F438824

General Info

Members Datasets Scaffolds Average Seq Length
416 195 412 206

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10415537|Ga0207681_104155372
Length 239
Sequence MTTVQLTHEATPLPRRTVPEPRPAGLVADIVSIAGRALRGVTRDLEAVTPPIFIALFFFLVNFLAPVPQAVKIFVATGAFMVAMVAAMLFSAIRYHRISPLLWFSGVMVVVLGGLTIYLHDETFIKMKPTVYYVLVAGILAFGLATGKPLLKAVLGSTYPGLDDAGWVKLTRNWAVFFAAMAVLNEGVWRNSSTEFWIGFKIWGAIPLTFLFALANVPMLMRHGLTREDAVPVEPGPVE

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
169 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
170 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
171 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
178 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
179 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
180 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
181 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
182 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
188 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
189 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
192 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
193 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0.48
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 2.4
Rhizosphere 95.19
Stem 0
Stem Tuber 0.24
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10084506 3300005290 Bacteria 2758
2 Ga0065712_10176602 3300005290 Bacteria 1202
3 Ga0065715_10091763 3300005293 Bacteria 5549
4 Ga0065715_10092828 3300005293 Bacteria 4919
5 Ga0065715_10096871 3300005293 Bacteria 3804
6 Ga0065715_10118965 3300005293 Bacteria 2300
7 Ga0065715_10324678 3300005293 Bacteria 995
8 Ga0065707_10453515 3300005295 Bacteria 798
9 Ga0070658_10091592 3300005327 Bacteria 2505
10 Ga0070658_10450866 3300005327 Bacteria 1108
11 Ga0070658_10606940 3300005327 Bacteria 948
12 Ga0070676_10022149 3300005328 Bacteria 3562
13 Ga0070676_10023262 3300005328 Bacteria 3482
14 Ga0070676_10183645 3300005328 Bacteria 1361
15 Ga0070683_100037375 3300005329 Bacteria 4445
16 Ga0070683_100950859 3300005329 Bacteria 824
17 Ga0070690_100010452 3300005330 Bacteria 5402
18 Ga0070670_100006155 3300005331 Bacteria 10144
19 Ga0070670_100455817 3300005331 Bacteria 1134
20 Ga0070677_10012981 3300005333 Bacteria 2903
21 Ga0068869_100289637 3300005334 Bacteria 1319
22 Ga0070666_10000784 3300005335 Bacteria 19242
23 Ga0070680_100030875 3300005336 Bacteria 4305
24 Ga0068868_100002185 3300005338 Bacteria 13483
25 Ga0070660_100000378 3300005339 Bacteria 29634
26 Ga0070660_100031954 3300005339 Bacteria 3958
27 Ga0070660_100047116 3300005339 Bacteria 3306
28 Ga0070660_100214587 3300005339 Bacteria 1563
29 Ga0070660_100530740 3300005339 Bacteria 981
30 Ga0070689_100439803 3300005340 Bacteria 1108
31 Ga0070689_100487395 3300005340 Bacteria 1054
32 Ga0070687_100048174 3300005343 Bacteria 2190
33 Ga0070661_100318216 3300005344 Bacteria 1215
34 Ga0070661_100466104 3300005344 Bacteria 1007
35 Ga0070661_100534249 3300005344 Bacteria 942
36 Ga0070692_10038321 3300005345 Bacteria 2442
37 Ga0070668_100011377 3300005347 Bacteria 6628
38 Ga0070669_100002456 3300005353 Bacteria 13414
39 Ga0070669_100025109 3300005353 Bacteria 4279
40 Ga0070675_100008845 3300005354 Bacteria 7827
41 Ga0070675_100133866 3300005354 Bacteria 2114
42 Ga0070675_100717356 3300005354 Bacteria 911
43 Ga0070671_100002317 3300005355 Bacteria 14704
44 Ga0070671_100004451 3300005355 Bacteria 11086
45 Ga0070671_100014767 3300005355 Bacteria 6310
46 Ga0070671_100049518 3300005355 Bacteria 3495
47 Ga0070674_100039908 3300005356 Bacteria 3173
48 Ga0070674_100298245 3300005356 Bacteria 1284
49 Ga0070673_100042870 3300005364 Bacteria 3492
50 Ga0070673_100060706 3300005364 Bacteria 2997
51 Ga0070673_100373716 3300005364 Bacteria 1269
52 Ga0070673_100431387 3300005364 Bacteria 1183
53 Ga0070673_100447425 3300005364 Bacteria 1162
54 Ga0070688_100456781 3300005365 Bacteria 956
55 Ga0070659_100029716 3300005366 Bacteria 4224
56 Ga0070659_100083949 3300005366 Bacteria 2546
57 Ga0070659_100167779 3300005366 Bacteria 1797
58 Ga0070659_100252790 3300005366 Bacteria 1461
59 Ga0070659_100255435 3300005366 Bacteria 1453
60 Ga0070667_100000764 3300005367 Bacteria 30578
61 Ga0070667_100007799 3300005367 Bacteria 8876
62 Ga0070667_100398932 3300005367 Bacteria 1252
63 Ga0070714_100056771 3300005435 Bacteria 3349
64 Ga0070701_10176601 3300005438 Bacteria 1247
65 Ga0070701_10649046 3300005438 Bacteria 704
66 Ga0070705_100403222 3300005440 Bacteria 1013
67 Ga0070663_100043380 3300005455 Bacteria 3165
68 Ga0070678_100042720 3300005456 Bacteria 3224
69 Ga0070662_100002737 3300005457 Bacteria 10895
70 Ga0070662_100019234 3300005457 Bacteria 4635
71 Ga0070662_100162232 3300005457 Bacteria 1749
72 Ga0070662_100780286 3300005457 Bacteria 812
73 Ga0070681_10025117 3300005458 Bacteria 5995
74 Ga0070681_10435759 3300005458 Bacteria 1223
75 Ga0068867_100028267 3300005459 Bacteria 4037
76 Ga0070679_100015243 3300005530 Bacteria 7385
77 Ga0070679_100507056 3300005530 Bacteria 1150
78 Ga0070672_100006190 3300005543 Bacteria 8014
79 Ga0070672_100039976 3300005543 Bacteria 3596
80 Ga0070672_100085152 3300005543 Bacteria 2540
81 Ga0070696_100257168 3300005546 Bacteria 1323
82 Ga0070665_100355686 3300005548 Bacteria 1470
83 Ga0068855_100000480 3300005563 Bacteria 49187
84 Ga0070664_100043149 3300005564 Bacteria 3805
85 Ga0070664_100318865 3300005564 Bacteria 1408
86 Ga0068856_100080752 3300005614 Bacteria 3225
87 Ga0068856_100339590 3300005614 Bacteria 1520
88 Ga0068852_100099196 3300005616 Bacteria 2625
89 Ga0068859_100017860 3300005617 Bacteria 7130
90 Ga0068859_100158186 3300005617 Bacteria 2344
91 Ga0068859_100161391 3300005617 Bacteria 2320
92 Ga0068864_100000894 3300005618 Bacteria 25097
93 Ga0068864_100065708 3300005618 Bacteria 3147
94 Ga0068864_100194547 3300005618 Bacteria 1860
95 Ga0068861_100000175 3300005719 Bacteria 34015
96 Ga0068861_100158261 3300005719 Bacteria 1866
