F438829

General Info

Members Datasets Scaffolds Average Seq Length
416 221 832 212

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10667341|Ga0207676_106673412
Length 233
Sequence MPGEMEFLHKLYNLLRHLGEDASWREMINYIGVYKLYAVLFLIVFCETGLVVTPFLPGDSLLFAAGALAATIDPETGRHVLRVEVVAALLLAAAVLGDAVNYAVGHYVGPKVFSSTDDAGLVHKLLNRKHLAQAHAFFETYGAKAVVLGRWVPIVRTFVPFVAGAGQMKPSRFVFYNLMGAIGWVGLCMGAGVLFGNVPIVKENFSLVTIGIVTVSLLPVAVEYLAHRRRKAA

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
161 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
162 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 0
Rhizoplane 6.25
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10667341 3300026095 Bacteria 1005
2 JGI24751J29686_10005658 3300002459 Unclassified 2546
3 rootH2_10005888 3300003320 Bacteria 37018
4 rootH1_10200149 3300003323 Bacteria 3738
5 Ga0065712_10023855 3300005290 Bacteria 1334
6 Ga0065712_10161524 3300005290 Bacteria 1299
7 Ga0065712_10187960 3300005290 Bacteria 1161
8 Ga0065715_10007480 3300005293 Bacteria 3129
9 Ga0065707_10094231 3300005295 Bacteria 3522
10 Ga0070658_10034975 3300005327 Bacteria 4045
11 Ga0070676_10520826 3300005328 Bacteria 847
12 Ga0070690_100034102 3300005330 Bacteria 3189
13 Ga0070670_100176484 3300005331 Bacteria 1854
14 Ga0070670_100522811 3300005331 Unclassified 1057
15 Ga0070670_100680296 3300005331 Unclassified 924
16 Ga0068869_100339092 3300005334 Bacteria 1223
17 Ga0070680_100253170 3300005336 Bacteria 1489
18 Ga0070682_100270234 3300005337 Bacteria 1235
19 Ga0070660_100011686 3300005339 Bacteria 6250
20 Ga0070660_100050614 3300005339 Bacteria 3197
21 Ga0070689_100307967 3300005340 Unclassified 1320
22 Ga0070689_100680675 3300005340 Bacteria 897
23 Ga0070691_10000973 3300005341 Bacteria 11703
24 Ga0070669_100024614 3300005353 Bacteria 4318
25 Ga0070669_100105538 3300005353 Bacteria 2131
26 Ga0070669_100225003 3300005353 Bacteria 1485
27 Ga0070669_100295047 3300005353 Bacteria 1303
28 Ga0070675_100082159 3300005354 Bacteria 2688
29 Ga0070675_100475709 3300005354 Bacteria 1123
30 Ga0070675_100521939 3300005354 Bacteria 1072
31 Ga0070675_101204535 3300005354 Bacteria 697
32 Ga0070671_100026062 3300005355 Bacteria 4802
33 Ga0070671_100085264 3300005355 Bacteria 2642
34 Ga0070674_100085102 3300005356 Bacteria 2269
35 Ga0070674_100120098 3300005356 Bacteria 1945
36 Ga0070673_100090279 3300005364 Bacteria 2503
37 Ga0070673_100108205 3300005364 Bacteria 2301
38 Ga0070673_100134431 3300005364 Bacteria 2080
39 Ga0070673_100137119 3300005364 Bacteria 2061
40 Ga0070673_100534409 3300005364 Unclassified 1064
41 Ga0070688_100248493 3300005365 Bacteria 1265
42 Ga0070688_100323719 3300005365 Unclassified 1121
43 Ga0070659_100140493 3300005366 Bacteria 1966
44 Ga0070667_100005997 3300005367 Bacteria 10097
45 Ga0070709_10123900 3300005434 Bacteria 1756
46 Ga0070711_100174501 3300005439 Bacteria 1641
47 Ga0070705_100007659 3300005440 Bacteria 5327
48 Ga0070700_100004264 3300005441 Bacteria 7463
49 Ga0070700_100273832 3300005441 Bacteria 1221
50 Ga0070694_100005696 3300005444 Bacteria 7554
51 Ga0070663_100216587 3300005455 Bacteria 1502
52 Ga0070678_100019649 3300005456 Bacteria 4412
53 Ga0070678_100080445 3300005456 Bacteria 2468
54 Ga0070662_100451333 3300005457 Bacteria 1067
55 Ga0070681_10020794 3300005458 Bacteria 6574
56 Ga0070681_10217145 3300005458 Bacteria 1828
57 Ga0070681_10703872 3300005458 Bacteria 926
58 Ga0070706_100253717 3300005467 Bacteria 1642
59 Ga0070706_100502612 3300005467 Bacteria 1128
60 Ga0070679_100233068 3300005530 Bacteria 1800
61 Ga0070672_100129545 3300005543 Bacteria 2072
62 Ga0070672_100182629 3300005543 Bacteria 1749
63 Ga0070686_100038232 3300005544 Bacteria 2982
64 Ga0070695_100006963 3300005545 Bacteria 6700
65 Ga0070695_100256128 3300005545 Bacteria 1276
66 Ga0070696_100012338 3300005546 Bacteria 5732
