F438741

General Info

Members Datasets Scaffolds Average Seq Length
416 247 416 233

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100000359|Ga0070707_1000003595
Length 254
Sequence MTETVIETRQLTKEYVRDEFHVVALKDVDLTINRGEFVALMGPSGSGKSTLLHLIAAMDRPTGGEIRVLGEDLRRLSDREVARWRNEHVGFIFQSFNLIPVMSAMENVELPLKLTNLKKSERREHAAIALELVGLGERMKHLPRQLSGGQEQRVAIARAIATDPDLILADEPTGNLDAASAQEALTVLAKLNREYGKTIVMVTHDPHAASFATRVCRLDKGVLLREGALPDEWIDSDPAAPVLSRFVPAKGTSP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
201 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
202 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
224 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
225 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
226 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
227 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
228 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 97.36
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9471297 2162886012 Bacteria 954
2 CNAas_1002007 3300000532 Unclassified 1542
3 JGI25406J46586_10007090 3300003203 Bacteria 5134
4 Ga0065704_10097922 3300005289 Bacteria 2373
5 Ga0065712_10105225 3300005290 Bacteria 1944
6 Ga0065715_10013551 3300005293 Bacteria 2208
7 Ga0065715_10104687 3300005293 Bacteria 2943
8 Ga0065715_10189567 3300005293 Bacteria 1423
9 Ga0065715_10389864 3300005293 Bacteria 895
10 Ga0065707_10088334 3300005295 Bacteria 4688
11 Ga0065707_10264160 3300005295 Bacteria 1089
12 Ga0070676_10392053 3300005328 Bacteria 964
13 Ga0070683_100000002 3300005329 Bacteria 427530
14 Ga0070683_100124934 3300005329 Bacteria 2432
15 Ga0068869_100063627 3300005334 Bacteria 2711
16 Ga0068869_100328763 3300005334 Bacteria 1241
17 Ga0070680_100124293 3300005336 Bacteria 2155
18 Ga0068868_100269072 3300005338 Bacteria 1439
19 Ga0070660_100065719 3300005339 Bacteria 2823
20 Ga0070689_100071889 3300005340 Bacteria 2703
21 Ga0070689_100437056 3300005340 Bacteria 1111
22 Ga0070687_100013607 3300005343 Bacteria 3630
23 Ga0070661_100165001 3300005344 Bacteria 1679
24 Ga0070669_100468837 3300005353 Bacteria 1040
25 Ga0070671_100029974 3300005355 Bacteria 4489
26 Ga0070673_100036057 3300005364 Bacteria 3756
27 Ga0070659_100036966 3300005366 Bacteria 3806
28 Ga0070667_100142217 3300005367 Bacteria 2102
29 Ga0070667_100202896 3300005367 Bacteria 1760
30 Ga0070667_100257923 3300005367 Bacteria 1560
31 Ga0070714_100001305 3300005435 Bacteria 18015
32 Ga0070711_100032593 3300005439 Bacteria 3465
33 Ga0070711_100048962 3300005439 Bacteria 2893
34 Ga0070700_100000548 3300005441 Bacteria 18871
35 Ga0070694_100017026 3300005444 Bacteria 4587
36 Ga0070708_100014735 3300005445 Bacteria 6441
37 Ga0070708_100116271 3300005445 Bacteria 2463
38 Ga0070708_100177349 3300005445 Bacteria 1991
39 Ga0070662_100033961 3300005457 Bacteria 3595
40 Ga0070662_100134296 3300005457 Bacteria 1912
41 Ga0068867_100070105 3300005459 Bacteria 2620
42 Ga0068867_100101868 3300005459 Bacteria 2194
43 Ga0070706_100011269 3300005467 Bacteria 8303
44 Ga0070706_100017311 3300005467 Bacteria 6651
45 Ga0070706_100081349 3300005467 Bacteria 2999
46 Ga0070706_100454023 3300005467 Bacteria 1192
47 Ga0070707_100000359 3300005468 Bacteria 44814
48 Ga0070707_100000920 3300005468 Bacteria 29194
49 Ga0070707_100498743 3300005468 Bacteria 1179
50 Ga0070698_100004327 3300005471 Bacteria 15606
51 Ga0070698_100023113 3300005471 Bacteria 6501
52 Ga0070698_100046268 3300005471 Bacteria 4449
53 Ga0070698_100143887 3300005471 Bacteria 2334
54 Ga0070699_100003025 3300005518 Bacteria 14921
55 Ga0070699_100009891 3300005518 Bacteria 8258
56 Ga0070699_100010793 3300005518 Bacteria 7906
57 Ga0070699_100040849 3300005518 Bacteria 4015
58 Ga0070699_100049729 3300005518 Bacteria 3629
59 Ga0070699_100191838 3300005518 Bacteria 1815
60 Ga0070684_100000007 3300005535 Bacteria 217174
61 Ga0070697_100038801 3300005536 Bacteria 3849
62 Ga0068853_100066967 3300005539 Bacteria 3119
63 Ga0070695_100039027 3300005545 Bacteria 2999
64 Ga0070696_100004095 3300005546 Bacteria 9718
65 Ga0070696_100059679 3300005546 Bacteria 2666
66 Ga0070696_100075650 3300005546 Bacteria 2376
67 Ga0070665_100465080 3300005548 Bacteria 1275
68 Ga0070704_100031625 3300005549 Bacteria 3563
69 Ga0068855_100082013 3300005563 Bacteria 3738
70 Ga0070664_100021643 3300005564 Bacteria 5302
71 Ga0070664_100061113 3300005564 Bacteria 3210
72 Ga0068857_100885310 3300005577 Bacteria 856
73 Ga0068856_100010676 3300005614 Bacteria 8923
74 Ga0068856_100040824 3300005614 Unclassified 4558
75 Ga0070702_100476042 3300005615 Bacteria 911
76 Ga0068852_100657472 3300005616 Unclassified 1056
77 Ga0068859_100038977 3300005617 Bacteria 4766
78 Ga0068859_100412796 3300005617 Bacteria 1446
79 Ga0068859_100573627 3300005617 Bacteria 1222
80 Ga0068864_100000961 3300005618 Bacteria 24179
81 Ga0068864_100640119 3300005618 Bacteria 1035
82 Ga0068861_100273115 3300005719 Bacteria 1452
83 Ga0068870_10256513 3300005840 Bacteria 1086
84 Ga0068863_100027355 3300005841 Bacteria 5439
85 Ga0068858_100016740 3300005842 Bacteria 6884
86 Ga0068858_100075780 3300005842 Bacteria 3125
87 Ga0068858_100327454 3300005842 Bacteria 1465
88 Ga0068858_100356620 3300005842 Bacteria 1401
89 Ga0068860_100172196 3300005843 Bacteria 2091
90 Ga0068860_100175646 3300005843 Bacteria 2070
91 Ga0068862_100018536 3300005844 Bacteria 5797
92 Ga0068862_100043681 3300005844 Bacteria 3821
93 Ga0081455_10107179 3300005937 Bacteria 2228
94 Ga0081539_10000407 3300005985 Bacteria 91696
95 Ga0081539_10003712 3300005985 Bacteria 18194
96 Ga0070717_10011885 3300006028 Bacteria 6625
97 Ga0070717_10822396 3300006028 Bacteria 845
98 Ga0070712_100154864 3300006175 Bacteria 1763
99 Ga0097621_100505734 3300006237 Bacteria 1095
100 Ga0097621_100795733 3300006237 Bacteria 876
101 Ga0068871_100003106 3300006358 Bacteria 11397
102 Ga0068871_100145736 3300006358 Bacteria 2016
103 Ga0068871_100149693 3300006358 Bacteria 1989
104 Ga0068871_100233763 3300006358 Bacteria 1596