97 Ga0068851_10010411 3300005834 Bacteria 4342
98 Ga0068863_100399104 3300005841 Bacteria 1345
99 Ga0068858_100000640 3300005842 Bacteria 36414
100 Ga0068860_101005135 3300005843 Bacteria 852
101 Ga0068862_100007623 3300005844 Bacteria 8964
102 Ga0068862_100563795 3300005844 Bacteria 1089
103 Ga0081539_10026054 3300005985 Bacteria 3745
104 Ga0075362_10040243 3300006177 Bacteria 2058
105 Ga0068865_100081903 3300006881 Bacteria 2319
106 Ga0097620_100017863 3300006931 Bacteria 7130
107 Ga0097620_100158190 3300006931 Bacteria 2344
108 Ga0097620_100161393 3300006931 Bacteria 2320
109 Ga0111539_10168479 3300009094 Bacteria 2560
110 Ga0111539_10295458 3300009094 Bacteria 1885
111 Ga0105245_10486500 3300009098 Bacteria 1248
112 Ga0105243_10123290 3300009148 Bacteria 2188
113 Ga0105248_10002046 3300009177 Bacteria 22341
114 Ga0105248_10002343 3300009177 Bacteria 21013
115 Ga0105248_10015490 3300009177 Bacteria 8406
116 Ga0105248_10176280 3300009177 Bacteria 2409
117 Ga0105238_10376350 3300009551 Bacteria 1411
118 Ga0105249_10076331 3300009553 Bacteria 3106
119 Ga0105249_11301900 3300009553 Bacteria 798
120 Ga0157373_10033456 3300013100 Bacteria 3698
121 Ga0157373_10132063 3300013100 Bacteria 1756
122 Ga0157373_10185534 3300013100 Bacteria 1465
123 Ga0157373_10227522 3300013100 Bacteria 1316
124 Ga0157373_10321433 3300013100 Bacteria 1101
125 Ga0157371_10030723 3300013102 Bacteria 3873
126 Ga0157371_10100232 3300013102 Bacteria 2054
127 Ga0157371_10315238 3300013102 Bacteria 1134
128 Ga0157370_10181923 3300013104 Bacteria 1953
129 Ga0157370_10331291 3300013104 Bacteria 1404
130 Ga0157369_10070336 3300013105 Bacteria 3760
131 Ga0157374_10216125 3300013296 Bacteria 1880
132 Ga0157378_10810233 3300013297 Bacteria 963
133 Ga0163162_10036415 3300013306 Bacteria 4904
134 Ga0157375_11231913 3300013308 Bacteria 878
135 Ga0157380_10002596 3300014326 Bacteria 12212
136 Ga0157380_10005862 3300014326 Bacteria 8598
137 Ga0157380_10008816 3300014326 Bacteria 7206
138 Ga0157380_10106592 3300014326 Bacteria 2346
139 Ga0157380_10203668 3300014326 Bacteria 1758
140 Ga0157380_10271903 3300014326 Bacteria 1545
141 Ga0157380_10303844 3300014326 Bacteria 1471
142 Ga0157380_10454245 3300014326 Bacteria 1231
143 Ga0157377_10147241 3300014745 Bacteria 1453
144 Ga0157379_10199522 3300014968 Bacteria 1809
145 Ga0157379_10428330 3300014968 Bacteria 1219
146 Ga0163161_10176785 3300017792 Bacteria 1635
147 Ga0213873_10000027 3300021358 Bacteria 73909
148 Ga0213876_10000004 3300021384 Bacteria 943822
149 Ga0207697_10004971 3300025315 Bacteria 6266
150 Ga0207682_10003569 3300025893 Bacteria 6729
151 Ga0207682_10121662 3300025893 Bacteria 1158
152 Ga0207682_10123582 3300025893 Bacteria 1150
153 Ga0207688_10028597 3300025901 Bacteria 3067
154 Ga0207680_10004489 3300025903 Bacteria 6622
155 Ga0207647_10144169 3300025904 Bacteria 1395
156 Ga0207647_10155673 3300025904 Bacteria 1334
157 Ga0207645_10007557 3300025907 Bacteria 7665
158 Ga0207645_10024046 3300025907 Bacteria 3953
159 Ga0207645_10080887 3300025907 Bacteria 2083
160 Ga0207705_10000131 3300025909 Bacteria 81639
161 Ga0207705_10040845 3300025909 Bacteria 3327
162 Ga0207705_10060901 3300025909 Bacteria 2727
163 Ga0207705_10144434 3300025909 Bacteria 1779
164 Ga0207705_10243508 3300025909 Bacteria 1370
165 Ga0207707_10026676 3300025912 Bacteria 5050
166 Ga0207660_10012930 3300025917 Bacteria 5467
167 Ga0207660_10017556 3300025917 Bacteria 4756
168 Ga0207660_10139263 3300025917 Bacteria 1854
169 Ga0207662_10125364 3300025918 Bacteria 1614
170 Ga0207657_10001988 3300025919 Bacteria 22083
171 Ga0207657_10005362 3300025919 Bacteria 13431
172 Ga0207657_10148417 3300025919 Bacteria 1911
173 Ga0207657_10450379 3300025919 Bacteria 1010
174 Ga0207649_10142944 3300025920 Bacteria 1639
175 Ga0207649_10296490 3300025920 Bacteria 1181
176 Ga0207652_10007449 3300025921 Bacteria 8819
177 Ga0207681_10001934 3300025923 Bacteria 13274
178 Ga0207681_10007817 3300025923 Bacteria 6550
179 Ga0207681_10045690 3300025923 Bacteria 2942
180 Ga0207681_10224644 3300025923 Bacteria 1454
181 Ga0207681_10415537 3300025923 Bacteria 1089
182 Ga0207650_10004848 3300025925 Bacteria 9191
183 Ga0207650_10116013 3300025925 Bacteria 2079
184 Ga0207659_10001721 3300025926 Bacteria 12974
185 Ga0207659_10324977 3300025926 Bacteria 1270
186 Ga0207687_10362367 3300025927 Bacteria 1183
187 Ga0207664_10510744 3300025929 Bacteria 1076
188 Ga0207644_10003063 3300025931 Bacteria 10763
189 Ga0207644_10027443 3300025931 Bacteria 3932
190 Ga0207644_10574438 3300025931 Bacteria 934
191 Ga0207690_10052000 3300025932 Bacteria 2742
192 Ga0207690_10143624 3300025932 Bacteria 1762
193 Ga0207690_10324315 3300025932 Bacteria 1211
194 Ga0207690_10326359 3300025932 Bacteria 1208
195 Ga0207690_10342785 3300025932 Bacteria 1180
196 Ga0207690_10428609 3300025932 Bacteria 1059
197 Ga0207706_10000187 3300025933 Bacteria 69090
198 Ga0207706_10003204 3300025933 Bacteria 15707
199 Ga0207706_10415131 3300025933 Bacteria 1166
200 Ga0207709_10075248 3300025935 Bacteria 2157
201 Ga0207670_10354436 3300025936 Bacteria 1163
202 Ga0207669_10024247 3300025937 Bacteria 3257
203 Ga0207704_10047457 3300025938 Bacteria 2567
204 Ga0207691_10046477 3300025940 Bacteria 3989
205 Ga0207691_10232747 3300025940 Bacteria 1595
206 Ga0207691_10274334 3300025940 Bacteria 1452
207 Ga0207711_10000174 3300025941 Bacteria 69263
208 Ga0207711_10005404 3300025941 Bacteria 10801
209 Ga0207661_10034157 3300025944 Bacteria 3953
210 Ga0207661_11024429 3300025944 Bacteria 760
211 Ga0207679_10012419 3300025945 Bacteria 5554
212 Ga0207679_10374368 3300025945 Bacteria 1247
213 Ga0207667_10000586 3300025949 Bacteria 47384
214 Ga0207667_10302421 3300025949 Bacteria 1634
215 Ga0207651_10077470 3300025960 Bacteria 2380
216 Ga0207651_10336456 3300025960 Bacteria 1267
217 Ga0207712_10039206 3300025961 Bacteria 3244
218 Ga0207668_10004109 3300025972 Bacteria 8547
219 Ga0207668_10024258 3300025972 Bacteria 3912
