F438767

General Info

Members Datasets Scaffolds Average Seq Length
416 234 414 301

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100157088|Ga0075428_1001570884
Length 318
Sequence VRGVIVHSAQTKVLQASIDPLMPIRLAENFRTVFYAPFYAAQVLELYGKEGVEIEFVTSSVPGDGASSLLNDTVDLTWGGPMRVMKARDLQQSSPLVCFCEVVARDPFFLVGRHHRSEFQLRDLGSLRFAAVSEVPTPWMCLQNDLREQGIDPSGVARAPDQSMAANLDALCNGQLDVVQLFEPYASMALQLAAGDILYASSTRGPTVYTTFLATRSGIERHRDAFVAMTRAIARMQDWFSQHGAEELADITAPFYPDIPRTILVSSLHRYGQSGIWARAPNVSREGFRRLGECLVSGGFISRMPIYEDCVDQSLSTA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.24
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.68
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10152071 3300005293 Bacteria 1718
2 Ga0070683_100080356 3300005329 Bacteria 3052
3 Ga0070690_100009045 3300005330 Bacteria 5760
4 Ga0070670_100180122 3300005331 Bacteria 1835
5 Ga0068869_100013889 3300005334 Bacteria 5369
6 Ga0070666_10031074 3300005335 Bacteria 3524
7 Ga0070682_100010044 3300005337 Bacteria 5364
8 Ga0070689_100099187 3300005340 Bacteria 2304
9 Ga0070689_100118355 3300005340 Bacteria 2114
10 Ga0070691_10004553 3300005341 Bacteria 6295
11 Ga0070691_10031778 3300005341 Unclassified 2477
12 Ga0070687_100001679 3300005343 Bacteria 7935
13 Ga0070692_10016000 3300005345 Bacteria 3560
14 Ga0070669_100110326 3300005353 Bacteria 2087
15 Ga0070674_100095699 3300005356 Unclassified 2153
16 Ga0070673_100305041 3300005364 Bacteria 1403
17 Ga0070673_100348335 3300005364 Bacteria 1314
18 Ga0070688_100070453 3300005365 Bacteria 2236
19 Ga0070659_100180740 3300005366 Bacteria 1731
20 Ga0070667_100334593 3300005367 Bacteria 1368
21 Ga0070709_10016933 3300005434 Bacteria 4171
22 Ga0070714_100140661 3300005435 Bacteria 2166
23 Ga0070714_100229434 3300005435 Unclassified 1710
24 Ga0070714_100348043 3300005435 Bacteria 1391
25 Ga0070713_100032713 3300005436 Bacteria 4157
26 Ga0070713_100103245 3300005436 Bacteria 2473
27 Ga0070710_10016614 3300005437 Bacteria 3749
28 Ga0070701_10006105 3300005438 Bacteria 5043
29 Ga0070711_100255884 3300005439 Unclassified 1375
30 Ga0070700_100008924 3300005441 Bacteria 5483
31 Ga0070700_100047137 3300005441 Unclassified 2666
32 Ga0070694_100036612 3300005444 Bacteria 3251
33 Ga0070694_100039707 3300005444 Bacteria 3135
34 Ga0070708_100139227 3300005445 Bacteria 2250
35 Ga0070708_100495507 3300005445 Bacteria 1152
36 Ga0070681_10001358 3300005458 Bacteria 21392
37 Ga0070681_10120329 3300005458 Bacteria 2561
38 Ga0068867_100014068 3300005459 Bacteria 5668
39 Ga0070706_100100265 3300005467 Bacteria 2690
40 Ga0070698_100475024 3300005471 Unclassified 1187
41 Ga0070699_100013745 3300005518 Bacteria 6964
42 Ga0070699_100186196 3300005518 Bacteria 1843
43 Ga0070679_100017954 3300005530 Bacteria 6854
44 Ga0070679_100192470 3300005530 Unclassified 2008
45 Ga0070684_100009449 3300005535 Bacteria 7680
46 Ga0070697_100101379 3300005536 Bacteria 2392
47 Ga0068853_100322635 3300005539 Bacteria 1432
48 Ga0068853_100399563 3300005539 Bacteria 1286
49 Ga0070686_100005375 3300005544 Bacteria 7085
50 Ga0070695_100033723 3300005545 Unclassified 3204
51 Ga0070695_100047575 3300005545 Bacteria 2740
52 Ga0070695_100220213 3300005545 Bacteria 1367
53 Ga0070696_100008631 3300005546 Bacteria 6815
54 Ga0070693_100004600 3300005547 Bacteria 6547
55 Ga0070665_100393729 3300005548 Bacteria 1393
56 Ga0070704_100000083 3300005549 Bacteria 32513
57 Ga0070704_100379294 3300005549 Bacteria 1201
58 Ga0068855_100126444 3300005563 Bacteria 2922
59 Ga0070664_100111415 3300005564 Bacteria 2389
60 Ga0068857_100181242 3300005577 Unclassified 1917
61 Ga0068856_100057266 3300005614 Bacteria 3848
62 Ga0070702_100024923 3300005615 Bacteria 3198
63 Ga0068852_100032341 3300005616 Bacteria 4331
64 Ga0068859_100021981 3300005617 Bacteria 6397
65 Ga0068859_100065375 3300005617 Bacteria 3671
66 Ga0068864_100134935 3300005618 Bacteria 2221
67 Ga0068861_100027715 3300005719 Bacteria 4130
68 Ga0068863_100401812 3300005841 Unclassified 1340
69 Ga0068858_100158391 3300005842 Bacteria 2131
70 Ga0068858_100272801 3300005842 Bacteria 1610
71 Ga0068862_100025801 3300005844 Bacteria 4935
72 Ga0081455_10000058 3300005937 Bacteria 119171
73 Ga0081455_10008303 3300005937 Bacteria 10820
74 Ga0081455_10011527 3300005937 Bacteria 8874
75 Ga0081455_10040566 3300005937 Bacteria 4103
76 Ga0081455_10066176 3300005937 Bacteria 3019
77 Ga0081538_10060867 3300005981 Bacteria 2167
78 Ga0081538_10061972 3300005981 Bacteria 2137
79 Ga0081540_1000026 3300005983 Bacteria 155402
80 Ga0081540_1006217 3300005983 Bacteria 8753
81 Ga0081540_1039466 3300005983 Bacteria 2475
82 Ga0081539_10008045 3300005985 Bacteria 9340
83 Ga0081539_10016600 3300005985 Bacteria 5240
84 Ga0081539_10033748 3300005985 Bacteria 3109
85 Ga0081539_10052989 3300005985 Unclassified 2274
86 Ga0070717_10024502 3300006028 Bacteria 4792
87 Ga0070717_10225037 3300006028 Bacteria 1650
88 Ga0070717_10296903 3300006028 Bacteria 1436
89 Ga0070717_10440931 3300006028 Bacteria 1173
90 Ga0070715_10092535 3300006163 Bacteria 1394
91 Ga0070712_100002935 3300006175 Bacteria 10567
92 Ga0070712_100293458 3300006175 Unclassified 1314
93 Ga0068871_100013049 3300006358 Bacteria 6159
94 Ga0075428_100002118 3300006844 Bacteria 21416
95 Ga0075428_100019085 3300006844 Bacteria 7582
96 Ga0075428_100063608 3300006844 Bacteria 4040
97 Ga0075428_100113415 3300006844 Bacteria 2953
98 Ga0075428_100157088 3300006844 Unclassified 2470
99 Ga0075428_100298642 3300006844 Bacteria 1732
100 Ga0075428_100344134 3300006844 Bacteria 1601
101 Ga0075430_100023739 3300006846 Bacteria 5223
102 Ga0075430_100103336 3300006846 Bacteria 2379
103 Ga0075431_100037688 3300006847 Bacteria 4979
104 Ga0075431_100077718 3300006847 Bacteria 3425
105 Ga0075431_100089087 3300006847 Bacteria 3185
106 Ga0075431_100142105 3300006847 Bacteria 2474
107 Ga0075431_100419111 3300006847 Bacteria 1338
108 Ga0075433_10009625 3300006852 Bacteria 7734
109 Ga0075433_10175214 3300006852 Bacteria 1909
110 Ga0075433_10404347 3300006852 Unclassified 1204