105 Ga0075428_100488894 3300006844 Bacteria 1317
106 Ga0075428_100498604 3300006844 Bacteria 1303
107 Ga0075431_100654173 3300006847 Bacteria 1031
108 Ga0075433_10365132 3300006852 Bacteria 1275
109 Ga0075429_100175921 3300006880 Bacteria 1875
110 Ga0068865_100050134 3300006881 Unclassified 2882
111 Ga0097620_100038975 3300006931 Bacteria 4766
112 Ga0097620_100412840 3300006931 Bacteria 1446
113 Ga0097620_100573595 3300006931 Bacteria 1222
114 Ga0075435_100734886 3300007076 Bacteria 858
115 Ga0105240_10056908 3300009093 Bacteria 4890
116 Ga0105240_10262754 3300009093 Bacteria 1990
117 Ga0111539_10027916 3300009094 Bacteria 6892
118 Ga0114129_10029556 3300009147 Bacteria 7761
119 Ga0114129_10034459 3300009147 Bacteria 7151
120 Ga0114129_10204496 3300009147 Bacteria 2672
121 Ga0114129_11093096 3300009147 Bacteria 999
122 Ga0105241_10172152 3300009174 Bacteria 1789
123 Ga0105241_10187829 3300009174 Bacteria 1718
124 Ga0105241_10640738 3300009174 Bacteria 964
125 Ga0105242_10569939 3300009176 Bacteria 1089
126 Ga0105248_10011822 3300009177 Bacteria 9629
127 Ga0105248_10127416 3300009177 Bacteria 2872
128 Ga0105248_10230822 3300009177 Bacteria 2083
129 Ga0105248_10667115 3300009177 Bacteria 1173
130 Ga0105237_10032632 3300009545 Bacteria 5272
131 Ga0105237_10091327 3300009545 Bacteria 3034
132 Ga0105237_10439182 3300009545 Bacteria 1311
133 Ga0105238_10023576 3300009551 Bacteria 6271
134 Ga0105238_10288833 3300009551 Bacteria 1622
135 Ga0105249_10015582 3300009553 Bacteria 6730
136 Ga0105239_10116206 3300010375 Bacteria 2969
137 Ga0105239_10138612 3300010375 Bacteria 2710
138 Ga0105246_10067306 3300011119 Bacteria 2509
139 Ga0105246_10096108 3300011119 Bacteria 2147
140 Ga0157373_10007604 3300013100 Bacteria 8054
141 Ga0157371_10015638 3300013102 Bacteria 5684
142 Ga0157369_10001852 3300013105 Bacteria 25575
143 Ga0157369_10056093 3300013105 Bacteria 4251
144 Ga0157369_10473397 3300013105 Bacteria 1296
145 Ga0157374_10004256 3300013296 Bacteria 12033
146 Ga0157374_10034682 3300013296 Bacteria 4612
147 Ga0157374_10089373 3300013296 Bacteria 2935
148 Ga0157374_10193898 3300013296 Bacteria 1988
149 Ga0157378_10001387 3300013297 Bacteria 21775
150 Ga0157378_10059779 3300013297 Bacteria 3401
151 Ga0157378_10060366 3300013297 Bacteria 3384
152 Ga0157378_10500612 3300013297 Bacteria 1214
153 Ga0163162_10000831 3300013306 Bacteria 28720
154 Ga0163162_10129637 3300013306 Bacteria 2630
155 Ga0163162_10216814 3300013306 Bacteria 2044
156 Ga0163162_10468971 3300013306 Bacteria 1391
157 Ga0157372_10290644 3300013307 Bacteria 1901
158 Ga0157372_10761002 3300013307 Bacteria 1126
159 Ga0157372_10928090 3300013307 Bacteria 1009
160 Ga0157375_10015816 3300013308 Bacteria 6761
161 Ga0157375_10050242 3300013308 Bacteria 4090
162 Ga0157375_10118717 3300013308 Bacteria 2752
163 Ga0157375_10199301 3300013308 Bacteria 2157
164 Ga0157375_10236499 3300013308 Bacteria 1986
165 Ga0157375_10922040 3300013308 Bacteria 1017
166 Ga0163163_10004845 3300014325 Bacteria 11564
167 Ga0163163_10033385 3300014325 Bacteria 4978
168 Ga0163163_10599287 3300014325 Unclassified 1165
169 Ga0157380_10012265 3300014326 Bacteria 6210
170 Ga0157380_10014188 3300014326 Bacteria 5827
171 Ga0157377_10322497 3300014745 Bacteria 1027
172 Ga0157376_10010721 3300014969 Bacteria 6721
173 Ga0157376_10019928 3300014969 Bacteria 5179
174 Ga0157376_10283433 3300014969 Bacteria 1561
175 Ga0182007_10161146 3300015262 Bacteria 767
176 Ga0163161_10093205 3300017792 Unclassified 2231
177 Ga0213875_10000002 3300021388 Bacteria 921066
178 Ga0207688_10406859 3300025901 Bacteria 844
179 Ga0207680_10170228 3300025903 Bacteria 1467
180 Ga0207680_10529647 3300025903 Bacteria 840
181 Ga0207645_10454322 3300025907 Bacteria 865
182 Ga0207643_10321112 3300025908 Bacteria 967
183 Ga0207684_10003628 3300025910 Bacteria 15007
184 Ga0207684_10735996 3300025910 Bacteria 836
185 Ga0207695_10052677 3300025913 Bacteria 4261
186 Ga0207695_10089092 3300025913 Unclassified 3104
187 Ga0207695_10214352 3300025913 Bacteria 1835
188 Ga0207695_10319160 3300025913 Bacteria 1443
189 Ga0207671_10106963 3300025914 Bacteria 2124
190 Ga0207671_10184242 3300025914 Bacteria 1626
191 Ga0207693_10050691 3300025915 Bacteria 3259
192 Ga0207663_10066855 3300025916 Bacteria 2302
193 Ga0207660_10322182 3300025917 Bacteria 1234
194 Ga0207660_10405787 3300025917 Bacteria 1098
195 Ga0207660_10466888 3300025917 Bacteria 1022
196 Ga0207662_10018219 3300025918 Bacteria 3980
197 Ga0207657_10094198 3300025919 Bacteria 2494
198 Ga0207646_10000651 3300025922 Bacteria 44822
199 Ga0207646_10000916 3300025922 Bacteria 38024
200 Ga0207646_10009381 3300025922 Bacteria 9674
201 Ga0207646_10052905 3300025922 Bacteria 3633
202 Ga0207681_10003696 3300025923 Bacteria 9505
203 Ga0207681_10272703 3300025923 Bacteria 1329
204 Ga0207650_10180757 3300025925 Bacteria 1681
205 Ga0207687_10418682 3300025927 Bacteria 1105
206 Ga0207700_10001943 3300025928 Bacteria 11761
207 Ga0207664_10003712 3300025929 Bacteria 10241
208 Ga0207644_10012818 3300025931 Bacteria 5575
209 Ga0207644_10077494 3300025931 Bacteria 2448
210 Ga0207706_10123427 3300025933 Bacteria 2278
211 Ga0207706_10329125 3300025933 Bacteria 1329
212 Ga0207686_10218567 3300025934 Bacteria 1374
213 Ga0207670_10341353 3300025936 Bacteria 1184
214 Ga0207711_10006345 3300025941 Bacteria 9974
215 Ga0207711_10070179 3300025941 Bacteria 3038
216 Ga0207689_10037425 3300025942 Bacteria 4024
217 Ga0207689_10181993 3300025942 Bacteria 1733
218 Ga0207689_10218594 3300025942 Bacteria 1574
219 Ga0207689_10592369 3300025942 Bacteria 932
220 Ga0207661_10000003 3300025944 Bacteria 611941
221 Ga0207679_10042414 3300025945 Bacteria 3270
222 Ga0207679_10510938 3300025945 Bacteria 1073
223 Ga0207667_10066917 3300025949 Bacteria 3744
224 Ga0207667_10781638 3300025949 Bacteria 952
225 Ga0207651_10012629 3300025960 Bacteria 4791
226 Ga0207651_10045879 3300025960 Bacteria 2934