220 Ga0207668_10075722 3300025972 Bacteria 2420
221 Ga0207640_10063592 3300025981 Bacteria 2453
222 Ga0207658_10006584 3300025986 Bacteria 7918
223 Ga0207677_10006421 3300026023 Bacteria 6449
224 Ga0207703_10001865 3300026035 Bacteria 18737
225 Ga0207678_10006377 3300026067 Bacteria 10473
226 Ga0207678_10022045 3300026067 Bacteria 5580
227 Ga0207702_10274347 3300026078 Bacteria 1592
228 Ga0207641_10383877 3300026088 Bacteria 1346
229 Ga0207648_10068054 3300026089 Bacteria 3103
230 Ga0207648_10327250 3300026089 Bacteria 1378
231 Ga0207676_10121962 3300026095 Bacteria 2200
232 Ga0207676_10125701 3300026095 Bacteria 2171
233 Ga0207675_100000049 3300026118 Bacteria 84016
234 Ga0207675_100006920 3300026118 Bacteria 10730
235 Ga0207675_100208497 3300026118 Bacteria 1879
236 Ga0207683_10037057 3300026121 Bacteria 4247
237 Ga0207698_10085354 3300026142 Bacteria 2563
238 Ga0209970_1029217 3300027614 Bacteria 954
239 Ga0209971_1011541 3300027682 Bacteria 2093
240 Ga0268265_10008756 3300028380 Bacteria 6837
241 Ga0268265_10377458 3300028380 Bacteria 1303
242 Ga0268265_10611184 3300028380 Bacteria 1043
243 Ga0268265_11419799 3300028380 Bacteria 696
244 Ga0316182_1142144 3300030745 Bacteria 2057
245 Ga0307408_100183833 3300031548 Bacteria 1678
246 Ga0307408_100284952 3300031548 Bacteria 1377
247 Ga0307405_10054997 3300031731 Bacteria 2488
248 Ga0307405_10061517 3300031731 Bacteria 2374
249 Ga0307405_10168990 3300031731 Bacteria 1558
250 Ga0307413_10021873 3300031824 Bacteria 3433
251 Ga0307413_10035729 3300031824 Bacteria 2853
252 Ga0307413_10097916 3300031824 Bacteria 1929
253 Ga0307413_10713573 3300031824 Bacteria 834
254 Ga0307410_10005881 3300031852 Bacteria 6552
255 Ga0307410_10009767 3300031852 Bacteria 5400
256 Ga0307410_10028474 3300031852 Bacteria 3544
257 Ga0307410_10140968 3300031852 Bacteria 1783
258 Ga0307410_10275135 3300031852 Bacteria 1319
259 Ga0307410_10417765 3300031852 Bacteria 1087
260 Ga0307410_10539663 3300031852 Bacteria 965
261 Ga0307406_10276977 3300031901 Bacteria 1277
262 Ga0307406_10283667 3300031901 Bacteria 1264
263 Ga0307406_10501489 3300031901 Bacteria 984
264 Ga0307407_10015599 3300031903 Bacteria 3762
265 Ga0307407_10023000 3300031903 Bacteria 3245
266 Ga0307407_10031588 3300031903 Bacteria 2869
267 Ga0307407_10177924 3300031903 Bacteria 1407
268 Ga0307407_10237872 3300031903 Bacteria 1241
269 Ga0307407_10371555 3300031903 Bacteria 1018
270 Ga0307407_10648754 3300031903 Bacteria 790
271 Ga0307412_10011502 3300031911 Bacteria 5130
272 Ga0307412_10332272 3300031911 Bacteria 1213
273 Ga0307412_10604262 3300031911 Bacteria 929
274 Ga0307409_100055014 3300031995 Bacteria 3069
275 Ga0307409_100084641 3300031995 Bacteria 2575
276 Ga0307409_100114719 3300031995 Bacteria 2267
277 Ga0307409_100119031 3300031995 Bacteria 2232
278 Ga0307409_100242568 3300031995 Bacteria 1641
279 Ga0307409_100247947 3300031995 Bacteria 1626
280 Ga0307409_100257295 3300031995 Bacteria 1600
281 Ga0307409_100376664 3300031995 Bacteria 1348
282 Ga0307409_100491431 3300031995 Bacteria 1193
283 Ga0307409_100681268 3300031995 Bacteria 1025
284 Ga0307416_100000539 3300032002 Bacteria 19259
285 Ga0307416_100017224 3300032002 Bacteria 5047
286 Ga0307416_100063313 3300032002 Bacteria 3028
287 Ga0307416_100129481 3300032002 Bacteria 2268
288 Ga0307416_100190282 3300032002 Bacteria 1934
289 Ga0307416_100309542 3300032002 Bacteria 1575
290 Ga0307416_100527014 3300032002 Bacteria 1251
291 Ga0307416_100787784 3300032002 Bacteria 1046
292 Ga0307414_10008273 3300032004 Bacteria 5887
293 Ga0307414_10044522 3300032004 Bacteria 3032
294 Ga0307414_10086675 3300032004 Bacteria 2311
295 Ga0307414_10132438 3300032004 Bacteria 1938
296 Ga0307414_10133464 3300032004 Bacteria 1931
297 Ga0307414_10172779 3300032004 Bacteria 1729
298 Ga0307414_10441854 3300032004 Bacteria 1139
299 Ga0307414_10603550 3300032004 Bacteria 984
300 Ga0307414_10819773 3300032004 Bacteria 849
301 Ga0307414_11006920 3300032004 Bacteria 767
302 Ga0307411_10001485 3300032005 Bacteria 9629
303 Ga0307411_10016320 3300032005 Bacteria 4201
304 Ga0307411_10022792 3300032005 Bacteria 3695
305 Ga0307411_10024990 3300032005 Bacteria 3570
306 Ga0307411_10078434 3300032005 Bacteria 2264
307 Ga0307411_10078772 3300032005 Bacteria 2260
308 Ga0307411_10081938 3300032005 Bacteria 2223
309 Ga0307411_10177883 3300032005 Bacteria 1611
310 Ga0307411_10210435 3300032005 Bacteria 1501
311 Ga0307411_10254498 3300032005 Bacteria 1383
312 Ga0307411_10409679 3300032005 Bacteria 1123
313 Ga0307411_10556436 3300032005 Bacteria 979
314 Ga0307415_100002134 3300032126 Bacteria 9793
315 Ga0307415_100004398 3300032126 Bacteria 7305
316 Ga0307415_100592754 3300032126 Bacteria 985
317 Ga0307415_100667398 3300032126 Bacteria 934
318 Ga0307415_100829656 3300032126 Bacteria 846
319 Ga0395899_0000261 3300037312 Bacteria 69173
320 Ga0395899_0076935 3300037312 Bacteria 2435
321 Ga0395900_0000036 3300037418 Bacteria 250619
322 Ga0395900_0209720 3300037418 Bacteria 1967
323 Ga0395900_0219020 3300037418 Bacteria 1919
324 Ga0395900_0226091 3300037418 Bacteria 1884
325 Ga0395900_0391298 3300037418 Bacteria 1356
326 Ga0395900_0403208 3300037418 Bacteria 1331
327 Ga0395900_1005754 3300037418 Bacteria 753
328 Ga0395900_1234343 3300037418 Bacteria 662
329 Ga0395898_0011477 3300037466 Bacteria 9200
330 Ga0395898_0019437 3300037466 Bacteria 6913
331 Ga0395898_0034613 3300037466 Bacteria 5031
332 Ga0395905_0005921 3300037471 Bacteria 12397
333 Ga0395905_0126776 3300037471 Bacteria 2400
334 Ga0395905_0192208 3300037471 Bacteria 1914
335 Ga0395905_0341987 3300037471 Bacteria 1387
336 Ga0395905_0492088 3300037471 Bacteria 1126
337 Ga0395905_0685225 3300037471 Bacteria 927
338 Ga0395901_0000036 3300038443 Bacteria 214274
339 Ga0395901_0000520 3300038443 Bacteria 44464
340 Ga0395901_0131771 3300038443 Bacteria 2627
341 Ga0395901_0147704 3300038443 Bacteria 2470
342 Ga0395901_0263855 3300038443 Bacteria 1792