67 Ga0070665_100026627 3300005548 Bacteria 5822
68 Ga0070665_100206499 3300005548 Bacteria 1965
69 Ga0070665_100811076 3300005548 Bacteria 949
70 Ga0070704_100001589 3300005549 Bacteria 12269
71 Ga0070704_100088576 3300005549 Bacteria 2300
72 Ga0070704_100156707 3300005549 Bacteria 1797
73 Ga0068855_100306124 3300005563 Bacteria 1759
74 Ga0070664_100142927 3300005564 Bacteria 2108
75 Ga0070664_100636431 3300005564 Bacteria 991
76 Ga0068854_100039286 3300005578 Bacteria 3333
77 Ga0068854_100282071 3300005578 Bacteria 1338
78 Ga0068856_100363012 3300005614 Bacteria 1467
79 Ga0070702_100011680 3300005615 Bacteria 4375
80 Ga0068859_100019084 3300005617 Bacteria 6886
81 Ga0068859_100128424 3300005617 Bacteria 2606
82 Ga0068859_100192852 3300005617 Bacteria 2122
83 Ga0068859_100368755 3300005617 Bacteria 1531
84 Ga0068859_100382767 3300005617 Bacteria 1502
85 Ga0068859_100622821 3300005617 Bacteria 1172
86 Ga0068859_101085572 3300005617 Bacteria 880
87 Ga0068859_101091204 3300005617 Bacteria 878
88 Ga0068864_100312228 3300005618 Bacteria 1474
89 Ga0068866_10522431 3300005718 Bacteria 789
90 Ga0068861_100452351 3300005719 Bacteria 1151
91 Ga0068851_10140023 3300005834 Bacteria 1315
92 Ga0068863_100003258 3300005841 Bacteria 16036
93 Ga0068858_100022553 3300005842 Bacteria 5874
94 Ga0068858_100090475 3300005842 Bacteria 2848
95 Ga0068858_100337565 3300005842 Bacteria 1442
96 Ga0068858_100602459 3300005842 Bacteria 1066
97 Ga0068860_100122279 3300005843 Bacteria 2493
98 Ga0068860_100920892 3300005843 Bacteria 891
99 Ga0068862_100039269 3300005844 Bacteria 4019
100 Ga0068862_100375665 3300005844 Bacteria 1324
101 Ga0068862_100386917 3300005844 Bacteria 1306
102 Ga0081455_10026756 3300005937 Bacteria 5296
103 Ga0070717_10079020 3300006028 Bacteria 2758
104 Ga0075365_10014739 3300006038 Bacteria 4708
105 Ga0075368_10050175 3300006042 Bacteria 1657
106 Ga0075368_10065401 3300006042 Bacteria 1461
107 Ga0075368_10079422 3300006042 Bacteria 1334
108 Ga0075363_100063856 3300006048 Bacteria 1988
109 Ga0075363_100074778 3300006048 Bacteria 1845
110 Ga0075364_10014970 3300006051 Bacteria 4801
111 Ga0075364_10053231 3300006051 Bacteria 2646
112 Ga0075364_10451614 3300006051 Bacteria 878
113 Ga0075432_10020564 3300006058 Bacteria 2257
114 Ga0070715_10233555 3300006163 Bacteria 952
115 Ga0075362_10001172 3300006177 Bacteria 8200
116 Ga0075367_10003100 3300006178 Bacteria 7812
117 Ga0075367_10017302 3300006178 Bacteria 3954
118 Ga0075367_10232475 3300006178 Bacteria 1154
119 Ga0075367_10428287 3300006178 Bacteria 838
120 Ga0075369_10185302 3300006186 Bacteria 958
121 Ga0075366_10000820 3300006195 Bacteria 14951
122 Ga0075366_10001838 3300006195 Bacteria 10699
123 Ga0075366_10008708 3300006195 Bacteria 5648
124 Ga0075366_10017005 3300006195 Bacteria 4182
125 Ga0075366_10030963 3300006195 Bacteria 3147
126 Ga0075366_10229813 3300006195 Bacteria 1130
127 Ga0097621_100087671 3300006237 Bacteria 2599
128 Ga0097621_100101295 3300006237 Bacteria 2423
129 Ga0075370_10001492 3300006353 Bacteria 10201
130 Ga0075370_10085357 3300006353 Bacteria 1818
131 Ga0068871_100029582 3300006358 Bacteria 4303
132 Ga0068871_100212853 3300006358 Bacteria 1672
133 Ga0068871_100245593 3300006358 Bacteria 1558
134 Ga0075428_100856822 3300006844 Bacteria 965
135 Ga0075428_100869285 3300006844 Bacteria 957
136 Ga0075433_10026097 3300006852 Bacteria 4942
137 Ga0075433_10071676 3300006852 Bacteria 3046
138 Ga0075429_100092203 3300006880 Bacteria 2642
139 Ga0068865_100417817 3300006881 Bacteria 1102
140 Ga0068865_100473912 3300006881 Bacteria 1039
141 Ga0097620_100019080 3300006931 Bacteria 6886
142 Ga0097620_100128428 3300006931 Bacteria 2606
143 Ga0097620_100192858 3300006931 Bacteria 2122
144 Ga0097620_100368782 3300006931 Bacteria 1531
145 Ga0097620_100382763 3300006931 Bacteria 1502