227 Ga0207651_10275607 3300025960 Bacteria 1388
228 Ga0207640_10261866 3300025981 Bacteria 1348
229 Ga0207658_10114933 3300025986 Bacteria 2135
230 Ga0207658_10748829 3300025986 Bacteria 885
231 Ga0207677_10010497 3300026023 Bacteria 5243
232 Ga0207703_10033032 3300026035 Bacteria 4099
233 Ga0207703_10130548 3300026035 Bacteria 2169
234 Ga0207703_10144487 3300026035 Bacteria 2068
235 Ga0207703_10373835 3300026035 Bacteria 1317
236 Ga0207703_10609175 3300026035 Bacteria 1033
237 Ga0207703_10662161 3300026035 Bacteria 991
238 Ga0207703_10706512 3300026035 Bacteria 959
239 Ga0207639_10049927 3300026041 Bacteria 3175
240 Ga0207639_10064226 3300026041 Bacteria 2845
241 Ga0207708_10001715 3300026075 Bacteria 16223
242 Ga0207708_10125438 3300026075 Bacteria 2003
243 Ga0207702_10012871 3300026078 Bacteria 6959
244 Ga0207702_10171986 3300026078 Unclassified 1987
245 Ga0207641_10084321 3300026088 Bacteria 2766
246 Ga0207641_10154654 3300026088 Bacteria 2080
247 Ga0207648_10076146 3300026089 Bacteria 2925
248 Ga0207648_10122782 3300026089 Bacteria 2284
249 Ga0207648_10617279 3300026089 Bacteria 1000
250 Ga0207648_10633250 3300026089 Bacteria 988
251 Ga0207676_10005697 3300026095 Bacteria 8814
252 Ga0207675_100086578 3300026118 Bacteria 2942
253 Ga0207675_100207448 3300026118 Bacteria 1883
254 Ga0207675_100248523 3300026118 Bacteria 1721
255 Ga0207683_10549904 3300026121 Bacteria 1067
256 Ga0207698_10065537 3300026142 Bacteria 2853
257 Ga0207428_10128680 3300027907 Bacteria 1938
258 Ga0268266_10236081 3300028379 Bacteria 1686
259 Ga0268265_10111088 3300028380 Bacteria 2238
260 Ga0268265_10220764 3300028380 Bacteria 1658
261 Ga0268264_10285411 3300028381 Bacteria 1548
262 Ga0265318_10115294 3300028577 Bacteria 987
263 Ga0265338_10023167 3300028800 Bacteria 6394
264 Ga0265338_10605834 3300028800 Bacteria 763
265 Ga0265324_10032334 3300029957 Bacteria 1828
266 Ga0265332_10008388 3300031238 Bacteria 4644
267 Ga0265328_10019235 3300031239 Bacteria 2626
268 Ga0265320_10002234 3300031240 Bacteria 13585
269 Ga0265325_10006833 3300031241 Bacteria 6894
270 Ga0265325_10033272 3300031241 Bacteria 2749
271 Ga0265340_10017207 3300031247 Bacteria 3739
272 Ga0265339_10046724 3300031249 Bacteria 2378
273 Ga0265331_10007533 3300031250 Bacteria 6289
274 Ga0265331_10237697 3300031250 Bacteria 818
275 Ga0265316_10007652 3300031344 Bacteria 10137
276 Ga0265316_10013591 3300031344 Bacteria 7223
277 Ga0265316_10017329 3300031344 Bacteria 6232
278 Ga0265316_10038611 3300031344 Bacteria 3845
279 Ga0265316_10156927 3300031344 Bacteria 1702
280 Ga0265313_10074746 3300031595 Bacteria 1553
281 Ga0265314_10045147 3300031711 Bacteria 3117
282 Ga0265342_10033471 3300031712 Bacteria 3160
283 Ga0265342_10193168 3300031712 Bacteria 1110
284 Ga0307416_100455645 3300032002 Bacteria 1333
285 Ga0307416_100535600 3300032002 Bacteria 1242
286 Ga0373926_0003584 3300035083 Bacteria 5034
287 Ga0373926_0096367 3300035083 Bacteria 1104
288 Ga0373923_0053745 3300035111 Bacteria 1694
289 Ga0373953_0240239 3300035117 Bacteria 786
290 Ga0373954_0019745 3300035118 Bacteria 3042
291 Ga0373954_0170774 3300035118 Bacteria 1065
292 Ga0373954_0250306 3300035118 Bacteria 872
293 Ga0373956_0053454 3300035119 Bacteria 1818
294 Ga0373946_0130995 3300035171 Bacteria 1154
295 Ga0373935_0067721 3300035692 Bacteria 2296
296 Ga0373935_0087978 3300035692 Bacteria 2029
297 Ga0373935_0491783 3300035692 Bacteria 890
298 Ga0373927_0003509 3300035695 Bacteria 11223
299 Ga0373927_0005216 3300035695 Bacteria 8986
300 Ga0373933_0237831 3300035724 Bacteria 1171
301 Ga0373947_0012893 3300035725 Bacteria 4792
302 Ga0373937_0151521 3300036401 Bacteria 2172
303 Ga0373937_0251912 3300036401 Bacteria 1665
304 Ga0373937_0328812 3300036401 Bacteria 1447
305 Ga0373925_0172200 3300037068 Bacteria 1709
306 Ga0373925_0229512 3300037068 Bacteria 1484
307 Ga0373925_0515959 3300037068 Bacteria 982
308 Ga0436364_0539899 3300037853 Bacteria 986
309 Ga0436364_0612043 3300037853 Bacteria 326330
310 Ga0453684_0609134 3300044712 Bacteria 1196
311 Ga0466957_0036036 3300044842 Bacteria 2972
312 Ga0466967_0188967 3300045976 Bacteria 1946
313 Ga0466967_0309429 3300045976 Bacteria 1521
314 Ga0495629_0260525 3300046459 Bacteria 1192
315 Ga0495651_0014467 3300046462 Bacteria 6097
316 Ga0495651_0185852 3300046462 Bacteria 1467
317 Ga0495653_0231883 3300046463 Bacteria 1235
318 Ga0495580_0001300 3300046472 Bacteria 22053
319 Ga0495580_0024367 3300046472 Bacteria 4431
320 Ga0495580_0417011 3300046472 Bacteria 904
321 Ga0495582_0380439 3300046473 Bacteria 813
322 Ga0495662_0146499 3300046476 Bacteria 1163
323 Ga0495630_0511896 3300046517 Bacteria 920
324 Ga0495666_0096833 3300046526 Bacteria 1391
325 Ga0495665_0059889 3300046531 Bacteria 2010
326 Ga0495640_0258906 3300046533 Bacteria 1088
327 Ga0495587_0375487 3300046536 Bacteria 791
328 Ga0495667_0015914 3300046559 Bacteria 5084
329 Ga0495635_0055147 3300046663 Bacteria 2738
330 Ga0495657_0154378 3300046675 Bacteria 1424
331 Ga0495623_0002615 3300046679 Bacteria 11872
332 Ga0495613_0088912 3300046689 Bacteria 2238
333 Ga0495613_0169354 3300046689 Bacteria 1551
334 Ga0495624_0285688 3300046690 Bacteria 996
335 Ga0495604_0051322 3300047317 Bacteria 3198
336 Ga0495636_0066249 3300047318 Bacteria 1535
337 Ga0495636_0398936 3300047318 Bacteria 655
338 Ga0495674_0110761 3300047319 Bacteria 2328
339 Ga0495674_0153060 3300047319 Bacteria 1933
340 Ga0495676_0362605 3300047321 Bacteria 967
341 Ga0495680_0207489 3300047322 Bacteria 1404
342 Ga0495680_0501935 3300047322 Bacteria 823
343 Ga0495675_0011275 3300047444 Bacteria 5608
344 Ga0495675_0158279 3300047444 Bacteria 1396
345 Ga0495684_0000911 3300047471 Bacteria 24040
346 Ga0495684_0007338 3300047471 Bacteria 8543
347 Ga0495684_0050825 3300047471 Bacteria 3164
348 Ga0495602_0045715 3300048088 Bacteria 3960
349 Ga0495602_0145604 3300048088 Bacteria 1870
350 Ga0495602_0321908 3300048088 Bacteria 1125
351 Ga0495602_0450231 3300048088 Bacteria 909
