

0.96

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

121

171

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9241 4 190
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9143 4 190
3l8f-assembly1.cif.gz_A crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate 0.9132 2 190
3l8f-assembly1.cif.gz_A crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate 0.9085 2 190
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.8791 3 187
ID Description Score Start End Superfamily
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.917 5 190 3.40.50.1000
af_P9WMV3_2_164_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9088 2 145 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9071 5 190 3.40.50.1000
3l8gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8818 2 190 3.40.50.1000
3l8gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8771 2 190 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A6L4ZLR8-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.993 1 189 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A3N5YHY4-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9926 1 159 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A1F9D8K4-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9925 1 152 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A7V9HU45-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9923 1 147 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A2V7TMV3-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9899 23 189 GO:0005737
GO:0005975
GO:0016791

Map