146 Ga0097620_100622835 3300006931 Bacteria 1172
147 Ga0097620_101085675 3300006931 Bacteria 880
148 Ga0097620_101091228 3300006931 Bacteria 878
149 Ga0105251_10301744 3300009011 Bacteria 726
150 Ga0105240_10274441 3300009093 Bacteria 1940
151 Ga0111539_10001448 3300009094 Bacteria 31687
152 Ga0111539_11389783 3300009094 Bacteria 814
153 Ga0105245_10018809 3300009098 Bacteria 6045
154 Ga0105245_10391419 3300009098 Bacteria 1387
155 Ga0105245_11558726 3300009098 Bacteria 712
156 Ga0114129_10000513 3300009147 Bacteria 47473
157 Ga0114129_10010117 3300009147 Bacteria 13447
158 Ga0114129_10026668 3300009147 Bacteria 8184
159 Ga0105243_11040181 3300009148 Bacteria 824
160 Ga0105242_10941650 3300009176 Bacteria 867
161 Ga0105248_10003412 3300009177 Bacteria 17649
162 Ga0105248_10010662 3300009177 Bacteria 10138
163 Ga0105248_10034698 3300009177 Bacteria 5644
164 Ga0105248_10054716 3300009177 Bacteria 4476
165 Ga0105248_10128322 3300009177 Bacteria 2861
166 Ga0105248_10253136 3300009177 Bacteria 1982
167 Ga0105248_10335202 3300009177 Bacteria 1703
168 Ga0105248_10777131 3300009177 Bacteria 1081
169 Ga0105248_10898688 3300009177 Bacteria 1000
170 Ga0105248_11003374 3300009177 Bacteria 943
171 Ga0105238_10113696 3300009551 Bacteria 2687
172 Ga0105238_10322869 3300009551 Bacteria 1530
173 Ga0105249_10322617 3300009553 Bacteria 1556
174 Ga0105249_10527759 3300009553 Bacteria 1229
175 Ga0105249_11109974 3300009553 Unclassified 861
176 Ga0157374_10581656 3300013296 Archaea 1129
177 Ga0157378_10846967 3300013297 Bacteria 942
178 Ga0163162_10021336 3300013306 Bacteria 6377
179 Ga0163162_10245428 3300013306 Bacteria 1922
180 Ga0163162_11087970 3300013306 Unclassified 905
181 Ga0157375_10024231 3300013308 Bacteria 5613
182 Ga0157375_10370756 3300013308 Bacteria 1598
183 Ga0157375_10404338 3300013308 Bacteria 1532
184 Ga0157375_10899845 3300013308 Unclassified 1029
185 Ga0163163_10000103 3300014325 Bacteria 89756
186 Ga0163163_10011984 3300014325 Bacteria 7890
187 Ga0163163_10029921 3300014325 Bacteria 5241
188 Ga0163163_10346926 3300014325 Bacteria 1540
189 Ga0157380_10346537 3300014326 Bacteria 1388
190 Ga0157380_10591565 3300014326 Bacteria 1096
191 Ga0157380_10975754 3300014326 Bacteria 879
192 Ga0157380_11053200 3300014326 Bacteria 850
193 Ga0157377_10513881 3300014745 Bacteria 839
194 Ga0157379_10160097 3300014968 Bacteria 2032
195 Ga0157376_10033278 3300014969 Bacteria 4149
196 Ga0213876_10018370 3300021384 Bacteria 3693
197 Ga0213876_10059299 3300021384 Bacteria 2020
198 Ga0207682_10064795 3300025893 Bacteria 1536
199 Ga0207642_10464818 3300025899 Bacteria 769
200 Ga0207688_10115803 3300025901 Bacteria 1560
201 Ga0207645_10005718 3300025907 Bacteria 8981
202 Ga0207645_10322439 3300025907 Bacteria 1031
203 Ga0207705_10079194 3300025909 Bacteria 2393
204 Ga0207684_10202598 3300025910 Bacteria 1712
205 Ga0207684_10487617 3300025910 Bacteria 1057
206 Ga0207707_10080665 3300025912 Bacteria 2841
207 Ga0207707_10090536 3300025912 Bacteria 2674
208 Ga0207663_10062925 3300025916 Bacteria 2361
209 Ga0207657_10003841 3300025919 Bacteria 15954
210 Ga0207657_10061506 3300025919 Bacteria 3219
211 Ga0207649_10234276 3300025920 Bacteria 1314
212 Ga0207652_10045842 3300025921 Bacteria 3728
213 Ga0207646_10145569 3300025922 Bacteria 2135
214 Ga0207681_10040309 3300025923 Bacteria 3107
215 Ga0207681_10080499 3300025923 Bacteria 2297
216 Ga0207681_10149266 3300025923 Bacteria 1750
217 Ga0207681_10336007 3300025923 Bacteria 1205
218 Ga0207681_10941331 3300025923 Bacteria 724
219 Ga0207659_10000599 3300025926 Bacteria 21514
220 Ga0207659_10076551 3300025926 Bacteria 2460
221 Ga0207659_10077842 3300025926 Bacteria 2442
222 Ga0207659_10482466 3300025926 Bacteria 1047
223 Ga0207644_10013928 3300025931 Bacteria 5373
224 Ga0207644_10394140 3300025931 Bacteria 1131
225 Ga0207690_10046975 3300025932 Bacteria 2862