352 Ga0495614_0097119 3300048089 Bacteria 1285
353 Ga0496102_0066414 3300048905 Unclassified 3306
354 Ga0496104_0249601 3300048907 Unclassified 1687
355 Ga0496108_0055710 3300048911 Unclassified 3321
356 Ga0496112_0022642 3300048915 Bacteria 5991
357 Ga0496112_0109185 3300048915 Bacteria 2737
358 Ga0496112_0571127 3300048915 Bacteria 1064
359 Ga0496112_0810983 3300048915 Bacteria 860
360 Ga0496113_0124432 3300048916 Unclassified 2019
361 Ga0501292_023940 3300049515 Bacteria 1000
362 Ga0501296_002893 3300049519 Bacteria 1820
363 Ga0501300_009880 3300049523 Bacteria 1390
364 Ga0501031_0000875 3300049568 Bacteria 18129
365 Ga0501031_0285318 3300049568 Bacteria 1071
366 Ga0501032_0003251 3300049569 Bacteria 12499
367 Ga0501033_0009735 3300049570 Bacteria 7386
368 Ga0501034_0019408 3300049571 Bacteria 6952
369 Ga0501036_0000743 3300049572 Bacteria 24114
370 Ga0501037_0004147 3300049573 Bacteria 10511
371 Ga0501038_0001107 3300049574 Bacteria 24411
372 Ga0501039_0046508 3300049575 Bacteria 3352
373 Ga0501043_0000476 3300049579 Bacteria 35781
374 Ga0501046_0001462 3300049580 Bacteria 22645
375 Ga0501047_0015064 3300049581 Bacteria 7358
376 Ga0501048_0027782 3300049582 Bacteria 4108
377 Ga0501067_0003587 3300049583 Bacteria 8549
378 Ga0501068_0000437 3300049584 Bacteria 21180
379 Ga0501069_0003025 3300049585 Bacteria 8643
380 Ga0501070_0023715 3300049586 Bacteria 5141
381 Ga0501072_0086748 3300049588 Bacteria 2483
382 Ga0501072_0391155 3300049588 Bacteria 1103
383 Ga0501073_0002493 3300049589 Bacteria 13744
384 Ga0501074_0007514 3300049590 Bacteria 7886
385 Ga0501077_0006587 3300049593 Bacteria 7131
386 Ga0501198_028477 3300049649 Bacteria 922
387 Ga0501206_009148 3300049653 Bacteria 1315
388 Ga0501207_015248 3300049654 Bacteria 1181
389 Ga0501209_022666 3300049656 Bacteria 1508
390 Ga0501224_005195 3300049664 Bacteria 1861
391 Ga0501233_072046 3300049668 Bacteria 877
392 Ga0501235_023718 3300049669 Bacteria 1369
393 Ga0501256_004605 3300049685 Bacteria 1191
394 Ga0501225_0101948 3300049705 Bacteria 839
395 Ga0501245_011367 3300049708 Bacteria 1294
396 Ga0501079_0017223 3300049741 Bacteria 5516
397 Ga0501080_0000282 3300049742 Bacteria 38365
398 Ga0501083_0030298 3300049744 Bacteria 3717
399 Ga0501270_008058 3300049767 Bacteria 1323
400 Ga0501044_0313934 3300049823 Bacteria 1493
401 Ga0501212_010550 3300049851 Bacteria 1319
402 Ga0501212_032140 3300049851 Bacteria 849
403 nmdc:mga05p37_1163690_c1 3300050507 Bacteria 801
404 nmdc:mga05p37_142391_c1 3300050507 Bacteria 2937
405 nmdc:mga05p37_177198_c1 3300050507 Bacteria 2596
406 nmdc:mga05p37_498563_c1 3300050507 Bacteria 1398
407 nmdc:mga0qj67_397103_c1 3300050509 Bacteria 1113
408 nmdc:mga06r32_243081_c1 3300050510 Bacteria 1787
409 nmdc:mga08y16_141326_c1 3300050511 Bacteria 2503
410 nmdc:mga08y16_66796_c1 3300050511 Bacteria 3753
411 nmdc:mga0n895_776334_c1 3300050512 Bacteria 950
412 nmdc:mga0a205_367041_c1 3300050515 Bacteria 1306
413 Ga0501084_0007747 3300054114 Bacteria 8840
414 Ga0501082_0000225 3300060353 Bacteria 49244
415 Ga0501082_0004868 3300060353 Bacteria 11714
416 Ga0530510_0373091 3300061734 Bacteria 1073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0207489 Ga0495680_0207489_504_1136 200
2 3300047318 Ga0495636_0398936 Ga0495636_0398936_20_643 207
3 3300035171 Ga0373946_0130995 Ga0373946_0130995_486_1130 214
4 3300025917 Ga0207660_10405787 Ga0207660_104057871 215
5 3300026121 Ga0207683_10549904 Ga0207683_105499042 216
6 3300009094 Ga0111539_10027916 Ga0111539_100279162 221
7 3300049568 Ga0501031_0285318 Ga0501031_0285318_161_826 221
8 3300050507 nmdc:mga05p37_1163690_c1 nmdc:mga05p37_1163690_c1_18_683 221
9 3300050511 nmdc:mga08y16_141326_c1 nmdc:mga08y16_141326_c1_738_1403 221
10 3300021388 Ga0213875_10000002 Ga0213875_1000000245 222
11 3300037853 Ga0436364_0612043 Ga0436364_0612043_41129_41854 222
12 3300014325 Ga0163163_10599287 Ga0163163_105992871 224
13 3300005339 Ga0070660_100065719 Ga0070660_1000657192 225
14 3300005366 Ga0070659_100036966 Ga0070659_1000369662 225
15 3300005439 Ga0070711_100032593 Ga0070711_1000325933 225
16 3300005539 Ga0068853_100066967 Ga0068853_1000669672 225
17 3300005563 Ga0068855_100082013 Ga0068855_1000820132 225
18 3300005564 Ga0070664_100061113 Ga0070664_1000611133 225
19 3300005614 Ga0068856_100010676 Ga0068856_1000106762 225
20 3300006358 Ga0068871_100149693 Ga0068871_1001496932 225
21 3300013102 Ga0157371_10015638 Ga0157371_100156384 225
22 3300013105 Ga0157369_10001852 Ga0157369_1000185229 225
23 3300013105 Ga0157369_10056093 Ga0157369_100560933 225
24 3300013296 Ga0157374_10034682 Ga0157374_100346824 225
25 3300013296 Ga0157374_10089373 Ga0157374_100893732 225
26 3300013307 Ga0157372_10761002 Ga0157372_107610021 225
27 3300025919 Ga0207657_10094198 Ga0207657_100941982 225
28 3300025933 Ga0207706_10329125 Ga0207706_103291252 225
29 3300025945 Ga0207679_10042414 Ga0207679_100424143 225
30 3300025949 Ga0207667_10066917 Ga0207667_100669173 225
31 3300025949 Ga0207667_10781638 Ga0207667_107816381 225
32 3300026041 Ga0207639_10049927 Ga0207639_100499272 225
33 3300026078 Ga0207702_10012871 Ga0207702_100128711 225
34 3300026142 Ga0207698_10065537 Ga0207698_100655372 225
35 3300028800 Ga0265338_10605834 Ga0265338_106058341 225
36 3300031344 Ga0265316_10007652 Ga0265316_100076527 225
37 3300031712 Ga0265342_10193168 Ga0265342_101931682 225
38 3300047321 Ga0495676_0362605 Ga0495676_0362605_60_803 225
39 3300048915 Ga0496112_0022642 Ga0496112_0022642_3332_4072 225
40 3300006237 Ga0097621_100795733 Ga0097621_1007957331 226
41 3300009176 Ga0105242_10569939 Ga0105242_105699392 226
42 3300025903 Ga0207680_10529647 Ga0207680_105296471 226
43 3300049515 Ga0501292_023940 Ga0501292_023940_133_813 226
44 3300049519 Ga0501296_002893 Ga0501296_002893_865_1545 226
45 3300049523 Ga0501300_009880 Ga0501300_009880_13_693 226
46 3300049649 Ga0501198_028477 Ga0501198_028477_194_874 226
47 3300049653 Ga0501206_009148 Ga0501206_009148_126_806 226