111 Ga0075434_100001060 3300006871 Bacteria 22455
112 Ga0075434_100001207 3300006871 Bacteria 21477
113 Ga0075434_100064138 3300006871 Bacteria 3657
114 Ga0075434_100087254 3300006871 Bacteria 3121
115 Ga0075434_100187309 3300006871 Bacteria 2090
116 Ga0075434_100417597 3300006871 Bacteria 1363
117 Ga0075429_100068703 3300006880 Bacteria 3084
118 Ga0075429_100186624 3300006880 Bacteria 1817
119 Ga0075436_100009750 3300006914 Bacteria 6571
120 Ga0097620_100021981 3300006931 Bacteria 6397
121 Ga0097620_100065384 3300006931 Bacteria 3671
122 Ga0075435_100314193 3300007076 Bacteria 1341
123 Ga0075435_100376860 3300007076 Bacteria 1219
124 Ga0099794_10019814 3300007265 Bacteria 3037
125 Ga0099794_10040210 3300007265 Bacteria 2222
126 Ga0099795_10008852 3300007788 Bacteria 2895
127 Ga0111539_10025745 3300009094 Bacteria 7206
128 Ga0111539_10029841 3300009094 Bacteria 6635
129 Ga0111539_10057462 3300009094 Bacteria 4620
130 Ga0111539_10074451 3300009094 Bacteria 4001
131 Ga0111539_10500889 3300009094 Bacteria 1415
132 Ga0105245_10013750 3300009098 Bacteria 7049
133 Ga0105245_10099392 3300009098 Bacteria 2690
134 Ga0105247_10016083 3300009101 Bacteria 4482
135 Ga0114129_10008197 3300009147 Bacteria 14894
136 Ga0114129_10062179 3300009147 Bacteria 5217
137 Ga0114129_10087577 3300009147 Bacteria 4318
138 Ga0114129_10093262 3300009147 Bacteria 4171
139 Ga0114129_10158156 3300009147 Bacteria 3097
140 Ga0114129_10290714 3300009147 Bacteria 2181
141 Ga0114129_10339369 3300009147 Bacteria 1993
142 Ga0105243_10014681 3300009148 Bacteria 5926
143 Ga0105243_10131927 3300009148 Bacteria 2120
144 Ga0105243_10289011 3300009148 Bacteria 1480
145 Ga0105248_10029884 3300009177 Bacteria 6081
146 Ga0105249_10054421 3300009553 Bacteria 3660
147 Ga0105246_10083864 3300011119 Bacteria 2278
148 Ga0157369_10463801 3300013105 Bacteria 1311
149 Ga0157378_10012229 3300013297 Bacteria 7515
150 Ga0163162_10047001 3300013306 Bacteria 4326
151 Ga0157372_10200194 3300013307 Bacteria 2313
152 Ga0163163_10259857 3300014325 Bacteria 1787
153 Ga0157380_10018721 3300014326 Bacteria 5147
154 Ga0157376_10013488 3300014969 Bacteria 6098
155 Ga0163161_10097179 3300017792 Bacteria 2187
156 Ga0163161_10243216 3300017792 Bacteria 1400
157 Ga0213876_10063229 3300021384 Bacteria 1954
158 Ga0213875_10000058 3300021388 Bacteria 135597
159 Ga0228598_1022384 3300024227 Bacteria 1243
160 Ga0207710_10006463 3300025900 Bacteria 5004
161 Ga0207685_10126898 3300025905 Unclassified 1127
162 Ga0207699_10030657 3300025906 Bacteria 3012
163 Ga0207684_10056264 3300025910 Bacteria 3336
164 Ga0207684_10099540 3300025910 Bacteria 2483
165 Ga0207654_10037481 3300025911 Bacteria 2714
166 Ga0207707_10012222 3300025912 Bacteria 7464
167 Ga0207693_10004490 3300025915 Bacteria 11805
168 Ga0207663_10021837 3300025916 Bacteria 3650
169 Ga0207662_10002519 3300025918 Bacteria 9222
170 Ga0207662_10055346 3300025918 Bacteria 2367
171 Ga0207662_10164204 3300025918 Bacteria 1421
172 Ga0207646_10216834 3300025922 Bacteria 1728
173 Ga0207681_10122963 3300025923 Bacteria 1906
174 Ga0207650_10406163 3300025925 Bacteria 1128
175 Ga0207687_10043494 3300025927 Bacteria 3095
176 Ga0207687_10045141 3300025927 Bacteria 3045
177 Ga0207700_10032411 3300025928 Bacteria 3727
178 Ga0207664_10129636 3300025929 Bacteria 2122
179 Ga0207706_10150930 3300025933 Bacteria 2043
180 Ga0207709_10010547 3300025935 Bacteria 5088
181 Ga0207709_10126199 3300025935 Bacteria 1736
182 Ga0207670_10192455 3300025936 Bacteria 1544
183 Ga0207669_10216837 3300025937 Unclassified 1401
184 Ga0207669_10284853 3300025937 Bacteria 1248
185 Ga0207704_10005406 3300025938 Bacteria 5889
186 Ga0207665_10002785 3300025939 Bacteria 11719
187 Ga0207665_10084567 3300025939 Bacteria 2189
188 Ga0207689_10000229 3300025942 Bacteria 49945
189 Ga0207689_10033984 3300025942 Bacteria 4235
190 Ga0207661_10096779 3300025944 Bacteria 2470
191 Ga0207651_10355937 3300025960 Bacteria 1234
192 Ga0207712_10075486 3300025961 Bacteria 2437
193 Ga0207640_10270792 3300025981 Unclassified 1328
194 Ga0207703_10123235 3300026035 Bacteria 2228
195 Ga0207708_10007282 3300026075 Bacteria 8181
196 Ga0207708_10152255 3300026075 Unclassified 1822
197 Ga0207708_10290953 3300026075 Bacteria 1326
198 Ga0207702_10085161 3300026078 Bacteria 2753
199 Ga0207648_10010575 3300026089 Bacteria 8731
200 Ga0207676_10221132 3300026095 Bacteria 1686
201 Ga0207674_10100693 3300026116 Bacteria 2871
202 Ga0207675_100001175 3300026118 Bacteria 26068
203 Ga0207698_10036103 3300026142 Bacteria 3624
204 Ga0209179_1019956 3300027512 Bacteria 1296
205 Ga0209588_1014839 3300027671 Bacteria 2391
206 Ga0207428_10003770 3300027907 Bacteria 14553
207 Ga0207428_10034405 3300027907 Bacteria 4152
208 Ga0207428_10118674 3300027907 Bacteria 2030
209 Ga0265357_1000899 3300028023 Unclassified 1998
210 Ga0268265_10028934 3300028380 Bacteria 3972
211 Ga0265760_10009600 3300031090 Unclassified 2764
212 Ga0265339_10023357 3300031249 Bacteria 3575
213 Ga0307513_10068021 3300031456 Bacteria 3733
214 Ga0265314_10004888 3300031711 Bacteria 12255
215 Ga0265342_10019911 3300031712 Bacteria 4316
216 Ga0373958_0023195 3300034819 Bacteria 1166
217 Ga0373926_0070050 3300035083 Unclassified 1287
218 Ga0373940_0009719 3300035088 Bacteria 2243
219 Ga0373940_0026647 3300035088 Bacteria 1514
220 Ga0373940_0039934 3300035088 Bacteria 1286
221 Ga0373944_0000630 3300035089 Bacteria 8374
222 Ga0373944_0001575 3300035089 Bacteria 5770
223 Ga0373949_0010339 3300035090 Bacteria 2045
224 Ga0373923_0034662 3300035111 Bacteria 2050
225 Ga0373923_0078837 3300035111 Bacteria 1426
226 Ga0373936_0000675 3300035113 Bacteria 11854
227 Ga0373936_0004502 3300035113 Bacteria 5274
228 Ga0373936_0020102 3300035113 Bacteria 2591
229 Ga0373941_0008745 3300035115 Bacteria 2527
230 Ga0373945_0000817 3300035116 Bacteria 9128
231 Ga0373945_0003644 3300035116 Bacteria 4855
232 Ga0373953_0000790 3300035117 Bacteria 8815
233 Ga0373954_0030902 3300035118 Bacteria 2471
234 Ga0373956_0053092 3300035119 Bacteria 1824
235 Ga0373957_0008394 3300035120 Unclassified 3343