226 Ga0207690_10103041 3300025932 Bacteria 2042
227 Ga0207709_10013058 3300025935 Bacteria 4579
228 Ga0207670_10428996 3300025936 Bacteria 1062
229 Ga0207669_10060099 3300025937 Bacteria 2328
230 Ga0207669_10062011 3300025937 Bacteria 2301
231 Ga0207704_10093670 3300025938 Bacteria 1981
232 Ga0207704_10253412 3300025938 Bacteria 1323
233 Ga0207704_10341673 3300025938 Bacteria 1162
234 Ga0207704_10379924 3300025938 Bacteria 1109
235 Ga0207691_10009500 3300025940 Bacteria 9339
236 Ga0207691_10009827 3300025940 Bacteria 9186
237 Ga0207691_10268707 3300025940 Bacteria 1469
238 Ga0207691_10548011 3300025940 Bacteria 981
239 Ga0207711_10006949 3300025941 Bacteria 9499
240 Ga0207711_10007766 3300025941 Bacteria 8963
241 Ga0207711_10082271 3300025941 Bacteria 2814
242 Ga0207711_10173304 3300025941 Bacteria 1959
243 Ga0207711_10410536 3300025941 Bacteria 1259
244 Ga0207711_10430809 3300025941 Bacteria 1227
245 Ga0207689_10681768 3300025942 Bacteria 866
246 Ga0207661_10759393 3300025944 Bacteria 893
247 Ga0207679_10440130 3300025945 Bacteria 1154
248 Ga0207667_10110433 3300025949 Bacteria 2836
249 Ga0207651_10450331 3300025960 Bacteria 1104
250 Ga0207712_10419129 3300025961 Bacteria 1129
251 Ga0207668_10556955 3300025972 Bacteria 994
252 Ga0207640_10006788 3300025981 Bacteria 6296
253 Ga0207640_10256572 3300025981 Bacteria 1360
254 Ga0207658_10038553 3300025986 Bacteria 3443
255 Ga0207703_10151039 3300026035 Bacteria 2025
256 Ga0207703_10619323 3300026035 Bacteria 1025
257 Ga0207703_10720252 3300026035 Bacteria 949
258 Ga0207703_11016434 3300026035 Bacteria 795
259 Ga0207678_10035075 3300026067 Bacteria 4368
260 Ga0207678_10777854 3300026067 Bacteria 844
261 Ga0207708_10006883 3300026075 Bacteria 8413
262 Ga0207708_10093232 3300026075 Bacteria 2324
263 Ga0207641_10013660 3300026088 Bacteria 6662
264 Ga0207641_10093277 3300026088 Bacteria 2639
265 Ga0207641_10371809 3300026088 Bacteria 1367
266 Ga0207648_10005029 3300026089 Bacteria 13421
267 Ga0207648_10171177 3300026089 Bacteria 1919
268 Ga0207648_10186149 3300026089 Bacteria 1839
269 Ga0207676_10755626 3300026095 Bacteria 946
270 Ga0207675_100410332 3300026118 Bacteria 1336
271 Ga0207675_100514927 3300026118 Bacteria 1192
272 Ga0207683_10026369 3300026121 Bacteria 5015
273 Ga0207683_10124767 3300026121 Bacteria 2313
274 Ga0209813_10008052 3300027866 Bacteria 2650
275 Ga0207428_10004009 3300027907 Bacteria 14134
276 Ga0207428_10008680 3300027907 Bacteria 9176
277 Ga0207428_10044841 3300027907 Bacteria 3565
278 Ga0207428_10161164 3300027907 Bacteria 1703
279 Ga0268266_10123792 3300028379 Bacteria 2304
280 Ga0268266_10142449 3300028379 Bacteria 2152
281 Ga0268266_10143761 3300028379 Bacteria 2143
282 Ga0268265_10009630 3300028380 Bacteria 6524
283 Ga0268265_10401930 3300028380 Bacteria 1266
284 Ga0268265_10750826 3300028380 Bacteria 947
285 Ga0268264_10257052 3300028381 Bacteria 1625
286 Ga0268264_10416510 3300028381 Bacteria 1295
287 Ga0265331_10007898 3300031250 Bacteria 6098
288 Ga0265331_10098831 3300031250 Bacteria 1345
289 Ga0265327_10002115 3300031251 Bacteria 21994
290 Ga0307408_100000058 3300031548 Bacteria 135057
291 Ga0265314_10076357 3300031711 Unclassified 2226
292 Ga0307409_100562823 3300031995 Bacteria 1121
293 Ga0307416_100048467 3300032002 Bacteria 3371
294 Ga0307416_100265555 3300032002 Bacteria 1681
295 Ga0307411_10046783 3300032005 Bacteria 2792
296 Ga0307415_100096066 3300032126 Bacteria 2159
297 Ga0373934_0000443 3300035086 Bacteria 14442
298 Ga0373923_0261801 3300035111 Bacteria 811
299 Ga0373953_0009267 3300035117 Bacteria 3380
300 Ga0373956_0104539 3300035119 Bacteria 1315
301 Ga0373943_0001534 3300035170 Bacteria 10453
302 Ga0373946_0011588 3300035171 Bacteria 3293
303 Ga0373946_0140867 3300035171 Bacteria 1118
304 Ga0373955_0029536 3300035172 Bacteria 2852