48 3300049654 Ga0501207_015248 Ga0501207_015248_393_1073 226
49 3300049656 Ga0501209_022666 Ga0501209_022666_393_1073 226
50 3300049664 Ga0501224_005195 Ga0501224_005195_117_797 226
51 3300049668 Ga0501233_072046 Ga0501233_072046_14_694 226
52 3300049669 Ga0501235_023718 Ga0501235_023718_290_970 226
53 3300049685 Ga0501256_004605 Ga0501256_004605_252_932 226
54 3300049705 Ga0501225_0101948 Ga0501225_0101948_115_795 226
55 3300049708 Ga0501245_011367 Ga0501245_011367_142_822 226
56 3300049851 Ga0501212_010550 Ga0501212_010550_442_1122 226
57 3300049851 Ga0501212_032140 Ga0501212_032140_23_703 226
58 3300005445 Ga0070708_100014735 Ga0070708_1000147352 227
59 3300005467 Ga0070706_100011269 Ga0070706_1000112695 227
60 3300005471 Ga0070698_100023113 Ga0070698_1000231132 227
61 3300005518 Ga0070699_100009891 Ga0070699_1000098917 227
62 3300005536 Ga0070697_100038801 Ga0070697_1000388013 227
63 3300005548 Ga0070665_100465080 Ga0070665_1004650802 227
64 3300025910 Ga0207684_10003628 Ga0207684_100036286 227
65 3300026035 Ga0207703_10609175 Ga0207703_106091751 227
66 3300028379 Ga0268266_10236081 Ga0268266_102360812 227
67 3300031595 Ga0265313_10074746 Ga0265313_100747462 227
68 3300005329 Ga0070683_100124934 Ga0070683_1001249342 228
69 3300005615 Ga0070702_100476042 Ga0070702_1004760421 228
70 3300005841 Ga0068863_100027355 Ga0068863_1000273553 228
71 3300005842 Ga0068858_100327454 Ga0068858_1003274542 228
72 3300006358 Ga0068871_100145736 Ga0068871_1001457362 228
73 3300009093 Ga0105240_10262754 Ga0105240_102627542 228
74 3300009147 Ga0114129_11093096 Ga0114129_110930962 228
75 3300009174 Ga0105241_10187829 Ga0105241_101878292 228
76 3300009545 Ga0105237_10439182 Ga0105237_104391822 228
77 3300013100 Ga0157373_10007604 Ga0157373_100076043 228
78 3300013105 Ga0157369_10473397 Ga0157369_104733972 228
79 3300013296 Ga0157374_10193898 Ga0157374_101938982 228
80 3300013306 Ga0163162_10468971 Ga0163162_104689712 228
81 3300013307 Ga0157372_10290644 Ga0157372_102906441 228
82 3300013308 Ga0157375_10199301 Ga0157375_101993012 228
83 3300014745 Ga0157377_10322497 Ga0157377_103224972 228
84 3300014969 Ga0157376_10019928 Ga0157376_100199283 228
85 3300025908 Ga0207643_10321112 Ga0207643_103211121 228
86 3300025913 Ga0207695_10319160 Ga0207695_103191602 228
87 3300025960 Ga0207651_10275607 Ga0207651_102756072 228
88 3300025986 Ga0207658_10748829 Ga0207658_107488291 228
89 3300026035 Ga0207703_10130548 Ga0207703_101305483 228
90 3300026088 Ga0207641_10084321 Ga0207641_100843213 228
91 3300031344 Ga0265316_10038611 Ga0265316_100386111 228
92 3300035083 Ga0373926_0096367 Ga0373926_0096367_289_975 228
93 3300035118 Ga0373954_0170774 Ga0373954_0170774_20_706 228
94 3300044842 Ga0466957_0036036 Ga0466957_0036036_379_1113 228
95 3300045976 Ga0466967_0188967 Ga0466967_0188967_36_746 228
96 3300046459 Ga0495629_0260525 Ga0495629_0260525_318_1004 228
97 3300046462 Ga0495651_0014467 Ga0495651_0014467_1690_2376 228
98 3300046473 Ga0495582_0380439 Ga0495582_0380439_116_802 228
99 3300046476 Ga0495662_0146499 Ga0495662_0146499_234_920 228
100 3300046517 Ga0495630_0511896 Ga0495630_0511896_35_721 228
101 3300046526 Ga0495666_0096833 Ga0495666_0096833_539_1225 228
102 3300046531 Ga0495665_0059889 Ga0495665_0059889_721_1407 228
103 3300046533 Ga0495640_0258906 Ga0495640_0258906_117_803 228
104 3300046559 Ga0495667_0015914 Ga0495667_0015914_2901_3587 228
105 3300046663 Ga0495635_0055147 Ga0495635_0055147_51_737 228
106 3300046679 Ga0495623_0002615 Ga0495623_0002615_6592_7278 228
107 3300046689 Ga0495613_0088912 Ga0495613_0088912_93_779 228
108 3300046690 Ga0495624_0285688 Ga0495624_0285688_161_847 228
109 3300047317 Ga0495604_0051322 Ga0495604_0051322_1262_1948 228
110 3300047319 Ga0495674_0153060 Ga0495674_0153060_967_1653 228
111 3300047444 Ga0495675_0011275 Ga0495675_0011275_987_1673 228
112 3300047444 Ga0495675_0158279 Ga0495675_0158279_279_965 228
113 3300047471 Ga0495684_0000911 Ga0495684_0000911_11921_12607 228
114 3300047471 Ga0495684_0050825 Ga0495684_0050825_626_1312 228
115 3300048088 Ga0495602_0045715 Ga0495602_0045715_2425_3111 228
116 3300048088 Ga0495602_0450231 Ga0495602_0450231_30_716 228
117 3300048089 Ga0495614_0097119 Ga0495614_0097119_10_696 228
118 3300050510 nmdc:mga06r32_243081_c1 nmdc:mga06r32_243081_c1_913_1599 228
119 3300005329 Ga0070683_100000002 Ga0070683_100000002120 229
120 3300005467 Ga0070706_100454023 Ga0070706_1004540232 229
121 3300005535 Ga0070684_100000007 Ga0070684_100000007120 229
122 3300006844 Ga0075428_100488894 Ga0075428_1004888942 229
123 3300006852 Ga0075433_10365132 Ga0075433_103651322 229
124 3300007076 Ga0075435_100734886 Ga0075435_1007348862 229
125 3300009093 Ga0105240_10056908 Ga0105240_100569084 229
126 3300009177 Ga0105248_10667115 Ga0105248_106671152 229
127 3300009545 Ga0105237_10032632 Ga0105237_100326324 229
128 3300009551 Ga0105238_10288833 Ga0105238_102888332 229
129 3300010375 Ga0105239_10138612 Ga0105239_101386122 229
130 3300025910 Ga0207684_10735996 Ga0207684_107359961 229
131 3300025913 Ga0207695_10052677 Ga0207695_100526773 229
132 3300025914 Ga0207671_10184242 Ga0207671_101842422 229
133 3300025917 Ga0207660_10466888 Ga0207660_104668882 229
134 3300025944 Ga0207661_10000003 Ga0207661_10000003118 229
135 3300026035 Ga0207703_10662161 Ga0207703_106621612 229
136 3300035118 Ga0373954_0250306 Ga0373954_0250306_40_729 229
137 3300035724 Ga0373933_0237831 Ga0373933_0237831_194_883 229
138 3300036401 Ga0373937_0251912 Ga0373937_0251912_474_1163 229
139 3300050512 nmdc:mga0n895_776334_c1 nmdc:mga0n895_776334_c1_13_702 229
140 3300050515 nmdc:mga0a205_367041_c1 nmdc:mga0a205_367041_c1_206_895 229
141 3300060353 Ga0501082_0000225 Ga0501082_0000225_34112_34801 229
142 3300005293 Ga0065715_10104687 Ga0065715_101046872 230
143 3300005334 Ga0068869_100063627 Ga0068869_1000636272 230
144 3300005340 Ga0070689_100071889 Ga0070689_1000718892 230
145 3300005344 Ga0070661_100165001 Ga0070661_1001650012 230