236 Ga0373957_0019833 3300035120 Bacteria 2370
237 Ga0373960_0020243 3300035121 Bacteria 1757
238 Ga0373943_0001014 3300035170 Bacteria 12480
239 Ga0373943_0004189 3300035170 Bacteria 6540
240 Ga0373943_0006883 3300035170 Bacteria 5099
241 Ga0373946_0002868 3300035171 Bacteria 6109
242 Ga0373946_0006416 3300035171 Bacteria 4265
243 Ga0373955_0007789 3300035172 Unclassified 4937
244 Ga0373961_0018132 3300035241 Unclassified 1835
245 Ga0373961_0039362 3300035241 Bacteria 1358
246 Ga0373924_0006143 3300035410 Bacteria 4290
247 Ga0373931_0000327 3300035691 Bacteria 19905
248 Ga0373931_0009828 3300035691 Bacteria 4582
249 Ga0373931_0035127 3300035691 Bacteria 2605
250 Ga0373931_0053723 3300035691 Bacteria 2150
251 Ga0373935_0000454 3300035692 Bacteria 21220
252 Ga0373935_0009642 3300035692 Bacteria 5779
253 Ga0373935_0030716 3300035692 Bacteria 3330
254 Ga0373927_0001264 3300035695 Bacteria 19155
255 Ga0373927_0002492 3300035695 Bacteria 13439
256 Ga0373927_0019670 3300035695 Bacteria 4427
257 Ga0373927_0168374 3300035695 Bacteria 1436
258 Ga0373927_0235768 3300035695 Bacteria 1202
259 Ga0373933_0002060 3300035724 Bacteria 11550
260 Ga0373933_0010844 3300035724 Bacteria 5001
261 Ga0373933_0378423 3300035724 Unclassified 922
262 Ga0373947_0003394 3300035725 Bacteria 9420
263 Ga0373947_0005085 3300035725 Bacteria 7706
264 Ga0373947_0037522 3300035725 Bacteria 2876
265 Ga0373947_0041120 3300035725 Bacteria 2756
266 Ga0373937_0000089 3300036401 Bacteria 84564
267 Ga0373937_0008865 3300036401 Bacteria 8731
268 Ga0373937_0311220 3300036401 Bacteria 1490
269 Ga0373925_0000016 3300037068 Bacteria 176830
270 Ga0373925_0003827 3300037068 Bacteria 11545
271 Ga0436364_0440289 3300037853 Bacteria 49939
272 Ga0436365_0049485 3300039437 Bacteria 1888
273 Ga0436365_1642579 3300039437 Bacteria 2543
274 Ga0436365_1705817 3300039437 Bacteria 1517
275 Ga0436361_0550596 3300039447 Bacteria 14713
276 Ga0466964_0106882 3300044706 Unclassified 1242
277 Ga0466967_0402635 3300045976 Bacteria 1332
278 Ga0495592_0001282 3300046454 Bacteria 17428
279 Ga0495592_0040253 3300046454 Bacteria 3508
280 Ga0495629_0009971 3300046459 Bacteria 6932
281 Ga0495629_0247038 3300046459 Bacteria 1228
282 Ga0495638_0001652 3300046460 Bacteria 19749
283 Ga0495638_0026503 3300046460 Bacteria 3756
284 Ga0495641_0024281 3300046461 Bacteria 2995
285 Ga0495651_0002468 3300046462 Bacteria 14299
286 Ga0495651_0028257 3300046462 Bacteria 4372
287 Ga0495651_0109194 3300046462 Bacteria 2048
288 Ga0495653_0000022 3300046463 Bacteria 169653
289 Ga0495653_0021161 3300046463 Bacteria 5270
290 Ga0495653_0085631 3300046463 Unclassified 2318
291 Ga0495580_0001099 3300046472 Bacteria 23728
292 Ga0495580_0026132 3300046472 Bacteria 4259
293 Ga0495582_0028989 3300046473 Bacteria 3039
294 Ga0495582_0053855 3300046473 Bacteria 2219
295 Ga0495639_0013346 3300046475 Bacteria 3546
296 Ga0495639_0042193 3300046475 Bacteria 2056
297 Ga0495662_0000552 3300046476 Bacteria 17176
298 Ga0495662_0016763 3300046476 Bacteria 3548
299 Ga0495664_0000013 3300046477 Bacteria 204282
300 Ga0495664_0009788 3300046477 Bacteria 5374
301 Ga0495585_0086276 3300046492 Bacteria 1696
302 Ga0495608_0000004 3300046511 Bacteria 355027
303 Ga0495608_0006443 3300046511 Bacteria 8335
304 Ga0495618_0000032 3300046514 Bacteria 104874
305 Ga0495618_0016827 3300046514 Bacteria 4478
306 Ga0495628_0000014 3300046516 Bacteria 205818
307 Ga0495630_0024919 3300046517 Bacteria 4422
308 Ga0495630_0046573 3300046517 Bacteria 3241
309 Ga0495666_0020260 3300046526 Bacteria 3297
310 Ga0495652_0000002 3300046529 Bacteria 946606
311 Ga0495652_0069759 3300046529 Bacteria 2941
312 Ga0495652_0175288 3300046529 Unclassified 1651
313 Ga0495640_0000001 3300046533 Bacteria 853827
314 Ga0495640_0012840 3300046533 Bacteria 6390
315 Ga0495640_0014368 3300046533 Bacteria 5996
316 Ga0495640_0062874 3300046533 Unclassified 2516
317 Ga0495640_0105612 3300046533 Bacteria 1845
318 Ga0495586_0018101 3300046535 Bacteria 3747
319 Ga0495587_0000004 3300046536 Bacteria 358433
320 Ga0495587_0121395 3300046536 Bacteria 1497
321 Ga0495645_0000001 3300046543 Bacteria 657910
322 Ga0495645_0021741 3300046543 Bacteria 4637
323 Ga0495667_0000009 3300046559 Bacteria 223329
324 Ga0495656_0040053 3300046615 Bacteria 1951
325 Ga0495634_0000033 3300046642 Bacteria 109811
326 Ga0495634_0014186 3300046642 Bacteria 5748
327 Ga0495634_0062707 3300046642 Bacteria 2468
328 Ga0495635_0000003 3300046663 Bacteria 390055
329 Ga0495635_0009284 3300046663 Bacteria 6871
330 Ga0495657_0000112 3300046675 Bacteria 72999
331 Ga0495657_0005797 3300046675 Bacteria 9729
332 Ga0495657_0231421 3300046675 Unclassified 1118
333 Ga0495623_0000026 3300046679 Bacteria 90660
334 Ga0495646_0000005 3300046680 Bacteria 266899
335 Ga0495646_0063135 3300046680 Bacteria 2200
336 Ga0495647_0000277 3300046681 Bacteria 14241
337 Ga0495658_0001128 3300046683 Bacteria 14124
338 Ga0495658_0074790 3300046683 Bacteria 1975
339 Ga0495613_0090412 3300046689 Bacteria 2217
340 Ga0495613_0137661 3300046689 Bacteria 1746
341 Ga0495624_0022863 3300046690 Bacteria 4127
342 Ga0495600_0000003 3300046809 Bacteria 180457
343 Ga0495600_0034149 3300046809 Unclassified 3302
344 Ga0495604_0000002 3300047317 Bacteria 530904
345 Ga0495636_0094094 3300047318 Unclassified 1304
346 Ga0495674_0000004 3300047319 Bacteria 531855
347 Ga0495674_0019244 3300047319 Bacteria 6340
348 Ga0495674_0038580 3300047319 Bacteria 4287
349 Ga0495674_0290325 3300047319 Bacteria 1338
350 Ga0495676_0020012 3300047321 Bacteria 5879
351 Ga0495676_0151058 3300047321 Bacteria 1653
352 Ga0495680_0000129 3300047322 Bacteria 74623
353 Ga0495680_0094765 3300047322 Unclassified 2233
354 Ga0495675_0000268 3300047444 Bacteria 37760
355 Ga0495675_0051153 3300047444 Plasmid 2625
356 Ga0495684_0000019 3300047471 Bacteria 153938
357 Ga0495684_0004282 3300047471 Bacteria 11136
358 Ga0495593_0000137 3300047673 Bacteria 35364
359 Ga0495593_0014297 3300047673 Bacteria 4514
360 Ga0495593_0019517 3300047673 Bacteria 3800