305 Ga0373955_0327577 3300035172 Bacteria 926
306 Ga0373924_0001417 3300035410 Bacteria 7770
307 Ga0373947_0027044 3300035725 Bacteria 3356
308 Ga0373947_0410316 3300035725 Bacteria 914
309 Ga0373937_0000330 3300036401 Bacteria 44908
310 Ga0373937_0108814 3300036401 Bacteria 2577
311 Ga0373937_0363994 3300036401 Bacteria 1371
312 Ga0373925_0013852 3300037068 Bacteria 5839
313 Ga0436365_0297701 3300039437 Bacteria 2066
314 Ga0436365_0701986 3300039437 Bacteria 3428
315 Ga0450894_024129 3300042131 Bacteria 829
316 Ga0450908_001417 3300042184 Bacteria 4656
317 Ga0450918_014022 3300042531 Bacteria 1394
318 Ga0453684_0540505 3300044712 Bacteria 1285
319 Ga0466957_0408576 3300044842 Bacteria 930
320 Ga0495580_0663047 3300046472 Bacteria 685
321 Ga0495582_0186622 3300046473 Bacteria 1182
322 Ga0495628_0184302 3300046516 Bacteria 1578
323 Ga0495640_0097576 3300046533 Bacteria 1932
324 Ga0495586_0185706 3300046535 Bacteria 1177
325 Ga0495598_0181666 3300046537 Unclassified 751
326 Ga0495656_0058636 3300046615 Bacteria 1672
327 Ga0495634_0663207 3300046642 Bacteria 602
328 Ga0495599_0148489 3300046678 Bacteria 1453
329 Ga0495658_0192482 3300046683 Bacteria 1269
330 Ga0495613_0188475 3300046689 Bacteria 1459
331 Ga0495613_0222763 3300046689 Bacteria 1324
332 Ga0495613_0272931 3300046689 Bacteria 1176
333 Ga0495670_0104153 3300046691 Bacteria 1464
334 Ga0495684_0040817 3300047471 Bacteria 3557
335 Ga0496100_0010930 3300048903 Bacteria 5151
336 Ga0496101_0000227 3300048904 Bacteria 42022
337 Ga0496102_0336970 3300048905 Bacteria 1421
338 Ga0496102_0565244 3300048905 Bacteria 1060
339 Ga0496104_0009734 3300048907 Bacteria 8567
340 Ga0496104_0026390 3300048907 Bacteria 5364
341 Ga0496104_0172877 3300048907 Bacteria 2071
342 Ga0496105_0242799 3300048908 Bacteria 1461
343 Ga0496106_0055850 3300048909 Bacteria 2985
344 Ga0496106_0367023 3300048909 Bacteria 1157
345 Ga0496107_0022106 3300048910 Bacteria 4494
346 Ga0496108_0202931 3300048911 Bacteria 1721
347 Ga0496108_0547954 3300048911 Bacteria 1009
348 Ga0496108_1046009 3300048911 Bacteria 696
349 Ga0496109_0261207 3300048912 Bacteria 1631
350 Ga0496109_0905192 3300048912 Bacteria 820
351 Ga0496110_0167525 3300048913 Bacteria 1993
352 Ga0496110_0176769 3300048913 Bacteria 1938
353 Ga0496111_0415378 3300048914 Bacteria 994
354 Ga0496112_0004111 3300048915 Bacteria 12236
355 Ga0496112_0121873 3300048915 Bacteria 2578
356 Ga0496112_0525148 3300048915 Bacteria 1118
357 Ga0496112_0621581 3300048915 Bacteria 1011
358 Ga0496113_0009082 3300048916 Bacteria 6515
359 Ga0496114_0000536 3300048917 Bacteria 28013
360 Ga0496115_0164650 3300048918 Bacteria 1834
361 Ga0501034_0021223 3300049571 Bacteria 6624
362 Ga0501034_0490932 3300049571 Bacteria 1142
363 Ga0501036_0155052 3300049572 Bacteria 1932
364 Ga0501040_0462002 3300049576 Unclassified 914
365 Ga0501041_0483880 3300049577 Bacteria 787
366 Ga0501047_0161292 3300049581 Bacteria 2114
367 Ga0501047_0577620 3300049581 Bacteria 947
368 Ga0501048_0603503 3300049582 Unclassified 788
369 Ga0501069_0339606 3300049585 Bacteria 884
370 Ga0501073_0042142 3300049589 Bacteria 3223
371 Ga0501074_0126740 3300049590 Unclassified 1827
372 Ga0501076_0111540 3300049592 Bacteria 2211
373 Ga0501079_0363335 3300049741 Unclassified 1135
374 Ga0501080_0327204 3300049742 Bacteria 1387
375 Ga0501044_0004995 3300049823 Bacteria 14809
376 Ga0501045_0289617 3300049824 Unclassified 1219
377 nmdc:mga03683_5676_c1 3300050489 Bacteria 4228
378 nmdc:mga03n38_144158_c1 3300050490 Bacteria 1192
379 nmdc:mga03n38_32150_c1 3300050490 Bacteria 2220
380 nmdc:mga00v17_138063_c1 3300050491 Bacteria 1562
381 nmdc:mga00v17_24876_c1 3300050491 Bacteria 3476
382 nmdc:mga00v17_51725_c1 3300050491 Bacteria 2498
383 nmdc:mga00v17_555581_c1 3300050491 Bacteria 742
384 nmdc:mga00v17_60039_c1 3300050491 Bacteria 2334