146 3300005355 Ga0070671_100029974 Ga0070671_1000299743 230
147 3300005367 Ga0070667_100142217 Ga0070667_1001422172 230
148 3300005564 Ga0070664_100021643 Ga0070664_1000216432 230
149 3300005614 Ga0068856_100040824 Ga0068856_1000408241 230
150 3300005618 Ga0068864_100000961 Ga0068864_10000096117 230
151 3300005840 Ga0068870_10256513 Ga0068870_102565131 230
152 3300005842 Ga0068858_100016740 Ga0068858_1000167402 230
153 3300006358 Ga0068871_100003106 Ga0068871_1000031063 230
154 3300006880 Ga0075429_100175921 Ga0075429_1001759212 230
155 3300009177 Ga0105248_10011822 Ga0105248_100118225 230
156 3300010375 Ga0105239_10116206 Ga0105239_101162062 230
157 3300013296 Ga0157374_10004256 Ga0157374_100042569 230
158 3300013297 Ga0157378_10001387 Ga0157378_100013878 230
159 3300013306 Ga0163162_10000831 Ga0163162_100008315 230
160 3300013307 Ga0157372_10928090 Ga0157372_109280902 230
161 3300013308 Ga0157375_10236499 Ga0157375_102364992 230
162 3300013308 Ga0157375_10922040 Ga0157375_109220401 230
163 3300014325 Ga0163163_10004845 Ga0163163_100048457 230
164 3300014969 Ga0157376_10010721 Ga0157376_100107212 230
165 3300025903 Ga0207680_10170228 Ga0207680_101702282 230
166 3300025914 Ga0207671_10106963 Ga0207671_101069632 230
167 3300025927 Ga0207687_10418682 Ga0207687_104186821 230
168 3300025931 Ga0207644_10012818 Ga0207644_100128184 230
169 3300025931 Ga0207644_10077494 Ga0207644_100774943 230
170 3300025934 Ga0207686_10218567 Ga0207686_102185672 230
171 3300025941 Ga0207711_10006345 Ga0207711_100063456 230
172 3300025942 Ga0207689_10218594 Ga0207689_102185942 230
173 3300025960 Ga0207651_10045879 Ga0207651_100458792 230
174 3300025986 Ga0207658_10114933 Ga0207658_101149331 230
175 3300026023 Ga0207677_10010497 Ga0207677_100104972 230
176 3300026035 Ga0207703_10033032 Ga0207703_100330322 230
177 3300026041 Ga0207639_10064226 Ga0207639_100642261 230
178 3300026078 Ga0207702_10171986 Ga0207702_101719861 230
179 3300026088 Ga0207641_10154654 Ga0207641_101546542 230
180 3300026095 Ga0207676_10005697 Ga0207676_100056973 230
181 3300048905 Ga0496102_0066414 Ga0496102_0066414_2573_3265 230
182 3300048907 Ga0496104_0249601 Ga0496104_0249601_951_1643 230
183 3300048911 Ga0496108_0055710 Ga0496108_0055710_988_1680 230
184 3300048915 Ga0496112_0571127 Ga0496112_0571127_97_789 230
185 3300048916 Ga0496113_0124432 Ga0496113_0124432_272_964 230
186 3300000532 CNAas_1002007 CNAas_10020071 231
187 3300005289 Ga0065704_10097922 Ga0065704_100979223 231
188 3300005293 Ga0065715_10189567 Ga0065715_101895671 231
189 3300005293 Ga0065715_10389864 Ga0065715_103898641 231
190 3300005295 Ga0065707_10088334 Ga0065707_100883342 231
191 3300005295 Ga0065707_10264160 Ga0065707_102641602 231
192 3300005328 Ga0070676_10392053 Ga0070676_103920531 231
193 3300005334 Ga0068869_100328763 Ga0068869_1003287632 231
194 3300005336 Ga0070680_100124293 Ga0070680_1001242933 231
195 3300005364 Ga0070673_100036057 Ga0070673_1000360573 231
196 3300005367 Ga0070667_100257923 Ga0070667_1002579232 231
197 3300005441 Ga0070700_100000548 Ga0070700_1000005486 231
198 3300005444 Ga0070694_100017026 Ga0070694_1000170261 231
199 3300005445 Ga0070708_100116271 Ga0070708_1001162712 231
200 3300005445 Ga0070708_100177349 Ga0070708_1001773492 231
201 3300005457 Ga0070662_100033961 Ga0070662_1000339613 231
202 3300005459 Ga0068867_100070105 Ga0068867_1000701052 231
203 3300005459 Ga0068867_100101868 Ga0068867_1001018683 231
204 3300005467 Ga0070706_100017311 Ga0070706_1000173112 231
205 3300005468 Ga0070707_100000920 Ga0070707_10000092013 231
206 3300005471 Ga0070698_100004327 Ga0070698_1000043273 231
207 3300005471 Ga0070698_100046268 Ga0070698_1000462683 231
208 3300005471 Ga0070698_100143887 Ga0070698_1001438871 231
209 3300005518 Ga0070699_100010793 Ga0070699_1000107932 231
210 3300005518 Ga0070699_100049729 Ga0070699_1000497293 231
211 3300005545 Ga0070695_100039027 Ga0070695_1000390273 231
212 3300005546 Ga0070696_100059679 Ga0070696_1000596792 231
213 3300005546 Ga0070696_100075650 Ga0070696_1000756502 231
214 3300005549 Ga0070704_100031625 Ga0070704_1000316252 231
215 3300005617 Ga0068859_100038977 Ga0068859_1000389774 231
216 3300005719 Ga0068861_100273115 Ga0068861_1002731152 231
217 3300005843 Ga0068860_100172196 Ga0068860_1001721962 231
218 3300005844 Ga0068862_100018536 Ga0068862_1000185362 231
219 3300005844 Ga0068862_100043681 Ga0068862_1000436814 231
220 3300006844 Ga0075428_100498604 Ga0075428_1004986041 231
221 3300006931 Ga0097620_100038975 Ga0097620_1000389754 231
222 3300009147 Ga0114129_10029556 Ga0114129_100295567 231
223 3300009147 Ga0114129_10204496 Ga0114129_102044961 231
224 3300009553 Ga0105249_10015582 Ga0105249_100155826 231
225 3300011119 Ga0105246_10096108 Ga0105246_100961082 231
226 3300013297 Ga0157378_10060366 Ga0157378_100603662 231
227 3300013306 Ga0163162_10129637 Ga0163162_101296371 231
228 3300013308 Ga0157375_10015816 Ga0157375_100158167 231
229 3300013308 Ga0157375_10050242 Ga0157375_100502423 231
230 3300014325 Ga0163163_10033385 Ga0163163_100333854 231
231 3300014326 Ga0157380_10012265 Ga0157380_100122654 231
232 3300015262 Ga0182007_10161146 Ga0182007_101611461 231
233 3300025901 Ga0207688_10406859 Ga0207688_104068591 231
234 3300025907 Ga0207645_10454322 Ga0207645_104543221 231
235 3300025917 Ga0207660_10322182 Ga0207660_103221821 231
236 3300025922 Ga0207646_10000916 Ga0207646_1000091619 231
237 3300025922 Ga0207646_10009381 Ga0207646_100093813 231
238 3300025922 Ga0207646_10052905 Ga0207646_100529052 231
239 3300025923 Ga0207681_10003696 Ga0207681_100036966 231
240 3300025923 Ga0207681_10272703 Ga0207681_102727031 231
241 3300025942 Ga0207689_10037425 Ga0207689_100374254 231
242 3300025960 Ga0207651_10012629 Ga0207651_100126292 231
243 3300026035 Ga0207703_10706512 Ga0207703_107065121 231
244 3300026075 Ga0207708_10001715 Ga0207708_100017154 231
245 3300026075 Ga0207708_10125438 Ga0207708_101254383 231
246 3300026089 Ga0207648_10076146 Ga0207648_100761462 231