361 Ga0495602_0000001 3300048088 Bacteria 510904
362 Ga0495602_0099023 3300048088 Bacteria 2398
363 Ga0495614_0073199 3300048089 Unclassified 1479
364 Ga0496100_0153914 3300048903 Unclassified 1643
365 Ga0496100_0258327 3300048903 Unclassified 1291
366 Ga0496106_0178537 3300048909 Bacteria 1685
367 Ga0496110_0031695 3300048913 Bacteria 4562
368 Ga0496111_0143500 3300048914 Unclassified 1770
369 Ga0496114_0122836 3300048917 Unclassified 2235
370 Ga0496114_0150084 3300048917 Bacteria 2022
371 Ga0496126_0001329 3300048929 Bacteria 39310
372 Ga0496126_0146288 3300048929 Bacteria 2029
373 Ga0501291_016157 3300049514 Unclassified 1137
374 Ga0501033_0206570 3300049570 Bacteria 1402
375 Ga0501073_0137732 3300049589 Bacteria 1692
376 Ga0501044_0164065 3300049823 Bacteria 2197
377 nmdc:mga05p37_250761_c1 3300050507 Bacteria 2123
378 nmdc:mga05p37_261452_c1 3300050507 Unclassified 2071
379 nmdc:mga05p37_304403_c1 3300050507 Unclassified 1892
380 nmdc:mga05p37_332436_c1 3300050507 Bacteria 1794
381 nmdc:mga05p37_6008_c2 3300050507 Bacteria 12783
382 nmdc:mga05p37_68339_c1 3300050507 Bacteria 4369
383 nmdc:mga09592_16961_c1 3300050508 Bacteria 5959
384 nmdc:mga09592_232503_c1 3300050508 Bacteria 1597
385 nmdc:mga0qj67_368041_c1 3300050509 Bacteria 1161
386 nmdc:mga06r32_584905_c1 3300050510 Unclassified 1088
387 nmdc:mga06r32_68546_c1 3300050510 Bacteria 3427
388 nmdc:mga06r32_796633_c1 3300050510 Unclassified 906
389 nmdc:mga08y16_102001_c1 3300050511 Bacteria 2987
390 nmdc:mga08y16_151882_c1 3300050511 Bacteria 2407
391 nmdc:mga08y16_358353_c1 3300050511 Bacteria 1497
392 nmdc:mga08y16_910160_c1 3300050511 Bacteria 865
393 nmdc:mga0n895_109960_c1 3300050512 Bacteria 2771
394 nmdc:mga0n895_436_c1 3300050512 Bacteria 28097
395 nmdc:mga0n895_50479_c1 3300050512 Bacteria 4078
396 nmdc:mga0n895_60292_c1 3300050512 Bacteria 3744
397 nmdc:mga0n895_646_c1 3300050512 Bacteria 24309
398 nmdc:mga0rr50_96397_c1 3300050513 Bacteria 2314
399 nmdc:mga08x19_204859_c1 3300050514 Bacteria 1353
400 nmdc:mga0a205_188810_c1 3300050515 Bacteria 1953
401 nmdc:mga0a205_2530_c1 3300050515 Bacteria 16111
402 nmdc:mga0a205_340833_c1 3300050515 Bacteria 1367
403 Ga0495601_0000002 3300053077 Bacteria 528704
404 Ga0495601_0008815 3300053077 Bacteria 5954
405 Ga0495601_0011258 3300053077 Bacteria 5345
406 Ga0495601_0060414 3300053077 Unclassified 2405
407 Ga0495612_0000012 3300053078 Bacteria 223883
408 Ga0495612_0004107 3300053078 Bacteria 6033
409 Ga0495595_0000012 3300053084 Bacteria 174322
410 Ga0495595_0005633 3300053084 Bacteria 5066
411 Ga0495619_0000003 3300053085 Bacteria 515784
412 Ga0495619_0029319 3300053085 Unclassified 3554
413 Ga0495619_0054718 3300053085 Bacteria 2642
414 Ga0495619_0107698 3300053085 Unclassified 1901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_910160_c1 nmdc:mga08y16_910160_c1_109_855 238
2 3300050515 nmdc:mga0a205_340833_c1 nmdc:mga0a205_340833_c1_50_796 238
3 3300050510 nmdc:mga06r32_796633_c1 nmdc:mga06r32_796633_c1_53_892 262
4 3300046511 Ga0495608_0006443 Ga0495608_0006443_4375_5199 274
5 3300025905 Ga0207685_10126898 Ga0207685_101268982 278
6 3300031090 Ga0265760_10009600 Ga0265760_100096002 278
7 3300035695 Ga0373927_0168374 Ga0373927_0168374_146_1033 281
8 3300047319 Ga0495674_0290325 Ga0495674_0290325_95_982 281
9 3300048903 Ga0496100_0153914 Ga0496100_0153914_211_1098 281
10 3300035724 Ga0373933_0378423 Ga0373933_0378423_33_899 282
11 3300046533 Ga0495640_0062874 Ga0495640_0062874_12_866 284
12 3300039437 Ga0436365_1642579 Ga0436365_1642579_711_1598 285
13 3300013306 Ga0163162_10047001 Ga0163162_100470014 287
14 3300048917 Ga0496114_0150084 Ga0496114_0150084_591_1457 288
15 3300046533 Ga0495640_0105612 Ga0495640_0105612_325_1212 289
16 iso_pu_bacteria 8055225921 8055227822 289
17 3300005341 Ga0070691_10031778 Ga0070691_100317782 291
18 3300005441 Ga0070700_100047137 Ga0070700_1000471374 291
19 3300005444 Ga0070694_100039707 Ga0070694_1000397073 291
20 3300005458 Ga0070681_10001358 Ga0070681_1000135814 291
21 3300005545 Ga0070695_100033723 Ga0070695_1000337232 291
22 3300026075 Ga0207708_10152255 Ga0207708_101522552 291
23 3300035088 Ga0373940_0039934 Ga0373940_0039934_214_1140 291
24 3300035121 Ga0373960_0020243 Ga0373960_0020243_693_1619 291
25 3300035241 Ga0373961_0039362 Ga0373961_0039362_186_1112 291
26 3300035691 Ga0373931_0000327 Ga0373931_0000327_11804_12730 291
27 3300005445 Ga0070708_100139227 Ga0070708_1001392272 292
28 3300005458 Ga0070681_10120329 Ga0070681_101203292 292
29 3300005530 Ga0070679_100192470 Ga0070679_1001924702 292
30 3300005536 Ga0070697_100101379 Ga0070697_1001013792 292
31 3300005985 Ga0081539_10052989 Ga0081539_100529892 292
32 3300025912 Ga0207707_10012222 Ga0207707_100122222 292
33 3300049514 Ga0501291_016157 Ga0501291_016157_54_971 292
34 3300005330 Ga0070690_100009045 Ga0070690_1000090453 293
35 3300005334 Ga0068869_100013889 Ga0068869_1000138893 293
36 3300005335 Ga0070666_10031074 Ga0070666_100310742 293
37 3300005337 Ga0070682_100010044 Ga0070682_1000100445 293
38 3300005340 Ga0070689_100099187 Ga0070689_1000991872 293
39 3300005341 Ga0070691_10004553 Ga0070691_100045533 293
40 3300005343 Ga0070687_100001679 Ga0070687_1000016793 293
41 3300005345 Ga0070692_10016000 Ga0070692_100160003 293
42 3300005364 Ga0070673_100348335 Ga0070673_1003483351 293
43 3300005438 Ga0070701_10006105 Ga0070701_100061055 293
44 3300005441 Ga0070700_100008924 Ga0070700_1000089245 293
45 3300005444 Ga0070694_100036612 Ga0070694_1000366123 293
46 3300005459 Ga0068867_100014068 Ga0068867_1000140684 293
47 3300005471 Ga0070698_100475024 Ga0070698_1004750241 293
48 3300005530 Ga0070679_100017954 Ga0070679_1000179543 293
49 3300005544 Ga0070686_100005375 Ga0070686_1000053754 293
50 3300005545 Ga0070695_100047575 Ga0070695_1000475753 293
51 3300005546 Ga0070696_100008631 Ga0070696_1000086315 293
52 3300005547 Ga0070693_100004600 Ga0070693_1000046002 293
53 3300005549 Ga0070704_100000083 Ga0070704_1000000835 293
54 3300005563 Ga0068855_100126444 Ga0068855_1001264442 293