343 Ga0395901_0304595 3300038443 Bacteria 1651
344 Ga0395901_0410459 3300038443 Bacteria 1390
345 Ga0436365_0102423 3300039437 Bacteria 73123
346 Ga0436365_0594973 3300039437 Bacteria 21936
347 Ga0436363_1031549 3300039450 Bacteria 1348
348 Ga0436362_0740394 3300039453 Bacteria 73123
349 Ga0439432_004989 3300042006 Bacteria 4801
350 Ga0439432_017279 3300042006 Bacteria 2422
351 Ga0450889_000413 3300042144 Bacteria 4763
352 Ga0439434_0076003 3300042435 Bacteria 1062
353 Ga0466967_0161008 3300045976 Bacteria 2106
354 Ga0495663_0209392 3300046525 Bacteria 683
355 Ga0495598_0050584 3300046537 Bacteria 1249
356 Ga0495621_0001509 3300046539 Bacteria 6042
357 Ga0495621_0001791 3300046539 Bacteria 5644
358 Ga0495621_0030509 3300046539 Bacteria 1844
359 Ga0495621_0061812 3300046539 Bacteria 1361
360 Ga0495668_0217414 3300046616 Bacteria 1046
361 Ga0495659_0271326 3300046664 Bacteria 711
362 Ga0495669_0000565 3300046684 Bacteria 16363
363 Ga0495669_0012148 3300046684 Bacteria 3662
364 Ga0495669_0081769 3300046684 Bacteria 1483
365 Ga0495669_0227185 3300046684 Bacteria 895
366 Ga0495670_0010393 3300046691 Bacteria 4572
367 Ga0495670_0044355 3300046691 Bacteria 2220
368 Ga0495670_0210939 3300046691 Bacteria 1030
369 Ga0495636_0100592 3300047318 Bacteria 1264
370 Ga0495636_0158773 3300047318 Bacteria 1018
371 Ga0496104_0050695 3300048907 Bacteria 3917
372 Ga0496107_0358850 3300048910 Bacteria 1084
373 Ga0496108_0152811 3300048911 Bacteria 1992
374 Ga0496108_0868599 3300048911 Unclassified 775
375 Ga0496110_0008393 3300048913 Bacteria 8311
376 Ga0496111_0001738 3300048914 Bacteria 12752
377 Ga0496111_0004544 3300048914 Bacteria 8784
378 Ga0496112_0056638 3300048915 Bacteria 3858
379 Ga0496112_0312876 3300048915 Bacteria 1515
380 Ga0496114_0000019 3300048917 Bacteria 244365
381 Ga0501293_002241 3300049516 Bacteria 1467
382 Ga0501294_000601 3300049517 Bacteria 4099
383 Ga0501300_000728 3300049523 Bacteria 4945
384 Ga0501317_031032 3300049533 Bacteria 775
385 Ga0501334_04548 3300049550 Bacteria 893
386 Ga0501034_0192687 3300049571 Bacteria 2000
387 Ga0501034_0669445 3300049571 Bacteria 938
388 Ga0501046_0089752 3300049580 Bacteria 2365
389 Ga0501047_0139800 3300049581 Bacteria 2300
390 Ga0501202_005942 3300049652 Bacteria 2172
391 Ga0501206_001498 3300049653 Bacteria 2909
392 Ga0501216_042109 3300049660 Bacteria 876
393 Ga0501224_004354 3300049664 Bacteria 2012
394 Ga0501227_003821 3300049665 Bacteria 3253
395 Ga0501233_010360 3300049668 Bacteria 1835
396 Ga0501233_019738 3300049668 Bacteria 1431
397 Ga0501235_002954 3300049669 Bacteria 3661
398 Ga0501235_004653 3300049669 Bacteria 2967
399 Ga0501249_006924 3300049679 Bacteria 2336
400 Ga0501259_000899 3300049688 Bacteria 4903
401 Ga0501261_000173 3300049690 Bacteria 9199
402 Ga0501225_0001766 3300049705 Bacteria 6767
403 Ga0501225_0093031 3300049705 Bacteria 875
404 Ga0501234_023908 3300049707 Bacteria 979
405 Ga0501245_002991 3300049708 Bacteria 2281
406 Ga0501279_000022 3300049775 Bacteria 54370
407 Ga0501280_000035 3300049776 Bacteria 40433
408 Ga0501281_00157 3300049777 Bacteria 7948
409 Ga0501282_002640 3300049778 Bacteria 1942
410 Ga0501283_002892 3300049779 Bacteria 2251
411 Ga0501044_0133406 3300049823 Bacteria 2476
412 Ga0500556_0147766 3300053104 Bacteria 925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0192687 Ga0501034_0192687_49_660 185
2 3300039450 Ga0436363_1031549 Ga0436363_1031549_698_1300 192
3 iso_pu_bacteria 2643221541 2643730839 192
4 iso_pu_bacteria 2643221606 2644044508 192
5 iso_pu_bacteria 2643221671 2644391567 192
6 3300032002 Ga0307416_100527014 Ga0307416_1005270141 194
7 3300021358 Ga0213873_10000027 Ga0213873_1000002743 195
8 3300021384 Ga0213876_10000004 Ga0213876_10000004358 195
9 3300039437 Ga0436365_0102423 Ga0436365_0102423_31658_32266 195
10 3300039453 Ga0436362_0740394 Ga0436362_0740394_31658_32266 195
11 3300005340 Ga0070689_100487395 Ga0070689_1004873952 196
12 3300005617 Ga0068859_100158186 Ga0068859_1001581862 196
13 3300006931 Ga0097620_100158190 Ga0097620_1001581902 196
14 3300009551 Ga0105238_10376350 Ga0105238_103763502 196
15 3300032002 Ga0307416_100309542 Ga0307416_1003095421 196
16 3300049571 Ga0501034_0669445 Ga0501034_0669445_158_784 196
17 3300049580 Ga0501046_0089752 Ga0501046_0089752_299_925 196
18 3300049581 Ga0501047_0139800 Ga0501047_0139800_1487_2113 196
19 3300049823 Ga0501044_0133406 Ga0501044_0133406_457_1083 196
20 3300025972 Ga0207668_10075722 Ga0207668_100757223 197
21 3300046691 Ga0495670_0210939 Ga0495670_0210939_265_888 197
22 3300046525 Ga0495663_0209392 Ga0495663_0209392_28_633 198
23 3300005985 Ga0081539_10026054 Ga0081539_100260542 199
24 iso_pu_bacteria 2885427238 2885428369 199
25 3300031995 Ga0307409_100491431 Ga0307409_1004914311 201
26 3300005293 Ga0065715_10118965 Ga0065715_101189653 202
27 3300005331 Ga0070670_100455817 Ga0070670_1004558172 202
28 3300005617 Ga0068859_100017860 Ga0068859_1000178605 202
29 3300005719 Ga0068861_100000175 Ga0068861_1000001753 202
30 3300006931 Ga0097620_100017863 Ga0097620_1000178635 202
31 3300009094 Ga0111539_10295458 Ga0111539_102954582 202
32 3300009177 Ga0105248_10015490 Ga0105248_100154905 202
33 3300014968 Ga0157379_10199522 Ga0157379_101995222 202
34 3300025941 Ga0207711_10005404 Ga0207711_100054049 202
35 3300026118 Ga0207675_100000049 Ga0207675_10000004940 202
36 3300027614 Ga0209970_1029217 Ga0209970_10292172 202
37 3300027682 Ga0209971_1011541 Ga0209971_10115412 202
38 3300030745 Ga0316182_1142144 Ga0316182_11421442 202
39 3300031548 Ga0307408_100284952 Ga0307408_1002849521 202
40 3300031731 Ga0307405_10061517 Ga0307405_100615173 202
41 3300031824 Ga0307413_10021873 Ga0307413_100218732 202
42 3300031852 Ga0307410_10140968 Ga0307410_101409682 202
43 3300031903 Ga0307407_10023000 Ga0307407_100230004 202
44 3300031903 Ga0307407_10237872 Ga0307407_102378722 202
45 3300031911 Ga0307412_10332272 Ga0307412_103322722 202
46 3300031995 Ga0307409_100055014 Ga0307409_1000550144 202