247 3300026089 Ga0207648_10122782 Ga0207648_101227822 231
248 3300026118 Ga0207675_100086578 Ga0207675_1000865782 231
249 3300026118 Ga0207675_100248523 Ga0207675_1002485232 231
250 3300027907 Ga0207428_10128680 Ga0207428_101286802 231
251 3300028380 Ga0268265_10220764 Ga0268265_102207641 231
252 3300028381 Ga0268264_10285411 Ga0268264_102854112 231
253 3300032002 Ga0307416_100455645 Ga0307416_1004556452 231
254 3300046472 Ga0495580_0417011 Ga0495580_0417011_88_783 231
255 3300047318 Ga0495636_0066249 Ga0495636_0066249_563_1258 231
256 3300049588 Ga0501072_0391155 Ga0501072_0391155_88_786 231
257 3300050507 nmdc:mga05p37_142391_c1 nmdc:mga05p37_142391_c1_1286_2002 231
258 3300050507 nmdc:mga05p37_498563_c1 nmdc:mga05p37_498563_c1_237_950 231
259 3300050511 nmdc:mga08y16_66796_c1 nmdc:mga08y16_66796_c1_563_1258 231
260 3300061734 Ga0530510_0373091 Ga0530510_0373091_39_737 231
261 3300005353 Ga0070669_100468837 Ga0070669_1004688371 232
262 3300005467 Ga0070706_100081349 Ga0070706_1000813492 232
263 3300005518 Ga0070699_100040849 Ga0070699_1000408492 232
264 3300005546 Ga0070696_100004095 Ga0070696_1000040959 232
265 3300005577 Ga0068857_100885310 Ga0068857_1008853101 232
266 3300005842 Ga0068858_100356620 Ga0068858_1003566202 232
267 3300005937 Ga0081455_10107179 Ga0081455_101071793 232
268 3300005985 Ga0081539_10003712 Ga0081539_1000371210 232
269 3300006358 Ga0068871_100233763 Ga0068871_1002337633 232
270 3300006847 Ga0075431_100654173 Ga0075431_1006541732 232
271 3300009147 Ga0114129_10034459 Ga0114129_100344597 232
272 3300009174 Ga0105241_10172152 Ga0105241_101721522 232
273 3300009177 Ga0105248_10127416 Ga0105248_101274163 232
274 3300013297 Ga0157378_10059779 Ga0157378_100597792 232
275 3300014969 Ga0157376_10283433 Ga0157376_102834332 232
276 3300025925 Ga0207650_10180757 Ga0207650_101807572 232
277 3300025942 Ga0207689_10592369 Ga0207689_105923692 232
278 3300026035 Ga0207703_10373835 Ga0207703_103738352 232
279 3300026089 Ga0207648_10617279 Ga0207648_106172791 232
280 3300031250 Ga0265331_10237697 Ga0265331_102376971 232
281 3300048915 Ga0496112_0810983 Ga0496112_0810983_127_825 232
282 3300050507 nmdc:mga05p37_177198_c1 nmdc:mga05p37_177198_c1_639_1337 232
283 3300006237 Ga0097621_100505734 Ga0097621_1005057342 233
284 3300009174 Ga0105241_10640738 Ga0105241_106407382 233
285 3300031344 Ga0265316_10013591 Ga0265316_100135914 233
286 3300031711 Ga0265314_10045147 Ga0265314_100451472 233
287 3300036401 Ga0373937_0328812 Ga0373937_0328812_233_940 233
288 3300037068 Ga0373925_0515959 Ga0373925_0515959_176_883 233
289 3300046536 Ga0495587_0375487 Ga0495587_0375487_13_720 233
290 3300003203 JGI25406J46586_10007090 JGI25406J46586_100070901 234
291 3300005985 Ga0081539_10000407 Ga0081539_1000040726 234
292 3300005468 Ga0070707_100498743 Ga0070707_1004987432 235
293 3300005617 Ga0068859_100412796 Ga0068859_1004127962 235
294 3300006931 Ga0097620_100412840 Ga0097620_1004128402 235
295 3300009177 Ga0105248_10230822 Ga0105248_102308222 235
296 3300011119 Ga0105246_10067306 Ga0105246_100673064 235
297 3300013297 Ga0157378_10500612 Ga0157378_105006122 235
298 3300025941 Ga0207711_10070179 Ga0207711_100701793 235
299 3300035083 Ga0373926_0003584 Ga0373926_0003584_2439_3152 235
300 3300035117 Ga0373953_0240239 Ga0373953_0240239_13_726 235
301 3300035118 Ga0373954_0019745 Ga0373954_0019745_2272_2985 235
302 3300035119 Ga0373956_0053454 Ga0373956_0053454_10_723 235
303 3300035692 Ga0373935_0067721 Ga0373935_0067721_846_1559 235
304 3300035692 Ga0373935_0491783 Ga0373935_0491783_144_857 235
305 3300035695 Ga0373927_0003509 Ga0373927_0003509_2235_2948 235
306 3300035695 Ga0373927_0005216 Ga0373927_0005216_338_1051 235
307 3300037068 Ga0373925_0229512 Ga0373925_0229512_494_1207 235
308 3300046472 Ga0495580_0001300 Ga0495580_0001300_7422_8135 235
309 3300046689 Ga0495613_0169354 Ga0495613_0169354_785_1498 235
310 3300047471 Ga0495684_0007338 Ga0495684_0007338_1163_1876 235
311 3300048088 Ga0495602_0145604 Ga0495602_0145604_976_1689 235
312 3300005290 Ga0065712_10105225 Ga0065712_101052252 236
313 3300005518 Ga0070699_100003025 Ga0070699_1000030255 236
314 3300005618 Ga0068864_100640119 Ga0068864_1006401191 236
315 3300013308 Ga0157375_10118717 Ga0157375_101187172 236
316 3300025945 Ga0207679_10510938 Ga0207679_105109382 236
317 3300044712 Ga0453684_0609134 Ga0453684_0609134_288_1004 236
318 3300005367 Ga0070667_100202896 Ga0070667_1002028962 237
319 3300005435 Ga0070714_100001305 Ga0070714_1000013051 237
320 3300005439 Ga0070711_100048962 Ga0070711_1000489623 237
321 3300006028 Ga0070717_10011885 Ga0070717_100118856 237
322 3300006028 Ga0070717_10822396 Ga0070717_108223961 237
323 3300006175 Ga0070712_100154864 Ga0070712_1001548642 237
324 3300009545 Ga0105237_10091327 Ga0105237_100913272 237
325 3300009551 Ga0105238_10023576 Ga0105238_100235764 237
326 3300025913 Ga0207695_10089092 Ga0207695_100890922 237
327 3300025915 Ga0207693_10050691 Ga0207693_100506914 237
328 3300025916 Ga0207663_10066855 Ga0207663_100668552 237
329 3300025928 Ga0207700_10001943 Ga0207700_100019437 237
330 3300025929 Ga0207664_10003712 Ga0207664_100037127 237
331 3300031241 Ga0265325_10033272 Ga0265325_100332721 237
332 3300035111 Ga0373923_0053745 Ga0373923_0053745_320_1039 237
333 3300035692 Ga0373935_0087978 Ga0373935_0087978_215_934 237
334 3300035725 Ga0373947_0012893 Ga0373947_0012893_3308_4027 237
335 3300036401 Ga0373937_0151521 Ga0373937_0151521_965_1684 237
336 3300037068 Ga0373925_0172200 Ga0373925_0172200_122_841 237
337 3300037853 Ga0436364_0539899 Ga0436364_0539899_143_862 237
338 3300045976 Ga0466967_0309429 Ga0466967_0309429_657_1376 237
339 3300048915 Ga0496112_0109185 Ga0496112_0109185_695_1408 237
340 3300049568 Ga0501031_0000875 Ga0501031_0000875_16615_17340 237
341 3300049569 Ga0501032_0003251 Ga0501032_0003251_2829_3554 237
342 3300049570 Ga0501033_0009735 Ga0501033_0009735_6356_7081 237