55 3300005614 Ga0068856_100057266 Ga0068856_1000572663 293
56 3300005615 Ga0070702_100024923 Ga0070702_1000249232 293
57 3300005617 Ga0068859_100021981 Ga0068859_1000219812 293
58 3300005719 Ga0068861_100027715 Ga0068861_1000277153 293
59 3300005842 Ga0068858_100158391 Ga0068858_1001583911 293
60 3300005844 Ga0068862_100025801 Ga0068862_1000258015 293
61 3300005985 Ga0081539_10016600 Ga0081539_100166004 293
62 3300006358 Ga0068871_100013049 Ga0068871_1000130493 293
63 3300006871 Ga0075434_100417597 Ga0075434_1004175972 293
64 3300006931 Ga0097620_100021981 Ga0097620_1000219812 293
65 3300009098 Ga0105245_10013750 Ga0105245_100137505 293
66 3300009148 Ga0105243_10014681 Ga0105243_100146812 293
67 3300009553 Ga0105249_10054421 Ga0105249_100544213 293
68 3300013297 Ga0157378_10012229 Ga0157378_100122295 293
69 3300014326 Ga0157380_10018721 Ga0157380_100187212 293
70 3300014969 Ga0157376_10013488 Ga0157376_100134883 293
71 3300017792 Ga0163161_10243216 Ga0163161_102432162 293
72 3300021384 Ga0213876_10063229 Ga0213876_100632292 293
73 3300025911 Ga0207654_10037481 Ga0207654_100374812 293
74 3300025918 Ga0207662_10002519 Ga0207662_100025197 293
75 3300025927 Ga0207687_10045141 Ga0207687_100451413 293
76 3300025935 Ga0207709_10010547 Ga0207709_100105475 293
77 3300025936 Ga0207670_10192455 Ga0207670_101924551 293
78 3300025938 Ga0207704_10005406 Ga0207704_100054063 293
79 3300025942 Ga0207689_10000229 Ga0207689_1000022945 293
80 3300025961 Ga0207712_10075486 Ga0207712_100754863 293
81 3300025981 Ga0207640_10270792 Ga0207640_102707922 293
82 3300026075 Ga0207708_10007282 Ga0207708_100072824 293
83 3300026078 Ga0207702_10085161 Ga0207702_100851612 293
84 3300026089 Ga0207648_10010575 Ga0207648_100105757 293
85 3300026118 Ga0207675_100001175 Ga0207675_1000011757 293
86 3300027512 Ga0209179_1019956 Ga0209179_10199561 293
87 3300028380 Ga0268265_10028934 Ga0268265_100289343 293
88 3300031249 Ga0265339_10023357 Ga0265339_100233572 293
89 3300031711 Ga0265314_10004888 Ga0265314_100048888 293
90 3300031712 Ga0265342_10019911 Ga0265342_100199113 293
91 3300034819 Ga0373958_0023195 Ga0373958_0023195_144_1046 293
92 3300035088 Ga0373940_0026647 Ga0373940_0026647_213_1115 293
93 3300035089 Ga0373944_0000630 Ga0373944_0000630_2451_3353 293
94 3300035111 Ga0373923_0078837 Ga0373923_0078837_34_936 293
95 3300035113 Ga0373936_0000675 Ga0373936_0000675_7004_7906 293
96 3300035113 Ga0373936_0020102 Ga0373936_0020102_1527_2486 293
97 3300035116 Ga0373945_0000817 Ga0373945_0000817_2915_3817 293
98 3300035117 Ga0373953_0000790 Ga0373953_0000790_3406_4365 293
99 3300035119 Ga0373956_0053092 Ga0373956_0053092_16_975 293
100 3300035120 Ga0373957_0019833 Ga0373957_0019833_539_1498 293
101 3300035170 Ga0373943_0004189 Ga0373943_0004189_1437_2339 293
102 3300035170 Ga0373943_0006883 Ga0373943_0006883_2746_3705 293
103 3300035171 Ga0373946_0002868 Ga0373946_0002868_2097_2999 293
104 3300035171 Ga0373946_0006416 Ga0373946_0006416_871_1830 293
105 3300035410 Ga0373924_0006143 Ga0373924_0006143_140_1099 293
106 3300035691 Ga0373931_0053723 Ga0373931_0053723_57_959 293
107 3300035692 Ga0373935_0000454 Ga0373935_0000454_5644_6603 293
108 3300035692 Ga0373935_0009642 Ga0373935_0009642_1455_2357 293
109 3300035695 Ga0373927_0001264 Ga0373927_0001264_7132_8034 293
110 3300035695 Ga0373927_0019670 Ga0373927_0019670_3358_4317 293
111 3300035724 Ga0373933_0002060 Ga0373933_0002060_5163_6122 293
112 3300035725 Ga0373947_0005085 Ga0373947_0005085_3503_4405 293
113 3300036401 Ga0373937_0000089 Ga0373937_0000089_55454_56413 293
114 3300037068 Ga0373925_0000016 Ga0373925_0000016_153378_154337 293
115 3300037068 Ga0373925_0003827 Ga0373925_0003827_3537_4439 293
116 3300039437 Ga0436365_1705817 Ga0436365_1705817_581_1462 293
117 3300046454 Ga0495592_0001282 Ga0495592_0001282_3078_4037 293
118 3300046459 Ga0495629_0009971 Ga0495629_0009971_4604_5563 293
119 3300046462 Ga0495651_0002468 Ga0495651_0002468_3155_4114 293
120 3300046463 Ga0495653_0000022 Ga0495653_0000022_103745_104704 293
121 3300046472 Ga0495580_0001099 Ga0495580_0001099_15832_16734 293
122 3300046473 Ga0495582_0028989 Ga0495582_0028989_1079_1981 293
123 3300046475 Ga0495639_0042193 Ga0495639_0042193_150_1052 293
124 3300046476 Ga0495662_0000552 Ga0495662_0000552_3549_4508 293
125 3300046477 Ga0495664_0000013 Ga0495664_0000013_86552_87511 293
126 3300046511 Ga0495608_0000004 Ga0495608_0000004_237282_238241 293
127 3300046514 Ga0495618_0000032 Ga0495618_0000032_90174_91133 293
128 3300046516 Ga0495628_0000014 Ga0495628_0000014_118315_119274 293
129 3300046517 Ga0495630_0024919 Ga0495630_0024919_2205_3164 293
130 3300046529 Ga0495652_0000002 Ga0495652_0000002_91666_92625 293
131 3300046533 Ga0495640_0000001 Ga0495640_0000001_185669_186628 293
132 3300046535 Ga0495586_0018101 Ga0495586_0018101_1872_2774 293
133 3300046536 Ga0495587_0000004 Ga0495587_0000004_240766_241725 293
134 3300046543 Ga0495645_0000001 Ga0495645_0000001_116865_117824 293
135 3300046559 Ga0495667_0000009 Ga0495667_0000009_121914_122873 293
136 3300046642 Ga0495634_0000033 Ga0495634_0000033_93433_94392 293
137 3300046663 Ga0495635_0000003 Ga0495635_0000003_116722_117681 293
138 3300046675 Ga0495657_0000112 Ga0495657_0000112_68971_69930 293
139 3300046679 Ga0495623_0000026 Ga0495623_0000026_48800_49759 293
140 3300046680 Ga0495646_0000005 Ga0495646_0000005_29262_30221 293
141 3300046681 Ga0495647_0000277 Ga0495647_0000277_2377_3279 293
142 3300046683 Ga0495658_0001128 Ga0495658_0001128_4334_5236 293
143 3300046689 Ga0495613_0137661 Ga0495613_0137661_814_1701 293
144 3300046809 Ga0495600_0000003 Ga0495600_0000003_104068_105027 293
145 3300047317 Ga0495604_0000002 Ga0495604_0000002_413184_414143 293
146 3300047319 Ga0495674_0000004 Ga0495674_0000004_412517_413476 293
147 3300047321 Ga0495676_0020012 Ga0495676_0020012_3960_4862 293
148 3300047322 Ga0495680_0000129 Ga0495680_0000129_62413_63372 293
149 3300047444 Ga0495675_0000268 Ga0495675_0000268_11422_12381 293