47 3300032002 Ga0307416_100063313 Ga0307416_1000633133 202
48 3300032005 Ga0307411_10024990 Ga0307411_100249902 202
49 3300032126 Ga0307415_100667398 Ga0307415_1006673982 202
50 3300039437 Ga0436365_0594973 Ga0436365_0594973_4523_5155 202
51 3300042006 Ga0439432_017279 Ga0439432_017279_1445_2062 202
52 3300049516 Ga0501293_002241 Ga0501293_002241_37_678 202
53 3300049517 Ga0501294_000601 Ga0501294_000601_1974_2615 202
54 3300049523 Ga0501300_000728 Ga0501300_000728_2269_2910 202
55 3300049533 Ga0501317_031032 Ga0501317_031032_19_660 202
56 3300049550 Ga0501334_04548 Ga0501334_04548_192_833 202
57 3300049652 Ga0501202_005942 Ga0501202_005942_949_1590 202
58 3300049653 Ga0501206_001498 Ga0501206_001498_2022_2663 202
59 3300049665 Ga0501227_003821 Ga0501227_003821_1906_2547 202
60 3300049668 Ga0501233_019738 Ga0501233_019738_166_807 202
61 3300049669 Ga0501235_002954 Ga0501235_002954_1994_2635 202
62 3300049688 Ga0501259_000899 Ga0501259_000899_2120_2761 202
63 3300049690 Ga0501261_000173 Ga0501261_000173_4187_4828 202
64 3300049705 Ga0501225_0001766 Ga0501225_0001766_879_1520 202
65 3300049708 Ga0501245_002991 Ga0501245_002991_343_984 202
66 3300049775 Ga0501279_000022 Ga0501279_000022_28020_28661 202
67 3300049776 Ga0501280_000035 Ga0501280_000035_16963_17604 202
68 3300049777 Ga0501281_00157 Ga0501281_00157_5248_5889 202
69 3300049778 Ga0501282_002640 Ga0501282_002640_651_1292 202
70 3300049779 Ga0501283_002892 Ga0501283_002892_964_1605 202
71 3300053104 Ga0500556_0147766 Ga0500556_0147766_101_736 202
72 3300005290 Ga0065712_10176602 Ga0065712_101766022 203
73 3300005293 Ga0065715_10096871 Ga0065715_100968713 203
74 3300005295 Ga0065707_10453515 Ga0065707_104535151 203
75 3300005438 Ga0070701_10649046 Ga0070701_106490461 203
76 3300014326 Ga0157380_10303844 Ga0157380_103038441 203
77 3300005290 Ga0065712_10084506 Ga0065712_100845062 204
78 3300005293 Ga0065715_10091763 Ga0065715_100917636 204
79 3300005293 Ga0065715_10092828 Ga0065715_100928282 204
80 3300005293 Ga0065715_10324678 Ga0065715_103246781 204
81 3300005327 Ga0070658_10091592 Ga0070658_100915922 204
82 3300005327 Ga0070658_10450866 Ga0070658_104508662 204
83 3300005327 Ga0070658_10606940 Ga0070658_106069401 204
84 3300005328 Ga0070676_10022149 Ga0070676_100221493 204
85 3300005328 Ga0070676_10023262 Ga0070676_100232622 204
86 3300005328 Ga0070676_10183645 Ga0070676_101836452 204
87 3300005329 Ga0070683_100037375 Ga0070683_1000373754 204
88 3300005329 Ga0070683_100950859 Ga0070683_1009508591 204
89 3300005330 Ga0070690_100010452 Ga0070690_1000104525 204
90 3300005331 Ga0070670_100006155 Ga0070670_10000615511 204
91 3300005333 Ga0070677_10012981 Ga0070677_100129813 204
92 3300005334 Ga0068869_100289637 Ga0068869_1002896371 204
93 3300005335 Ga0070666_10000784 Ga0070666_100007846 204
94 3300005336 Ga0070680_100030875 Ga0070680_1000308752 204
95 3300005338 Ga0068868_100002185 Ga0068868_10000218513 204
96 3300005339 Ga0070660_100000378 Ga0070660_1000003789 204
97 3300005339 Ga0070660_100031954 Ga0070660_1000319543 204
98 3300005339 Ga0070660_100047116 Ga0070660_1000471162 204
99 3300005339 Ga0070660_100214587 Ga0070660_1002145872 204
100 3300005339 Ga0070660_100530740 Ga0070660_1005307402 204
101 3300005340 Ga0070689_100439803 Ga0070689_1004398032 204
102 3300005343 Ga0070687_100048174 Ga0070687_1000481742 204
103 3300005344 Ga0070661_100318216 Ga0070661_1003182162 204
104 3300005344 Ga0070661_100466104 Ga0070661_1004661042 204
105 3300005344 Ga0070661_100534249 Ga0070661_1005342491 204
106 3300005345 Ga0070692_10038321 Ga0070692_100383213 204
107 3300005347 Ga0070668_100011377 Ga0070668_1000113773 204
108 3300005353 Ga0070669_100002456 Ga0070669_1000024563 204
109 3300005353 Ga0070669_100025109 Ga0070669_1000251092 204
110 3300005354 Ga0070675_100008845 Ga0070675_1000088457 204
111 3300005354 Ga0070675_100133866 Ga0070675_1001338662 204
112 3300005354 Ga0070675_100717356 Ga0070675_1007173561 204
113 3300005355 Ga0070671_100002317 Ga0070671_1000023178 204
114 3300005355 Ga0070671_100004451 Ga0070671_1000044519 204
115 3300005355 Ga0070671_100014767 Ga0070671_1000147677 204
116 3300005355 Ga0070671_100049518 Ga0070671_1000495182 204
117 3300005356 Ga0070674_100039908 Ga0070674_1000399083 204
118 3300005356 Ga0070674_100298245 Ga0070674_1002982452 204
119 3300005364 Ga0070673_100042870 Ga0070673_1000428702 204
120 3300005364 Ga0070673_100060706 Ga0070673_1000607062 204
121 3300005364 Ga0070673_100373716 Ga0070673_1003737162 204
122 3300005364 Ga0070673_100431387 Ga0070673_1004313872 204
123 3300005364 Ga0070673_100447425 Ga0070673_1004474252 204
124 3300005365 Ga0070688_100456781 Ga0070688_1004567811 204
125 3300005366 Ga0070659_100029716 Ga0070659_1000297162 204
126 3300005366 Ga0070659_100083949 Ga0070659_1000839492 204
127 3300005366 Ga0070659_100167779 Ga0070659_1001677792 204
128 3300005366 Ga0070659_100252790 Ga0070659_1002527902 204
129 3300005366 Ga0070659_100255435 Ga0070659_1002554352 204
130 3300005367 Ga0070667_100000764 Ga0070667_10000076417 204
131 3300005367 Ga0070667_100007799 Ga0070667_1000077997 204
132 3300005367 Ga0070667_100398932 Ga0070667_1003989321 204
133 3300005435 Ga0070714_100056771 Ga0070714_1000567713 204
134 3300005438 Ga0070701_10176601 Ga0070701_101766011 204
135 3300005440 Ga0070705_100403222 Ga0070705_1004032222 204
136 3300005455 Ga0070663_100043380 Ga0070663_1000433803 204
137 3300005456 Ga0070678_100042720 Ga0070678_1000427202 204
138 3300005457 Ga0070662_100002737 Ga0070662_10000273711 204
139 3300005457 Ga0070662_100019234 Ga0070662_1000192342 204
140 3300005457 Ga0070662_100162232 Ga0070662_1001622321 204
141 3300005457 Ga0070662_100780286 Ga0070662_1007802861 204
142 3300005458 Ga0070681_10025117 Ga0070681_100251175 204
143 3300005458 Ga0070681_10435759 Ga0070681_104357592 204
144 3300005459 Ga0068867_100028267 Ga0068867_1000282672 204
145 3300005530 Ga0070679_100015243 Ga0070679_1000152433 204