385 nmdc:mga0k408_113271_c1 3300050493 Bacteria 1604
386 nmdc:mga0k408_14670_c1 3300050493 Bacteria 4321
387 nmdc:mga0k408_185541_c1 3300050493 Bacteria 1241
388 nmdc:mga0k408_5113_c1 3300050493 Bacteria 6946
389 nmdc:mga0k408_61677_c1 3300050493 Bacteria 2180
390 nmdc:mga06z11_182516_c1 3300050494 Bacteria 1211
391 nmdc:mga06z11_27039_c1 3300050494 Bacteria 2739
392 nmdc:mga06z11_35148_c1 3300050494 Bacteria 2465
393 nmdc:mga04h51_4155_c1 3300050495 Bacteria 3575
394 nmdc:mga07m45_12379_c2 3300050496 Bacteria 3295
395 nmdc:mga07m45_26004_c1 3300050496 Bacteria 3215
396 nmdc:mga07m45_35175_c1 3300050496 Bacteria 2786
397 nmdc:mga07m45_98577_c1 3300050496 Bacteria 1678
398 nmdc:mga05p37_17920_c1 3300050507 Bacteria 8549
399 nmdc:mga05p37_388_c1 3300050507 Bacteria 39947
400 nmdc:mga05p37_48306_c1 3300050507 Bacteria 5234
401 nmdc:mga05p37_8563_c1 3300050507 Bacteria 12091
402 nmdc:mga09592_118040_c1 3300050508 Bacteria 2277
403 nmdc:mga08y16_133289_c1 3300050511 Bacteria 2583
404 nmdc:mga08y16_198412_c1 3300050511 Bacteria 2080
405 nmdc:mga08y16_231821_c1 3300050511 Bacteria 1910
406 nmdc:mga08y16_452725_c1 3300050511 Bacteria 1309
407 nmdc:mga08y16_68325_c1 3300050511 Bacteria 3705
408 nmdc:mga0n895_486152_c1 3300050512 Bacteria 1245
409 nmdc:mga0a205_147650_c1 3300050515 Bacteria 2251
410 nmdc:mga0a205_40970_c1 3300050515 Bacteria 4460
411 nmdc:mga0a205_432611_c1 3300050515 Bacteria 1177
412 Ga0495619_0291727 3300053085 Bacteria 1130
413 Ga0495619_0308625 3300053085 Bacteria 1096
414 Ga0501084_0524453 3300054114 Unclassified 1001
415 Ga0501084_0529955 3300054114 Unclassified 996
416 Ga0530510_0127411 3300061734 Unclassified 1872
417 Ga0207676_10667341
418 JGI24751J29686_10005658
419 rootH2_10005888
420 rootH1_10200149
421 Ga0065712_10023855
422 Ga0065712_10161524
423 Ga0065712_10187960
424 Ga0065715_10007480
425 Ga0065707_10094231
426 Ga0070658_10034975
427 Ga0070676_10520826
428 Ga0070690_100034102
429 Ga0070670_100176484
430 Ga0070670_100522811
431 Ga0070670_100680296
432 Ga0068869_100339092
433 Ga0070680_100253170
434 Ga0070682_100270234
435 Ga0070660_100011686
436 Ga0070660_100050614
437 Ga0070689_100307967
438 Ga0070689_100680675
439 Ga0070691_10000973
440 Ga0070669_100024614
441 Ga0070669_100105538
442 Ga0070669_100225003
443 Ga0070669_100295047
444 Ga0070675_100082159
445 Ga0070675_100475709
446 Ga0070675_100521939
447 Ga0070675_101204535
448 Ga0070671_100026062
449 Ga0070671_100085264
450 Ga0070674_100085102
451 Ga0070674_100120098
452 Ga0070673_100090279
453 Ga0070673_100108205
454 Ga0070673_100134431
455 Ga0070673_100137119
456 Ga0070673_100534409
457 Ga0070688_100248493
458 Ga0070688_100323719
459 Ga0070659_100140493
460 Ga0070667_100005997
461 Ga0070709_10123900
462 Ga0070711_100174501
463 Ga0070705_100007659
464 Ga0070700_100004264
465 Ga0070700_100273832
466 Ga0070694_100005696
467 Ga0070663_100216587
468 Ga0070678_100019649
469 Ga0070678_100080445
470 Ga0070662_100451333
471 Ga0070681_10020794
472 Ga0070681_10217145
473 Ga0070681_10703872
474 Ga0070706_100253717
475 Ga0070706_100502612
476 Ga0070679_100233068
477 Ga0070672_100129545
478 Ga0070672_100182629
479 Ga0070686_100038232
480 Ga0070695_100006963
481 Ga0070695_100256128
482 Ga0070696_100012338
483 Ga0070665_100026627
484 Ga0070665_100206499
485 Ga0070665_100811076
486 Ga0070704_100001589
487 Ga0070704_100088576
488 Ga0070704_100156707
489 Ga0068855_100306124
490 Ga0070664_100142927
491 Ga0070664_100636431
492 Ga0068854_100039286
493 Ga0068854_100282071
494 Ga0068856_100363012
495 Ga0070702_100011680
496 Ga0068859_100019084
497 Ga0068859_100128424
498 Ga0068859_100192852
499 Ga0068859_100368755
500 Ga0068859_100382767
501 Ga0068859_100622821
502 Ga0068859_101085572
503 Ga0068859_101091204
504 Ga0068864_100312228
505 Ga0068866_10522431
506 Ga0068861_100452351
507 Ga0068851_10140023