150 3300047471 Ga0495684_0000019 Ga0495684_0000019_36214_37173 293
151 3300047673 Ga0495593_0000137 Ga0495593_0000137_20597_21556 293
152 3300048088 Ga0495602_0000001 Ga0495602_0000001_116764_117723 293
153 3300048929 Ga0496126_0001329 Ga0496126_0001329_5377_6270 293
154 3300049570 Ga0501033_0206570 Ga0501033_0206570_455_1357 293
155 3300049589 Ga0501073_0137732 Ga0501073_0137732_35_937 293
156 3300049823 Ga0501044_0164065 Ga0501044_0164065_582_1484 293
157 3300053077 Ga0495601_0000002 Ga0495601_0000002_433370_434329 293
158 3300053078 Ga0495612_0000012 Ga0495612_0000012_106212_107171 293
159 3300053084 Ga0495595_0000012 Ga0495595_0000012_64799_65758 293
160 3300053085 Ga0495619_0000003 Ga0495619_0000003_121886_122845 293
161 3300005436 Ga0070713_100103245 Ga0070713_1001032452 294
162 3300005545 Ga0070695_100220213 Ga0070695_1002202132 294
163 3300006028 Ga0070717_10024502 Ga0070717_100245023 294
164 3300006028 Ga0070717_10225037 Ga0070717_102250372 294
165 3300006175 Ga0070712_100293458 Ga0070712_1002934582 294
166 3300006847 Ga0075431_100419111 Ga0075431_1004191112 294
167 3300006871 Ga0075434_100001207 Ga0075434_1000012075 294
168 3300006880 Ga0075429_100068703 Ga0075429_1000687031 294
169 3300007076 Ga0075435_100314193 Ga0075435_1003141932 294
170 3300009147 Ga0114129_10087577 Ga0114129_100875773 294
171 3300013105 Ga0157369_10463801 Ga0157369_104638012 294
172 3300035083 Ga0373926_0070050 Ga0373926_0070050_340_1224 294
173 3300035089 Ga0373944_0001575 Ga0373944_0001575_208_1092 294
174 3300035111 Ga0373923_0034662 Ga0373923_0034662_593_1477 294
175 3300035113 Ga0373936_0004502 Ga0373936_0004502_2265_3149 294
176 3300035116 Ga0373945_0003644 Ga0373945_0003644_1373_2257 294
177 3300035170 Ga0373943_0001014 Ga0373943_0001014_11551_12435 294
178 3300035695 Ga0373927_0002492 Ga0373927_0002492_12490_13374 294
179 3300035725 Ga0373947_0003394 Ga0373947_0003394_8352_9236 294
180 3300039437 Ga0436365_0049485 Ga0436365_0049485_916_1800 294
181 3300046472 Ga0495580_0026132 Ga0495580_0026132_1956_2840 294
182 3300046526 Ga0495666_0020260 Ga0495666_0020260_241_1125 294
183 3300046675 Ga0495657_0231421 Ga0495657_0231421_125_1009 294
184 3300046690 Ga0495624_0022863 Ga0495624_0022863_2978_3862 294
185 3300047471 Ga0495684_0004282 Ga0495684_0004282_10012_10896 294
186 3300047673 Ga0495593_0014297 Ga0495593_0014297_3172_4056 294
187 3300050507 nmdc:mga05p37_68339_c1 nmdc:mga05p37_68339_c1_1231_2115 294
188 3300050512 nmdc:mga0n895_436_c1 nmdc:mga0n895_436_c1_4862_5746 294
189 3300050513 nmdc:mga0rr50_96397_c1 nmdc:mga0rr50_96397_c1_199_1083 294
190 3300050514 nmdc:mga08x19_204859_c1 nmdc:mga08x19_204859_c1_47_931 294
191 iso_pu_bacteria 8055225921 8055227924 294
192 3300005329 Ga0070683_100080356 Ga0070683_1000803562 295
193 3300005356 Ga0070674_100095699 Ga0070674_1000956992 295
194 3300005365 Ga0070688_100070453 Ga0070688_1000704532 295
195 3300005366 Ga0070659_100180740 Ga0070659_1001807401 295
196 3300005435 Ga0070714_100140661 Ga0070714_1001406612 295
197 3300005436 Ga0070713_100032713 Ga0070713_1000327132 295
198 3300005445 Ga0070708_100495507 Ga0070708_1004955071 295
199 3300005467 Ga0070706_100100265 Ga0070706_1001002651 295
200 3300005518 Ga0070699_100013745 Ga0070699_1000137454 295
201 3300005518 Ga0070699_100186196 Ga0070699_1001861961 295
202 3300005535 Ga0070684_100009449 Ga0070684_1000094494 295
203 3300005548 Ga0070665_100393729 Ga0070665_1003937291 295
204 3300005549 Ga0070704_100379294 Ga0070704_1003792941 295
205 3300005564 Ga0070664_100111415 Ga0070664_1001114153 295
206 3300005616 Ga0068852_100032341 Ga0068852_1000323414 295
207 3300005937 Ga0081455_10040566 Ga0081455_100405662 295
208 3300005983 Ga0081540_1000026 Ga0081540_100002650 295
209 3300005983 Ga0081540_1006217 Ga0081540_10062174 295
210 3300005983 Ga0081540_1039466 Ga0081540_10394662 295
211 3300005985 Ga0081539_10008045 Ga0081539_100080456 295
212 3300006028 Ga0070717_10296903 Ga0070717_102969032 295
213 3300006028 Ga0070717_10440931 Ga0070717_104409312 295
214 3300006175 Ga0070712_100002935 Ga0070712_1000029352 295
215 3300006844 Ga0075428_100344134 Ga0075428_1003441342 295
216 3300006847 Ga0075431_100142105 Ga0075431_1001421052 295
217 3300006852 Ga0075433_10404347 Ga0075433_104043472 295
218 3300006871 Ga0075434_100064138 Ga0075434_1000641383 295
219 3300006871 Ga0075434_100087254 Ga0075434_1000872542 295
220 3300006914 Ga0075436_100009750 Ga0075436_1000097509 295
221 3300007076 Ga0075435_100376860 Ga0075435_1003768602 295
222 3300007265 Ga0099794_10019814 Ga0099794_100198142 295
223 3300007265 Ga0099794_10040210 Ga0099794_100402102 295
224 3300007788 Ga0099795_10008852 Ga0099795_100088523 295
225 3300009094 Ga0111539_10074451 Ga0111539_100744513 295
226 3300009094 Ga0111539_10500889 Ga0111539_105008892 295
227 3300009147 Ga0114129_10158156 Ga0114129_101581563 295
228 3300009148 Ga0105243_10289011 Ga0105243_102890111 295
229 3300009177 Ga0105248_10029884 Ga0105248_100298844 295
230 3300013307 Ga0157372_10200194 Ga0157372_102001941 295
231 3300025906 Ga0207699_10030657 Ga0207699_100306572 295
232 3300025910 Ga0207684_10056264 Ga0207684_100562642 295
233 3300025910 Ga0207684_10099540 Ga0207684_100995402 295
234 3300025915 Ga0207693_10004490 Ga0207693_100044902 295
235 3300025916 Ga0207663_10021837 Ga0207663_100218374 295
236 3300025922 Ga0207646_10216834 Ga0207646_102168342 295
237 3300025928 Ga0207700_10032411 Ga0207700_100324113 295
238 3300025933 Ga0207706_10150930 Ga0207706_101509302 295
239 3300025935 Ga0207709_10126199 Ga0207709_101261992 295
240 3300025937 Ga0207669_10216837 Ga0207669_102168372 295
241 3300025937 Ga0207669_10284853 Ga0207669_102848532 295
242 3300025939 Ga0207665_10002785 Ga0207665_100027856 295
243 3300025944 Ga0207661_10096779 Ga0207661_100967792 295
244 3300026142 Ga0207698_10036103 Ga0207698_100361034 295
245 3300027671 Ga0209588_1014839 Ga0209588_10148392 295
246 3300031456 Ga0307513_10068021 Ga0307513_100680214 295
247 3300035118 Ga0373954_0030902 Ga0373954_0030902_105_992 295