146 3300005530 Ga0070679_100507056 Ga0070679_1005070561 204
147 3300005543 Ga0070672_100006190 Ga0070672_1000061902 204
148 3300005543 Ga0070672_100039976 Ga0070672_1000399762 204
149 3300005543 Ga0070672_100085152 Ga0070672_1000851523 204
150 3300005546 Ga0070696_100257168 Ga0070696_1002571682 204
151 3300005548 Ga0070665_100355686 Ga0070665_1003556862 204
152 3300005563 Ga0068855_100000480 Ga0068855_10000048024 204
153 3300005564 Ga0070664_100043149 Ga0070664_1000431495 204
154 3300005564 Ga0070664_100318865 Ga0070664_1003188652 204
155 3300005614 Ga0068856_100080752 Ga0068856_1000807523 204
156 3300005614 Ga0068856_100339590 Ga0068856_1003395902 204
157 3300005616 Ga0068852_100099196 Ga0068852_1000991963 204
158 3300005617 Ga0068859_100161391 Ga0068859_1001613912 204
159 3300005618 Ga0068864_100000894 Ga0068864_10000089424 204
160 3300005618 Ga0068864_100065708 Ga0068864_1000657084 204
161 3300005618 Ga0068864_100194547 Ga0068864_1001945472 204
162 3300005719 Ga0068861_100158261 Ga0068861_1001582612 204
163 3300005834 Ga0068851_10010411 Ga0068851_100104114 204
164 3300005841 Ga0068863_100399104 Ga0068863_1003991042 204
165 3300005842 Ga0068858_100000640 Ga0068858_1000006403 204
166 3300005843 Ga0068860_101005135 Ga0068860_1010051352 204
167 3300005844 Ga0068862_100007623 Ga0068862_1000076238 204
168 3300005844 Ga0068862_100563795 Ga0068862_1005637952 204
169 3300006177 Ga0075362_10040243 Ga0075362_100402433 204
170 3300006881 Ga0068865_100081903 Ga0068865_1000819032 204
171 3300006931 Ga0097620_100161393 Ga0097620_1001613932 204
172 3300009094 Ga0111539_10168479 Ga0111539_101684792 204
173 3300009098 Ga0105245_10486500 Ga0105245_104865002 204
174 3300009148 Ga0105243_10123290 Ga0105243_101232903 204
175 3300009177 Ga0105248_10002046 Ga0105248_1000204613 204
176 3300009177 Ga0105248_10002343 Ga0105248_1000234311 204
177 3300009177 Ga0105248_10176280 Ga0105248_101762803 204
178 3300009553 Ga0105249_10076331 Ga0105249_100763313 204
179 3300009553 Ga0105249_11301900 Ga0105249_113019001 204
180 3300013100 Ga0157373_10033456 Ga0157373_100334564 204
181 3300013100 Ga0157373_10132063 Ga0157373_101320633 204
182 3300013100 Ga0157373_10185534 Ga0157373_101855342 204
183 3300013100 Ga0157373_10227522 Ga0157373_102275222 204
184 3300013100 Ga0157373_10321433 Ga0157373_103214332 204
185 3300013102 Ga0157371_10030723 Ga0157371_100307235 204
186 3300013102 Ga0157371_10100232 Ga0157371_101002322 204
187 3300013102 Ga0157371_10315238 Ga0157371_103152382 204
188 3300013104 Ga0157370_10181923 Ga0157370_101819233 204
189 3300013104 Ga0157370_10331291 Ga0157370_103312912 204
190 3300013105 Ga0157369_10070336 Ga0157369_100703363 204
191 3300013296 Ga0157374_10216125 Ga0157374_102161252 204
192 3300013297 Ga0157378_10810233 Ga0157378_108102332 204
193 3300013306 Ga0163162_10036415 Ga0163162_100364156 204
194 3300013308 Ga0157375_11231913 Ga0157375_112319132 204
195 3300014326 Ga0157380_10002596 Ga0157380_1000259611 204
196 3300014326 Ga0157380_10005862 Ga0157380_100058624 204
197 3300014326 Ga0157380_10008816 Ga0157380_100088163 204
198 3300014326 Ga0157380_10106592 Ga0157380_101065922 204
199 3300014326 Ga0157380_10203668 Ga0157380_102036682 204
200 3300014326 Ga0157380_10271903 Ga0157380_102719032 204
201 3300014326 Ga0157380_10454245 Ga0157380_104542452 204
202 3300014745 Ga0157377_10147241 Ga0157377_101472412 204
203 3300014968 Ga0157379_10428330 Ga0157379_104283302 204
204 3300017792 Ga0163161_10176785 Ga0163161_101767851 204
205 3300025315 Ga0207697_10004971 Ga0207697_100049713 204
206 3300025893 Ga0207682_10003569 Ga0207682_100035693 204
207 3300025893 Ga0207682_10121662 Ga0207682_101216621 204
208 3300025893 Ga0207682_10123582 Ga0207682_101235822 204
209 3300025901 Ga0207688_10028597 Ga0207688_100285974 204
210 3300025903 Ga0207680_10004489 Ga0207680_100044892 204
211 3300025904 Ga0207647_10144169 Ga0207647_101441692 204
212 3300025904 Ga0207647_10155673 Ga0207647_101556732 204
213 3300025907 Ga0207645_10007557 Ga0207645_100075578 204
214 3300025907 Ga0207645_10024046 Ga0207645_100240465 204
215 3300025907 Ga0207645_10080887 Ga0207645_100808872 204
216 3300025909 Ga0207705_10000131 Ga0207705_1000013178 204
217 3300025909 Ga0207705_10040845 Ga0207705_100408452 204
218 3300025909 Ga0207705_10060901 Ga0207705_100609012 204
219 3300025909 Ga0207705_10144434 Ga0207705_101444342 204
220 3300025909 Ga0207705_10243508 Ga0207705_102435082 204
221 3300025912 Ga0207707_10026676 Ga0207707_100266764 204
222 3300025917 Ga0207660_10012930 Ga0207660_100129302 204
223 3300025917 Ga0207660_10017556 Ga0207660_100175563 204
224 3300025917 Ga0207660_10139263 Ga0207660_101392632 204
225 3300025918 Ga0207662_10125364 Ga0207662_101253642 204
226 3300025919 Ga0207657_10001988 Ga0207657_1000198828 204
227 3300025919 Ga0207657_10005362 Ga0207657_100053627 204
228 3300025919 Ga0207657_10148417 Ga0207657_101484172 204
229 3300025919 Ga0207657_10450379 Ga0207657_104503792 204
230 3300025920 Ga0207649_10142944 Ga0207649_101429441 204
231 3300025920 Ga0207649_10296490 Ga0207649_102964902 204
232 3300025921 Ga0207652_10007449 Ga0207652_100074499 204
233 3300025923 Ga0207681_10001934 Ga0207681_1000193411 204
234 3300025923 Ga0207681_10007817 Ga0207681_100078173 204
235 3300025923 Ga0207681_10045690 Ga0207681_100456902 204
236 3300025923 Ga0207681_10224644 Ga0207681_102246442 204
237 3300025923 Ga0207681_10415537 Ga0207681_104155372 204
238 3300025925 Ga0207650_10004848 Ga0207650_1000484811 204
239 3300025925 Ga0207650_10116013 Ga0207650_101160132 204
240 3300025926 Ga0207659_10001721 Ga0207659_1000172112 204
241 3300025926 Ga0207659_10324977 Ga0207659_103249772 204
242 3300025927 Ga0207687_10362367 Ga0207687_103623672 204
243 3300025929 Ga0207664_10510744 Ga0207664_105107442 204
244 3300025931 Ga0207644_10003063 Ga0207644_100030639 204
245 3300025931 Ga0207644_10027443 Ga0207644_100274433 204
246 3300025931 Ga0207644_10574438 Ga0207644_105744381 204