508 Ga0068863_100003258
509 Ga0068858_100022553
510 Ga0068858_100090475
511 Ga0068858_100337565
512 Ga0068858_100602459
513 Ga0068860_100122279
514 Ga0068860_100920892
515 Ga0068862_100039269
516 Ga0068862_100375665
517 Ga0068862_100386917
518 Ga0081455_10026756
519 Ga0070717_10079020
520 Ga0075365_10014739
521 Ga0075368_10050175
522 Ga0075368_10065401
523 Ga0075368_10079422
524 Ga0075363_100063856
525 Ga0075363_100074778
526 Ga0075364_10014970
527 Ga0075364_10053231
528 Ga0075364_10451614
529 Ga0075432_10020564
530 Ga0070715_10233555
531 Ga0075362_10001172
532 Ga0075367_10003100
533 Ga0075367_10017302
534 Ga0075367_10232475
535 Ga0075367_10428287
536 Ga0075369_10185302
537 Ga0075366_10000820
538 Ga0075366_10001838
539 Ga0075366_10008708
540 Ga0075366_10017005
541 Ga0075366_10030963
542 Ga0075366_10229813
543 Ga0097621_100087671
544 Ga0097621_100101295
545 Ga0075370_10001492
546 Ga0075370_10085357
547 Ga0068871_100029582
548 Ga0068871_100212853
549 Ga0068871_100245593
550 Ga0075428_100856822
551 Ga0075428_100869285
552 Ga0075433_10026097
553 Ga0075433_10071676
554 Ga0075429_100092203
555 Ga0068865_100417817
556 Ga0068865_100473912
557 Ga0097620_100019080
558 Ga0097620_100128428
559 Ga0097620_100192858
560 Ga0097620_100368782
561 Ga0097620_100382763
562 Ga0097620_100622835
563 Ga0097620_101085675
564 Ga0097620_101091228
565 Ga0105251_10301744
566 Ga0105240_10274441
567 Ga0111539_10001448
568 Ga0111539_11389783
569 Ga0105245_10018809
570 Ga0105245_10391419
571 Ga0105245_11558726
572 Ga0114129_10000513
573 Ga0114129_10010117
574 Ga0114129_10026668
575 Ga0105243_11040181
576 Ga0105242_10941650
577 Ga0105248_10003412
578 Ga0105248_10010662
579 Ga0105248_10034698
580 Ga0105248_10054716
581 Ga0105248_10128322
582 Ga0105248_10253136
583 Ga0105248_10335202
584 Ga0105248_10777131
585 Ga0105248_10898688
586 Ga0105248_11003374
587 Ga0105238_10113696
588 Ga0105238_10322869
589 Ga0105249_10322617
590 Ga0105249_10527759
591 Ga0105249_11109974
592 Ga0157374_10581656
593 Ga0157378_10846967
594 Ga0163162_10021336
595 Ga0163162_10245428
596 Ga0163162_11087970
597 Ga0157375_10024231
598 Ga0157375_10370756
599 Ga0157375_10404338
600 Ga0157375_10899845
601 Ga0163163_10000103
602 Ga0163163_10011984
603 Ga0163163_10029921
604 Ga0163163_10346926
605 Ga0157380_10346537
606 Ga0157380_10591565
607 Ga0157380_10975754
608 Ga0157380_11053200
609 Ga0157377_10513881
610 Ga0157379_10160097
611 Ga0157376_10033278
612 Ga0213876_10018370
613 Ga0213876_10059299
614 Ga0207682_10064795
615 Ga0207642_10464818
616 Ga0207688_10115803
617 Ga0207645_10005718
618 Ga0207645_10322439
619 Ga0207705_10079194
620 Ga0207684_10202598
621 Ga0207684_10487617
622 Ga0207707_10080665
623 Ga0207707_10090536
624 Ga0207663_10062925
625 Ga0207657_10003841
626 Ga0207657_10061506
627 Ga0207649_10234276
628 Ga0207652_10045842
629 Ga0207646_10145569
630 Ga0207681_10040309
631 Ga0207681_10080499
632 Ga0207681_10149266
633 Ga0207681_10336007
634 Ga0207681_10941331
635 Ga0207659_10000599
636 Ga0207659_10076551
637 Ga0207659_10077842
638 Ga0207659_10482466
639 Ga0207644_10013928
640 Ga0207644_10394140
641 Ga0207690_10046975
642 Ga0207690_10103041
643 Ga0207709_10013058
644 Ga0207670_10428996
645 Ga0207669_10060099
646 Ga0207669_10062011
647 Ga0207704_10093670
648 Ga0207704_10253412
649 Ga0207704_10341673
650 Ga0207704_10379924
651 Ga0207691_10009500
652 Ga0207691_10009827
653 Ga0207691_10268707
654 Ga0207691_10548011
655 Ga0207711_10006949
656 Ga0207711_10007766
657 Ga0207711_10082271
658 Ga0207711_10173304
659 Ga0207711_10410536
660 Ga0207711_10430809
661 Ga0207689_10681768
662 Ga0207661_10759393
663 Ga0207679_10440130
664 Ga0207667_10110433
665 Ga0207651_10450331
666 Ga0207712_10419129
667 Ga0207668_10556955
668 Ga0207640_10006788
669 Ga0207640_10256572
670 Ga0207658_10038553
671 Ga0207703_10151039
672 Ga0207703_10619323