248 3300035120 Ga0373957_0008394 Ga0373957_0008394_1247_2134 295
249 3300035172 Ga0373955_0007789 Ga0373955_0007789_1875_2762 295
250 3300035691 Ga0373931_0035127 Ga0373931_0035127_195_1082 295
251 3300035695 Ga0373927_0235768 Ga0373927_0235768_252_1139 295
252 3300035724 Ga0373933_0010844 Ga0373933_0010844_1802_2689 295
253 3300035725 Ga0373947_0037522 Ga0373947_0037522_934_1821 295
254 3300035725 Ga0373947_0041120 Ga0373947_0041120_118_1005 295
255 3300036401 Ga0373937_0008865 Ga0373937_0008865_3289_4176 295
256 3300039447 Ga0436361_0550596 Ga0436361_0550596_10871_11758 295
257 3300044706 Ga0466964_0106882 Ga0466964_0106882_77_964 295
258 3300045976 Ga0466967_0402635 Ga0466967_0402635_306_1193 295
259 3300046460 Ga0495638_0001652 Ga0495638_0001652_11453_12340 295
260 3300046461 Ga0495641_0024281 Ga0495641_0024281_65_952 295
261 3300046462 Ga0495651_0109194 Ga0495651_0109194_864_1751 295
262 3300046463 Ga0495653_0085631 Ga0495653_0085631_870_1757 295
263 3300046473 Ga0495582_0053855 Ga0495582_0053855_1181_2068 295
264 3300046476 Ga0495662_0016763 Ga0495662_0016763_2151_3038 295
265 3300046529 Ga0495652_0175288 Ga0495652_0175288_65_952 295
266 3300046536 Ga0495587_0121395 Ga0495587_0121395_208_1095 295
267 3300046675 Ga0495657_0005797 Ga0495657_0005797_4351_5238 295
268 3300046689 Ga0495613_0090412 Ga0495613_0090412_276_1163 295
269 3300046809 Ga0495600_0034149 Ga0495600_0034149_1163_2050 295
270 3300047321 Ga0495676_0151058 Ga0495676_0151058_600_1487 295
271 3300047322 Ga0495680_0094765 Ga0495680_0094765_233_1120 295
272 3300047444 Ga0495675_0051153 Ga0495675_0051153_1401_2288 295
273 3300047673 Ga0495593_0019517 Ga0495593_0019517_1094_1981 295
274 3300048088 Ga0495602_0099023 Ga0495602_0099023_285_1172 295
275 3300048089 Ga0495614_0073199 Ga0495614_0073199_46_933 295
276 3300048903 Ga0496100_0258327 Ga0496100_0258327_234_1121 295
277 3300048909 Ga0496106_0178537 Ga0496106_0178537_71_958 295
278 3300048913 Ga0496110_0031695 Ga0496110_0031695_2445_3332 295
279 3300048914 Ga0496111_0143500 Ga0496111_0143500_78_965 295
280 3300050507 nmdc:mga05p37_304403_c1 nmdc:mga05p37_304403_c1_658_1545 295
281 3300050511 nmdc:mga08y16_358353_c1 nmdc:mga08y16_358353_c1_304_1191 295
282 3300050512 nmdc:mga0n895_109960_c1 nmdc:mga0n895_109960_c1_1677_2576 295
283 3300050512 nmdc:mga0n895_50479_c1 nmdc:mga0n895_50479_c1_2044_2931 295
284 3300050515 nmdc:mga0a205_188810_c1 nmdc:mga0a205_188810_c1_870_1757 295
285 3300053077 Ga0495601_0011258 Ga0495601_0011258_3689_4576 295
286 3300053077 Ga0495601_0060414 Ga0495601_0060414_752_1657 295
287 3300053084 Ga0495595_0005633 Ga0495595_0005633_1823_2710 295
288 3300053085 Ga0495619_0029319 Ga0495619_0029319_1635_2522 295
289 3300053085 Ga0495619_0107698 Ga0495619_0107698_24_929 295
290 3300021388 Ga0213875_10000058 Ga0213875_1000005832 296
291 3300037853 Ga0436364_0440289 Ga0436364_0440289_30643_31533 296
292 3300005434 Ga0070709_10016933 Ga0070709_100169336 297
293 3300005435 Ga0070714_100348043 Ga0070714_1003480431 297
294 3300005437 Ga0070710_10016614 Ga0070710_100166142 297
295 3300005539 Ga0068853_100399563 Ga0068853_1003995631 297
296 3300005937 Ga0081455_10066176 Ga0081455_100661763 297
297 3300006844 Ga0075428_100157088 Ga0075428_1001570884 297
298 3300006846 Ga0075430_100023739 Ga0075430_1000237392 297
299 3300006880 Ga0075429_100186624 Ga0075429_1001866242 297
300 3300009094 Ga0111539_10029841 Ga0111539_100298415 297
301 3300009147 Ga0114129_10093262 Ga0114129_100932622 297
302 3300025929 Ga0207664_10129636 Ga0207664_101296362 297
303 3300025939 Ga0207665_10084567 Ga0207665_100845672 297
304 3300046459 Ga0495629_0247038 Ga0495629_0247038_29_937 297
305 3300046533 Ga0495640_0014368 Ga0495640_0014368_4510_5466 297
306 3300046642 Ga0495634_0062707 Ga0495634_0062707_1452_2408 297
307 3300047318 Ga0495636_0094094 Ga0495636_0094094_262_1155 297
308 3300047319 Ga0495674_0038580 Ga0495674_0038580_3209_4165 297
309 3300048917 Ga0496114_0122836 Ga0496114_0122836_536_1492 297
310 3300048929 Ga0496126_0146288 Ga0496126_0146288_793_1722 297
311 3300050507 nmdc:mga05p37_261452_c1 nmdc:mga05p37_261452_c1_149_1042 297
312 3300050509 nmdc:mga0qj67_368041_c1 nmdc:mga0qj67_368041_c1_28_921 297
313 3300050510 nmdc:mga06r32_584905_c1 nmdc:mga06r32_584905_c1_113_1063 297
314 3300050511 nmdc:mga08y16_102001_c1 nmdc:mga08y16_102001_c1_1934_2830 297
315 3300005331 Ga0070670_100180122 Ga0070670_1001801222 298
316 3300005340 Ga0070689_100118355 Ga0070689_1001183552 298
317 3300005353 Ga0070669_100110326 Ga0070669_1001103262 298
318 3300005364 Ga0070673_100305041 Ga0070673_1003050412 298
319 3300005435 Ga0070714_100229434 Ga0070714_1002294341 298
320 3300005439 Ga0070711_100255884 Ga0070711_1002558842 298
321 3300005539 Ga0068853_100322635 Ga0068853_1003226352 298
322 3300005577 Ga0068857_100181242 Ga0068857_1001812422 298
323 3300005617 Ga0068859_100065375 Ga0068859_1000653754 298
324 3300005618 Ga0068864_100134935 Ga0068864_1001349352 298
325 3300005841 Ga0068863_100401812 Ga0068863_1004018122 298
326 3300005842 Ga0068858_100272801 Ga0068858_1002728012 298
327 3300005937 Ga0081455_10000058 Ga0081455_1000005894 298
328 3300005937 Ga0081455_10008303 Ga0081455_100083039 298
329 3300005937 Ga0081455_10011527 Ga0081455_100115279 298
330 3300005981 Ga0081538_10060867 Ga0081538_100608672 298
331 3300005981 Ga0081538_10061972 Ga0081538_100619722 298
332 3300005985 Ga0081539_10033748 Ga0081539_100337483 298
333 3300006163 Ga0070715_10092535 Ga0070715_100925352 298
334 3300006844 Ga0075428_100002118 Ga0075428_10000211815 298
335 3300006844 Ga0075428_100019085 Ga0075428_1000190852 298
336 3300006844 Ga0075428_100063608 Ga0075428_1000636086 298
337 3300006844 Ga0075428_100113415 Ga0075428_1001134153 298
338 3300006844 Ga0075428_100298642 Ga0075428_1002986422 298
339 3300006846 Ga0075430_100103336 Ga0075430_1001033362 298
340 3300006847 Ga0075431_100037688 Ga0075431_1000376884 298
341 3300006847 Ga0075431_100077718 Ga0075431_1000777183 298
342 3300006847 Ga0075431_100089087 Ga0075431_1000890872 298