343 3300049571 Ga0501034_0019408 Ga0501034_0019408_795_1520 237
344 3300049572 Ga0501036_0000743 Ga0501036_0000743_12483_13208 237
345 3300049573 Ga0501037_0004147 Ga0501037_0004147_761_1486 237
346 3300049574 Ga0501038_0001107 Ga0501038_0001107_6483_7208 237
347 3300049575 Ga0501039_0046508 Ga0501039_0046508_2034_2759 237
348 3300049579 Ga0501043_0000476 Ga0501043_0000476_15899_16624 237
349 3300049580 Ga0501046_0001462 Ga0501046_0001462_6880_7605 237
350 3300049581 Ga0501047_0015064 Ga0501047_0015064_6171_6896 237
351 3300049582 Ga0501048_0027782 Ga0501048_0027782_2933_3658 237
352 3300049583 Ga0501067_0003587 Ga0501067_0003587_7647_8372 237
353 3300049584 Ga0501068_0000437 Ga0501068_0000437_14285_15010 237
354 3300049585 Ga0501069_0003025 Ga0501069_0003025_1187_1912 237
355 3300049586 Ga0501070_0023715 Ga0501070_0023715_795_1520 237
356 3300049588 Ga0501072_0086748 Ga0501072_0086748_1296_2021 237
357 3300049589 Ga0501073_0002493 Ga0501073_0002493_10779_11504 237
358 3300049590 Ga0501074_0007514 Ga0501074_0007514_463_1188 237
359 3300049593 Ga0501077_0006587 Ga0501077_0006587_2473_3198 237
360 3300049741 Ga0501079_0017223 Ga0501079_0017223_696_1421 237
361 3300049742 Ga0501080_0000282 Ga0501080_0000282_25030_25755 237
362 3300049744 Ga0501083_0030298 Ga0501083_0030298_178_903 237
363 3300049823 Ga0501044_0313934 Ga0501044_0313934_178_903 237
364 3300054114 Ga0501084_0007747 Ga0501084_0007747_7545_8270 237
365 3300060353 Ga0501082_0004868 Ga0501082_0004868_6019_6744 237
366 2162886012 MBSR1b_contig_9471297 MBSR1b_0044.00004980 238
367 3300005293 Ga0065715_10013551 Ga0065715_100135512 238
368 3300005338 Ga0068868_100269072 Ga0068868_1002690721 238
369 3300005340 Ga0070689_100437056 Ga0070689_1004370562 238
370 3300005343 Ga0070687_100013607 Ga0070687_1000136076 238
371 3300005457 Ga0070662_100134296 Ga0070662_1001342961 238
372 3300005468 Ga0070707_100000359 Ga0070707_1000003595 238
373 3300005518 Ga0070699_100191838 Ga0070699_1001918382 238
374 3300005616 Ga0068852_100657472 Ga0068852_1006574721 238
375 3300005617 Ga0068859_100573627 Ga0068859_1005736272 238
376 3300005842 Ga0068858_100075780 Ga0068858_1000757802 238
377 3300005843 Ga0068860_100175646 Ga0068860_1001756462 238
378 3300006881 Ga0068865_100050134 Ga0068865_1000501342 238
379 3300006931 Ga0097620_100573595 Ga0097620_1005735952 238
380 3300013306 Ga0163162_10216814 Ga0163162_102168142 238
381 3300014326 Ga0157380_10014188 Ga0157380_100141887 238
382 3300017792 Ga0163161_10093205 Ga0163161_100932052 238
383 3300025913 Ga0207695_10214352 Ga0207695_102143521 238
384 3300025918 Ga0207662_10018219 Ga0207662_100182192 238
385 3300025922 Ga0207646_10000651 Ga0207646_100006515 238
386 3300025933 Ga0207706_10123427 Ga0207706_101234272 238
387 3300025936 Ga0207670_10341353 Ga0207670_103413531 238
388 3300025942 Ga0207689_10181993 Ga0207689_101819932 238
389 3300025981 Ga0207640_10261866 Ga0207640_102618662 238
390 3300026035 Ga0207703_10144487 Ga0207703_101444871 238
391 3300026089 Ga0207648_10633250 Ga0207648_106332502 238
392 3300026118 Ga0207675_100207448 Ga0207675_1002074482 238
393 3300028380 Ga0268265_10111088 Ga0268265_101110882 238
394 3300028577 Ga0265318_10115294 Ga0265318_101152942 238
395 3300028800 Ga0265338_10023167 Ga0265338_100231674 238
396 3300029957 Ga0265324_10032334 Ga0265324_100323342 238
397 3300031238 Ga0265332_10008388 Ga0265332_100083884 238
398 3300031239 Ga0265328_10019235 Ga0265328_100192351 238
399 3300031240 Ga0265320_10002234 Ga0265320_1000223411 238
400 3300031241 Ga0265325_10006833 Ga0265325_100068334 238
401 3300031247 Ga0265340_10017207 Ga0265340_100172074 238
402 3300031249 Ga0265339_10046724 Ga0265339_100467241 238
403 3300031250 Ga0265331_10007533 Ga0265331_100075334 238
404 3300031344 Ga0265316_10017329 Ga0265316_100173293 238
405 3300031344 Ga0265316_10156927 Ga0265316_101569272 238
406 3300031712 Ga0265342_10033471 Ga0265342_100334713 238
407 3300032002 Ga0307416_100535600 Ga0307416_1005356002 238
408 3300046462 Ga0495651_0185852 Ga0495651_0185852_29_757 238
409 3300046463 Ga0495653_0231883 Ga0495653_0231883_436_1164 238
410 3300046472 Ga0495580_0024367 Ga0495580_0024367_439_1167 238
411 3300046675 Ga0495657_0154378 Ga0495657_0154378_165_893 238
412 3300047319 Ga0495674_0110761 Ga0495674_0110761_1572_2300 238
413 3300047322 Ga0495680_0501935 Ga0495680_0501935_50_778 238
414 3300048088 Ga0495602_0321908 Ga0495602_0321908_97_825 238
415 3300049767 Ga0501270_008058 Ga0501270_008058_556_1287 238
416 3300050509 nmdc:mga0qj67_397103_c1 nmdc:mga0qj67_397103_c1_179_904 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

25

174

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9721 6 225
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9672 5 225
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9664 3 224
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.966 2 225
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.959 3 227
ID Description Score Start End Superfamily
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9822 5 225 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9772 3 226 3.40.50.300
3tujC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9669 6 225 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 1 226 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9637 6 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382WIH5-F1-model_v4 ABC transporter domain-containing protein 0.9843 4 112 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A437SP63-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9828 71 225 GO:0005524
GO:0016887
AF-A0A522W8K2-F1-model_v4 ABC transporter ATP-binding protein 0.9815 1 225 GO:0005524
GO:0016887
AF-A0A661CYW9-F1-model_v4 ABC transporter domain-containing protein 0.9774 4 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A4U7CR65-F1-model_v4 ATP-binding cassette domain-containing protein 0.9769 6 85 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map