247 3300025932 Ga0207690_10052000 Ga0207690_100520003 204
248 3300025932 Ga0207690_10143624 Ga0207690_101436242 204
249 3300025932 Ga0207690_10324315 Ga0207690_103243152 204
250 3300025932 Ga0207690_10326359 Ga0207690_103263592 204
251 3300025932 Ga0207690_10342785 Ga0207690_103427852 204
252 3300025932 Ga0207690_10428609 Ga0207690_104286092 204
253 3300025933 Ga0207706_10000187 Ga0207706_1000018761 204
254 3300025933 Ga0207706_10003204 Ga0207706_100032049 204
255 3300025933 Ga0207706_10415131 Ga0207706_104151312 204
256 3300025935 Ga0207709_10075248 Ga0207709_100752483 204
257 3300025936 Ga0207670_10354436 Ga0207670_103544362 204
258 3300025937 Ga0207669_10024247 Ga0207669_100242473 204
259 3300025938 Ga0207704_10047457 Ga0207704_100474573 204
260 3300025940 Ga0207691_10046477 Ga0207691_100464774 204
261 3300025940 Ga0207691_10232747 Ga0207691_102327472 204
262 3300025940 Ga0207691_10274334 Ga0207691_102743342 204
263 3300025941 Ga0207711_10000174 Ga0207711_1000017417 204
264 3300025944 Ga0207661_10034157 Ga0207661_100341572 204
265 3300025944 Ga0207661_11024429 Ga0207661_110244291 204
266 3300025945 Ga0207679_10012419 Ga0207679_100124193 204
267 3300025945 Ga0207679_10374368 Ga0207679_103743682 204
268 3300025949 Ga0207667_10000586 Ga0207667_1000058641 204
269 3300025949 Ga0207667_10302421 Ga0207667_103024212 204
270 3300025960 Ga0207651_10077470 Ga0207651_100774701 204
271 3300025960 Ga0207651_10336456 Ga0207651_103364562 204
272 3300025961 Ga0207712_10039206 Ga0207712_100392063 204
273 3300025972 Ga0207668_10004109 Ga0207668_100041097 204
274 3300025972 Ga0207668_10024258 Ga0207668_100242582 204
275 3300025981 Ga0207640_10063592 Ga0207640_100635922 204
276 3300025986 Ga0207658_10006584 Ga0207658_100065844 204
277 3300026023 Ga0207677_10006421 Ga0207677_100064212 204
278 3300026035 Ga0207703_10001865 Ga0207703_1000186517 204
279 3300026067 Ga0207678_10006377 Ga0207678_100063775 204
280 3300026067 Ga0207678_10022045 Ga0207678_100220456 204
281 3300026078 Ga0207702_10274347 Ga0207702_102743472 204
282 3300026088 Ga0207641_10383877 Ga0207641_103838772 204
283 3300026089 Ga0207648_10068054 Ga0207648_100680542 204
284 3300026089 Ga0207648_10327250 Ga0207648_103272502 204
285 3300026095 Ga0207676_10121962 Ga0207676_101219623 204
286 3300026095 Ga0207676_10125701 Ga0207676_101257013 204
287 3300026118 Ga0207675_100006920 Ga0207675_10000692017 204
288 3300026118 Ga0207675_100208497 Ga0207675_1002084972 204
289 3300026121 Ga0207683_10037057 Ga0207683_100370574 204
290 3300026142 Ga0207698_10085354 Ga0207698_100853542 204
291 3300028380 Ga0268265_10008756 Ga0268265_100087565 204
292 3300028380 Ga0268265_10377458 Ga0268265_103774582 204
293 3300028380 Ga0268265_10611184 Ga0268265_106111842 204
294 3300028380 Ga0268265_11419799 Ga0268265_114197991 204
295 3300031548 Ga0307408_100183833 Ga0307408_1001838332 204
296 3300031731 Ga0307405_10054997 Ga0307405_100549972 204
297 3300031731 Ga0307405_10168990 Ga0307405_101689902 204
298 3300031824 Ga0307413_10035729 Ga0307413_100357293 204
299 3300031824 Ga0307413_10097916 Ga0307413_100979162 204
300 3300031824 Ga0307413_10713573 Ga0307413_107135732 204
301 3300031852 Ga0307410_10005881 Ga0307410_100058815 204
302 3300031852 Ga0307410_10009767 Ga0307410_100097672 204
303 3300031852 Ga0307410_10028474 Ga0307410_100284744 204
304 3300031852 Ga0307410_10275135 Ga0307410_102751352 204
305 3300031852 Ga0307410_10417765 Ga0307410_104177652 204
306 3300031852 Ga0307410_10539663 Ga0307410_105396632 204
307 3300031901 Ga0307406_10276977 Ga0307406_102769771 204
308 3300031901 Ga0307406_10283667 Ga0307406_102836671 204
309 3300031901 Ga0307406_10501489 Ga0307406_105014892 204
310 3300031903 Ga0307407_10015599 Ga0307407_100155992 204
311 3300031903 Ga0307407_10031588 Ga0307407_100315882 204
312 3300031903 Ga0307407_10177924 Ga0307407_101779242 204
313 3300031903 Ga0307407_10371555 Ga0307407_103715552 204
314 3300031903 Ga0307407_10648754 Ga0307407_106487541 204
315 3300031911 Ga0307412_10011502 Ga0307412_100115023 204
316 3300031911 Ga0307412_10604262 Ga0307412_106042621 204
317 3300031995 Ga0307409_100084641 Ga0307409_1000846412 204
318 3300031995 Ga0307409_100114719 Ga0307409_1001147193 204
319 3300031995 Ga0307409_100119031 Ga0307409_1001190313 204
320 3300031995 Ga0307409_100242568 Ga0307409_1002425682 204
321 3300031995 Ga0307409_100247947 Ga0307409_1002479472 204
322 3300031995 Ga0307409_100257295 Ga0307409_1002572952 204
323 3300031995 Ga0307409_100376664 Ga0307409_1003766642 204
324 3300031995 Ga0307409_100681268 Ga0307409_1006812682 204
325 3300032002 Ga0307416_100000539 Ga0307416_1000005395 204
326 3300032002 Ga0307416_100017224 Ga0307416_1000172243 204
327 3300032002 Ga0307416_100129481 Ga0307416_1001294812 204
328 3300032002 Ga0307416_100190282 Ga0307416_1001902822 204
329 3300032002 Ga0307416_100787784 Ga0307416_1007877842 204
330 3300032004 Ga0307414_10008273 Ga0307414_100082736 204
331 3300032004 Ga0307414_10044522 Ga0307414_100445223 204
332 3300032004 Ga0307414_10086675 Ga0307414_100866752 204
333 3300032004 Ga0307414_10132438 Ga0307414_101324382 204
334 3300032004 Ga0307414_10133464 Ga0307414_101334642 204
335 3300032004 Ga0307414_10172779 Ga0307414_101727792 204
336 3300032004 Ga0307414_10441854 Ga0307414_104418542 204
337 3300032004 Ga0307414_10603550 Ga0307414_106035502 204
338 3300032004 Ga0307414_10819773 Ga0307414_108197732 204
339 3300032004 Ga0307414_11006920 Ga0307414_110069202 204
340 3300032005 Ga0307411_10001485 Ga0307411_1000148512 204
341 3300032005 Ga0307411_10016320 Ga0307411_100163203 204
342 3300032005 Ga0307411_10022792 Ga0307411_100227924 204
343 3300032005 Ga0307411_10078434 Ga0307411_100784342 204
344 3300032005 Ga0307411_10078772 Ga0307411_100787722 204
345 3300032005 Ga0307411_10081938 Ga0307411_100819383 204
346 3300032005 Ga0307411_10177883 Ga0307411_101778832 204
347 3300032005 Ga0307411_10210435 Ga0307411_102104352 204
348 3300032005 Ga0307411_10254498 Ga0307411_102544982 204