343 3300006852 Ga0075433_10009625 Ga0075433_100096253 298
344 3300006852 Ga0075433_10175214 Ga0075433_101752142 298
345 3300006871 Ga0075434_100001060 Ga0075434_1000010603 298
346 3300006871 Ga0075434_100187309 Ga0075434_1001873092 298
347 3300006931 Ga0097620_100065384 Ga0097620_1000653844 298
348 3300009094 Ga0111539_10025745 Ga0111539_100257455 298
349 3300009094 Ga0111539_10057462 Ga0111539_100574625 298
350 3300009098 Ga0105245_10099392 Ga0105245_100993922 298
351 3300009101 Ga0105247_10016083 Ga0105247_100160834 298
352 3300009147 Ga0114129_10008197 Ga0114129_100081976 298
353 3300009147 Ga0114129_10062179 Ga0114129_100621795 298
354 3300009147 Ga0114129_10290714 Ga0114129_102907142 298
355 3300009147 Ga0114129_10339369 Ga0114129_103393692 298
356 3300009148 Ga0105243_10131927 Ga0105243_101319272 298
357 3300011119 Ga0105246_10083864 Ga0105246_100838642 298
358 3300014325 Ga0163163_10259857 Ga0163163_102598572 298
359 3300024227 Ga0228598_1022384 Ga0228598_10223841 298
360 3300025900 Ga0207710_10006463 Ga0207710_100064632 298
361 3300025918 Ga0207662_10055346 Ga0207662_100553462 298
362 3300025918 Ga0207662_10164204 Ga0207662_101642041 298
363 3300025923 Ga0207681_10122963 Ga0207681_101229632 298
364 3300025925 Ga0207650_10406163 Ga0207650_104061631 298
365 3300025927 Ga0207687_10043494 Ga0207687_100434942 298
366 3300025942 Ga0207689_10033984 Ga0207689_100339844 298
367 3300025960 Ga0207651_10355937 Ga0207651_103559372 298
368 3300026035 Ga0207703_10123235 Ga0207703_101232352 298
369 3300026075 Ga0207708_10290953 Ga0207708_102909532 298
370 3300026095 Ga0207676_10221132 Ga0207676_102211322 298
371 3300026116 Ga0207674_10100693 Ga0207674_101006933 298
372 3300027907 Ga0207428_10003770 Ga0207428_1000377014 298
373 3300027907 Ga0207428_10034405 Ga0207428_100344053 298
374 3300027907 Ga0207428_10118674 Ga0207428_101186742 298
375 3300028023 Ga0265357_1000899 Ga0265357_10008992 298
376 3300035088 Ga0373940_0009719 Ga0373940_0009719_542_1468 298
377 3300035090 Ga0373949_0010339 Ga0373949_0010339_365_1291 298
378 3300035115 Ga0373941_0008745 Ga0373941_0008745_298_1224 298
379 3300035241 Ga0373961_0018132 Ga0373961_0018132_244_1170 298
380 3300035691 Ga0373931_0009828 Ga0373931_0009828_1071_1997 298
381 3300035692 Ga0373935_0030716 Ga0373935_0030716_2182_3087 298
382 3300036401 Ga0373937_0311220 Ga0373937_0311220_274_1179 298
383 3300046454 Ga0495592_0040253 Ga0495592_0040253_2178_3083 298
384 3300046460 Ga0495638_0026503 Ga0495638_0026503_74_1009 298
385 3300046462 Ga0495651_0028257 Ga0495651_0028257_2487_3392 298
386 3300046463 Ga0495653_0021161 Ga0495653_0021161_1806_2711 298
387 3300046475 Ga0495639_0013346 Ga0495639_0013346_2380_3285 298
388 3300046477 Ga0495664_0009788 Ga0495664_0009788_2636_3541 298
389 3300046492 Ga0495585_0086276 Ga0495585_0086276_509_1444 298
390 3300046514 Ga0495618_0016827 Ga0495618_0016827_2710_3615 298
391 3300046517 Ga0495630_0046573 Ga0495630_0046573_266_1171 298
392 3300046529 Ga0495652_0069759 Ga0495652_0069759_1826_2731 298
393 3300046533 Ga0495640_0012840 Ga0495640_0012840_2853_3758 298
394 3300046543 Ga0495645_0021741 Ga0495645_0021741_2003_2908 298
395 3300046615 Ga0495656_0040053 Ga0495656_0040053_595_1536 298
396 3300046642 Ga0495634_0014186 Ga0495634_0014186_3980_4885 298
397 3300046663 Ga0495635_0009284 Ga0495635_0009284_2660_3565 298
398 3300046680 Ga0495646_0063135 Ga0495646_0063135_991_1896 298
399 3300046683 Ga0495658_0074790 Ga0495658_0074790_450_1376 298
400 3300047319 Ga0495674_0019244 Ga0495674_0019244_2710_3615 298
401 3300050507 nmdc:mga05p37_250761_c1 nmdc:mga05p37_250761_c1_511_1437 298
402 3300050507 nmdc:mga05p37_332436_c1 nmdc:mga05p37_332436_c1_147_1073 298
403 3300050507 nmdc:mga05p37_6008_c2 nmdc:mga05p37_6008_c2_4506_5450 298
404 3300050508 nmdc:mga09592_16961_c1 nmdc:mga09592_16961_c1_4456_5376 298
405 3300050508 nmdc:mga09592_232503_c1 nmdc:mga09592_232503_c1_365_1312 298
406 3300050510 nmdc:mga06r32_68546_c1 nmdc:mga06r32_68546_c1_1278_2207 298
407 3300050511 nmdc:mga08y16_151882_c1 nmdc:mga08y16_151882_c1_345_1271 298
408 3300050512 nmdc:mga0n895_60292_c1 nmdc:mga0n895_60292_c1_1860_2801 298
409 3300050512 nmdc:mga0n895_646_c1 nmdc:mga0n895_646_c1_4231_5157 298
410 3300050515 nmdc:mga0a205_2530_c1 nmdc:mga0a205_2530_c1_7589_8515 298
411 3300053077 Ga0495601_0008815 Ga0495601_0008815_2695_3600 298
412 3300053078 Ga0495612_0004107 Ga0495612_0004107_2616_3521 298
413 3300053085 Ga0495619_0054718 Ga0495619_0054718_1127_2053 298
414 3300005293 Ga0065715_10152071 Ga0065715_101520712 308
415 3300005367 Ga0070667_100334593 Ga0070667_1003345931 308
416 3300017792 Ga0163161_10097179 Ga0163161_100971792 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

33

247

0.89

PF13379

NMT1_2

NMT1-like family

29

253

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7935 2 304
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7927 2 302
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.7885 1 304
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7764 2 304
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.7673 1 304
ID Description Score Start End Superfamily
3qslA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8419 2 304 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8207 87 194 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8173 2 304 3.40.190.10
4ef1A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8098 1 84 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.805 84 194 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537P381-F1-model_v4 ABC transporter substrate-binding protein 0.9753 53 308
AF-A0A537P381-F1-model_v4 ABC transporter substrate-binding protein 0.9675 53 308
AF-A0A1Q7TUQ8-F1-model_v4 SsuA/THI5-like domain-containing protein 0.965 1 305
AF-A0A1Q3KD64-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9641 1 305
AF-A0A2E5PN62-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9636 1 305

Feature Viewer

pLDDT pTM Quality
92.51 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map