673 Ga0207703_10720252
674 Ga0207703_11016434
675 Ga0207678_10035075
676 Ga0207678_10777854
677 Ga0207708_10006883
678 Ga0207708_10093232
679 Ga0207641_10013660
680 Ga0207641_10093277
681 Ga0207641_10371809
682 Ga0207648_10005029
683 Ga0207648_10171177
684 Ga0207648_10186149
685 Ga0207676_10755626
686 Ga0207675_100410332
687 Ga0207675_100514927
688 Ga0207683_10026369
689 Ga0207683_10124767
690 Ga0209813_10008052
691 Ga0207428_10004009
692 Ga0207428_10008680
693 Ga0207428_10044841
694 Ga0207428_10161164
695 Ga0268266_10123792
696 Ga0268266_10142449
697 Ga0268266_10143761
698 Ga0268265_10009630
699 Ga0268265_10401930
700 Ga0268265_10750826
701 Ga0268264_10257052
702 Ga0268264_10416510
703 Ga0265331_10007898
704 Ga0265331_10098831
705 Ga0265327_10002115
706 Ga0307408_100000058
707 Ga0265314_10076357
708 Ga0307409_100562823
709 Ga0307416_100048467
710 Ga0307416_100265555
711 Ga0307411_10046783
712 Ga0307415_100096066
713 Ga0373934_0000443
714 Ga0373923_0261801
715 Ga0373953_0009267
716 Ga0373956_0104539
717 Ga0373943_0001534
718 Ga0373946_0011588
719 Ga0373946_0140867
720 Ga0373955_0029536
721 Ga0373955_0327577
722 Ga0373924_0001417
723 Ga0373947_0027044
724 Ga0373947_0410316
725 Ga0373937_0000330
726 Ga0373937_0108814
727 Ga0373937_0363994
728 Ga0373925_0013852
729 Ga0436365_0297701
730 Ga0436365_0701986
731 Ga0450894_024129
732 Ga0450908_001417
733 Ga0450918_014022
734 Ga0453684_0540505
735 Ga0466957_0408576
736 Ga0495580_0663047
737 Ga0495582_0186622
738 Ga0495628_0184302
739 Ga0495640_0097576
740 Ga0495586_0185706
741 Ga0495598_0181666
742 Ga0495656_0058636
743 Ga0495634_0663207
744 Ga0495599_0148489
745 Ga0495658_0192482
746 Ga0495613_0188475
747 Ga0495613_0222763
748 Ga0495613_0272931
749 Ga0495670_0104153
750 Ga0495684_0040817
751 Ga0496100_0010930
752 Ga0496101_0000227
753 Ga0496102_0336970
754 Ga0496102_0565244
755 Ga0496104_0009734
756 Ga0496104_0026390
757 Ga0496104_0172877
758 Ga0496105_0242799
759 Ga0496106_0055850
760 Ga0496106_0367023
761 Ga0496107_0022106
762 Ga0496108_0202931
763 Ga0496108_0547954
764 Ga0496108_1046009
765 Ga0496109_0261207
766 Ga0496109_0905192
767 Ga0496110_0167525
768 Ga0496110_0176769
769 Ga0496111_0415378
770 Ga0496112_0004111
771 Ga0496112_0121873
772 Ga0496112_0525148
773 Ga0496112_0621581
774 Ga0496113_0009082
775 Ga0496114_0000536
776 Ga0496115_0164650
777 Ga0501034_0021223
778 Ga0501034_0490932
779 Ga0501036_0155052
780 Ga0501040_0462002
781 Ga0501041_0483880
782 Ga0501047_0161292
783 Ga0501047_0577620
784 Ga0501048_0603503
785 Ga0501069_0339606
786 Ga0501073_0042142
787 Ga0501074_0126740
788 Ga0501076_0111540
789 Ga0501079_0363335
790 Ga0501080_0327204
791 Ga0501044_0004995
792 Ga0501045_0289617
793 nmdc:mga03683_5676_c1
794 nmdc:mga03n38_144158_c1
795 nmdc:mga03n38_32150_c1
796 nmdc:mga00v17_138063_c1
797 nmdc:mga00v17_24876_c1
798 nmdc:mga00v17_51725_c1
799 nmdc:mga00v17_555581_c1
800 nmdc:mga00v17_60039_c1
801 nmdc:mga0k408_113271_c1
802 nmdc:mga0k408_14670_c1
803 nmdc:mga0k408_185541_c1
804 nmdc:mga0k408_5113_c1
805 nmdc:mga0k408_61677_c1
806 nmdc:mga06z11_182516_c1
807 nmdc:mga06z11_27039_c1
808 nmdc:mga06z11_35148_c1
809 nmdc:mga04h51_4155_c1
810 nmdc:mga07m45_12379_c2
811 nmdc:mga07m45_26004_c1
812 nmdc:mga07m45_35175_c1
813 nmdc:mga07m45_98577_c1
814 nmdc:mga05p37_17920_c1
815 nmdc:mga05p37_388_c1
816 nmdc:mga05p37_48306_c1
817 nmdc:mga05p37_8563_c1
818 nmdc:mga09592_118040_c1
819 nmdc:mga08y16_133289_c1
820 nmdc:mga08y16_198412_c1
821 nmdc:mga08y16_231821_c1
822 nmdc:mga08y16_452725_c1
823 nmdc:mga08y16_68325_c1
824 nmdc:mga0n895_486152_c1
825 nmdc:mga0a205_147650_c1
826 nmdc:mga0a205_40970_c1
827 nmdc:mga0a205_432611_c1
828 Ga0495619_0291727
829 Ga0495619_0308625
830 Ga0501084_0524453
831 Ga0501084_0529955
832 Ga0530510_0127411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

56

194

0.92

Map