349 3300032005 Ga0307411_10409679 Ga0307411_104096792 204
350 3300032005 Ga0307411_10556436 Ga0307411_105564362 204
351 3300032126 Ga0307415_100002134 Ga0307415_10000213411 204
352 3300032126 Ga0307415_100004398 Ga0307415_1000043982 204
353 3300032126 Ga0307415_100592754 Ga0307415_1005927542 204
354 3300032126 Ga0307415_100829656 Ga0307415_1008296562 204
355 3300037312 Ga0395899_0000261 Ga0395899_0000261_55536_56150 204
356 3300037312 Ga0395899_0076935 Ga0395899_0076935_1324_1947 204
357 3300037418 Ga0395900_0000036 Ga0395900_0000036_84275_84889 204
358 3300037418 Ga0395900_0209720 Ga0395900_0209720_1109_1723 204
359 3300037418 Ga0395900_0219020 Ga0395900_0219020_998_1612 204
360 3300037418 Ga0395900_0226091 Ga0395900_0226091_175_789 204
361 3300037418 Ga0395900_0391298 Ga0395900_0391298_325_939 204
362 3300037418 Ga0395900_0403208 Ga0395900_0403208_235_849 204
363 3300037418 Ga0395900_1005754 Ga0395900_1005754_59_673 204
364 3300037418 Ga0395900_1234343 Ga0395900_1234343_23_637 204
365 3300037466 Ga0395898_0011477 Ga0395898_0011477_2698_3312 204
366 3300037466 Ga0395898_0019437 Ga0395898_0019437_1055_1669 204
367 3300037466 Ga0395898_0034613 Ga0395898_0034613_2690_3304 204
368 3300037471 Ga0395905_0005921 Ga0395905_0005921_2259_2882 204
369 3300037471 Ga0395905_0126776 Ga0395905_0126776_589_1203 204
370 3300037471 Ga0395905_0192208 Ga0395905_0192208_798_1412 204
371 3300037471 Ga0395905_0341987 Ga0395905_0341987_471_1085 204
372 3300037471 Ga0395905_0492088 Ga0395905_0492088_392_1006 204
373 3300037471 Ga0395905_0685225 Ga0395905_0685225_123_908 204
374 3300038443 Ga0395901_0000036 Ga0395901_0000036_135009_135623 204
375 3300038443 Ga0395901_0000520 Ga0395901_0000520_23557_24180 204
376 3300038443 Ga0395901_0131771 Ga0395901_0131771_801_1415 204
377 3300038443 Ga0395901_0147704 Ga0395901_0147704_1101_1715 204
378 3300038443 Ga0395901_0263855 Ga0395901_0263855_946_1560 204
379 3300038443 Ga0395901_0304595 Ga0395901_0304595_428_1042 204
380 3300038443 Ga0395901_0410459 Ga0395901_0410459_648_1262 204
381 3300042006 Ga0439432_004989 Ga0439432_004989_2557_3171 204
382 3300042144 Ga0450889_000413 Ga0450889_000413_2907_3527 204
383 3300042435 Ga0439434_0076003 Ga0439434_0076003_148_762 204
384 3300045976 Ga0466967_0161008 Ga0466967_0161008_242_856 204
385 3300046537 Ga0495598_0050584 Ga0495598_0050584_330_953 204
386 3300046539 Ga0495621_0001509 Ga0495621_0001509_5059_5679 204
387 3300046539 Ga0495621_0001791 Ga0495621_0001791_368_991 204
388 3300046539 Ga0495621_0030509 Ga0495621_0030509_1082_1705 204
389 3300046539 Ga0495621_0061812 Ga0495621_0061812_316_936 204
390 3300046616 Ga0495668_0217414 Ga0495668_0217414_299_925 204
391 3300046664 Ga0495659_0271326 Ga0495659_0271326_31_654 204
392 3300046684 Ga0495669_0000565 Ga0495669_0000565_3934_4548 204
393 3300046684 Ga0495669_0012148 Ga0495669_0012148_2287_2910 204
394 3300046684 Ga0495669_0081769 Ga0495669_0081769_348_968 204
395 3300046684 Ga0495669_0227185 Ga0495669_0227185_240_854 204
396 3300046691 Ga0495670_0010393 Ga0495670_0010393_1297_1917 204
397 3300046691 Ga0495670_0044355 Ga0495670_0044355_766_1386 204
398 3300047318 Ga0495636_0100592 Ga0495636_0100592_307_930 204
399 3300047318 Ga0495636_0158773 Ga0495636_0158773_207_827 204
400 3300048907 Ga0496104_0050695 Ga0496104_0050695_739_1353 204
401 3300048910 Ga0496107_0358850 Ga0496107_0358850_224_838 204
402 3300048911 Ga0496108_0152811 Ga0496108_0152811_884_1498 204
403 3300048911 Ga0496108_0868599 Ga0496108_0868599_68_682 204
404 3300048913 Ga0496110_0008393 Ga0496110_0008393_5588_6202 204
405 3300048914 Ga0496111_0001738 Ga0496111_0001738_10150_10764 204
406 3300048914 Ga0496111_0004544 Ga0496111_0004544_1387_2001 204
407 3300048915 Ga0496112_0056638 Ga0496112_0056638_2807_3421 204
408 3300048915 Ga0496112_0312876 Ga0496112_0312876_80_694 204
409 3300048917 Ga0496114_0000019 Ga0496114_0000019_218337_218951 204
410 3300049660 Ga0501216_042109 Ga0501216_042109_203_829 204
411 3300049664 Ga0501224_004354 Ga0501224_004354_1098_1724 204
412 3300049668 Ga0501233_010360 Ga0501233_010360_292_918 204
413 3300049669 Ga0501235_004653 Ga0501235_004653_912_1538 204
414 3300049679 Ga0501249_006924 Ga0501249_006924_1111_1737 204
415 3300049705 Ga0501225_0093031 Ga0501225_0093031_203_829 204
416 3300049707 Ga0501234_023908 Ga0501234_023908_203_829 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04279

IspA

Intracellular septation protein A

48

227

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.6531 11 87
6z3m-assembly3.cif.gz_O repulsive guidance molecule b (rgmb) in complex with growth differentiation factor 5 (gdf5) and neogenin 1 (neo1). 0.64 15 85
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.6158 11 87
2w2u-assembly1.cif.gz_A structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.5921 11 87
4zey-assembly1.cif.gz_A crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution 0.5903 19 93
ID Description Score Start End Superfamily
af_P0A710_1_176_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8622 12 189 1.20.120.550
af_P0A710_1_176_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8401 12 189 1.20.120.550
1x91A00 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6539 17 85 1.20.140.40
2v6yA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6531 11 87 1.20.58.80
af_Q53P90_38_155_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6229 11 85 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A2D6QC87-F1-model_v4 Septation protein A 0.9874 90 189 GO:0005886
AF-A0A529QKA6-F1-model_v4 Septation protein A 0.9585 95 193 GO:0005886
AF-A0A2D6QC87-F1-model_v4 Septation protein A 0.9316 90 189 GO:0005886
AF-A0A5C7WB11-F1-model_v4 Intracellular septation protein A 0.9134 12 188 GO:0005886
AF-A0A3C1NE79-F1-model_v4 Septation protein A 0.9113 90 200 GO:0005886

Feature Viewer

pLDDT pTM Quality
80.81 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map