F438683

General Info

Members Datasets Scaffolds Average Seq Length
415 279 323 350

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221670|2644387158
Length 377
Sequence TSMSTRKMAAVALVAALGVTTLAACGTESGAKGEAGKTGKPVSKTVTLVSHDSFNASKEVLAEFTKQTGFTVKVLKAGDAGEAVNKEILTKGSPQGDVFFGVDNTLLSRALDNGIFVPYEAKGVDRIPAAYRLDKEQRVTPIDSGDICVNYDKKYFADKKLAPPQTFDDLAKPAYKDLLVVENPERSSPGLGFLLGTAAKYGDGGTSQGEASGGGWQGYWTKLKANGVKTVDSWELAYNQEFSGSAGGKQAKGDRPLVVSYASSPPVEVLYGEPQPKVAPTGVSTGTCFRQIEFAGLLNGAKNPEGGKALIDFLISKKFQDDMPLQMFVNPVAEDATLPELFTKHGVVVDKPETMAPEKIAEKRDPWIQQWSSLVLK

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221670 Streptomyces sp. Root431 Isolate Unclassified
12 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
13 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
14 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
15 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
16 2643221714 Streptomyces sp. Root264 Isolate Unclassified
17 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
18 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
19 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
20 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
21 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
22 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
23 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
24 2808606448 Streptomyces sp. 193411 Isolate Unclassified
25 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
26 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
27 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
28 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
29 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
30 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
31 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
32 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
33 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
34 2862574272 Streptomyces sp. AcE210 Isolate Nodule
35 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
36 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
37 2867369537 Streptomyces sp. Z26 Isolate Unclassified
38 2867428634 Streptomyces sp. RP5T Isolate Unclassified
39 2867475112 Streptomyces sp. TM32 Isolate Unclassified
40 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
41 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
42 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
43 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
44 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
45 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
46 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
47 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
48 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
49 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
50 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
51 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
52 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
53 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
54 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
55 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
56 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
57 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
58 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
59 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
60 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
61 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
62 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
63 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
64 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
65 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
66 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
67 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
68 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
69 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
70 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
71 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
72 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
73 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
74 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
75 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
139 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
262 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
263 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
264 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
265 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
266 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
267 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
268 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
269 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
270 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
271 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
272 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
273 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
274 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
275 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
276 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
277 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
278 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
279 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.59
Metatranscriptomes 0.24
Isolates 22.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0.48
Rhizoplane 1.2
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 15.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005168 3300001989 Bacteria 4970
2 rootH2_10048140 3300003320 Bacteria 3675
3 rootH2_10135553 3300003320 Bacteria 1804
4 rootH1_10026109 3300003323 Bacteria 3204
5 JGI25160J50197_1015558 3300003354 Bacteria 2492
6 Ga0070713_100239265 3300005436 Bacteria 1653
7 Ga0070708_100010463 3300005445 Bacteria 7521
8 Ga0070706_100008571 3300005467 Bacteria 9530
9 Ga0070707_100186597 3300005468 Bacteria 2022
10 Ga0070698_100015874 3300005471 Bacteria 7952
11 Ga0070698_100354549 3300005471 Bacteria 1399
12 Ga0070699_100037226 3300005518 Bacteria 4209
13 Ga0081455_10016857 3300005937 Bacteria 7025
14 Ga0081455_10060312 3300005937 Bacteria 3199
15 Ga0081539_10004154 3300005985 Bacteria 16448
16 Ga0075363_100010971 3300006048 Bacteria 4324
17 Ga0075363_100037163 3300006048 Bacteria 2557
18 Ga0075367_10008628 3300006178 Bacteria 5287
19 Ga0075428_100078727 3300006844 Bacteria 3598
20 Ga0075428_100097472 3300006844 Bacteria 3205
21 Ga0075428_100354516 3300006844 Bacteria 1574
22 Ga0075431_100024501 3300006847 Bacteria 6184
23 Ga0075431_100336122 3300006847 Bacteria 1520
24 Ga0075434_100021649 3300006871 Bacteria 6252
25 Ga0075429_100281858 3300006880 Bacteria 1455
26 Ga0075436_100045505 3300006914 Bacteria 3027
27 Ga0075435_100004385 3300007076 Bacteria 9686
28 Ga0105251_10014786 3300009011 Bacteria 4295
29 Ga0111539_10548689 3300009094 Bacteria 1346
30 Ga0114129_10248313 3300009147 Bacteria 2390
31 Ga0105246_10020630 3300011119 Bacteria 4229
32 Ga0182008_10000192 3300014497 Bacteria 48269
33 Ga0182007_10000449 3300015262 Bacteria 24937
34 Ga0183367_1013 3300015688 Bacteria 334176
35 Ga0207426_1002296 3300025302 Bacteria 12608
36 Ga0207426_1003628 3300025302 Bacteria 8172
37 Ga0207713_1016215 3300025735 Bacteria 3791
38 Ga0207647_10040617 3300025904 Bacteria 2928
39 Ga0207646_10212484 3300025922 Bacteria 1747
40 Ga0207700_10101074 3300025928 Bacteria 2300
41 Ga0207639_10022902 3300026041 Bacteria 4505
42 Ga0209371_1005729 3300027312 Bacteria 4839
43 Ga0307517_10016670 3300028786 Bacteria 9637
44 Ga0307515_10003048 3300028794 Bacteria 35498
45 Ga0307515_10146900 3300028794 Bacteria 2491
46 Ga0268256_1009350 3300030500 Bacteria 3266
47 Ga0307511_10012189 3300030521 Bacteria 8443
48 Ga0307512_10002986 3300030522 Bacteria 20400
49 Ga0265327_10013638 3300031251 Bacteria 5384
50 Ga0307513_10020691 3300031456 Bacteria 7793
51 Ga0307509_10014720 3300031507 Bacteria 9175
52 Ga0307508_10005717 3300031616 Bacteria 11773
53 Ga0307508_10010818 3300031616 Bacteria 8345
54 Ga0307508_10047853 3300031616 Bacteria 3811
55 Ga0307514_10003971 3300031649 Bacteria 13818
56 Ga0307514_10040081 3300031649 Bacteria 3696
57 Ga0307514_10055685 3300031649 Bacteria 3038
58 Ga0307514_10069622 3300031649 Bacteria 2646
59 Ga0307516_10018764 3300031730 Bacteria 7182
60 Ga0307516_10038502 3300031730 Bacteria 4772
61 Ga0307416_100028303 3300032002 Bacteria 4165
62 Ga0307507_10012239 3300033179 Bacteria 10642
63 Ga0307507_10042360 3300033179 Bacteria 4539
64 Ga0307507_10078198 3300033179 Bacteria 2935
65 Ga0373947_0008189 3300035725 Bacteria 6028
66 Ga0395899_0143727 3300037312 Bacteria 1696
67 Ga0395898_0018786 3300037466 Bacteria 7044
68 Ga0395898_0026040 3300037466 Bacteria 5889
69 Ga0395898_0330591 3300037466 Bacteria 1453
70 Ga0395901_0153573 3300038443 Bacteria 2418
71 Ga0439436_0000779 3300041404 Bacteria 8637
72 Ga0439436_0006705 3300041404 Bacteria 3537
73 Ga0439439_0000740 3300041406 Bacteria 5874
74 Ga0451837_1486135 3300041494 Bacteria 3638
75 Ga0451841_1125641 3300041498 Bacteria 1979
76 Ga0451845_0032422 3300041501 Bacteria 1161
77 Ga0451853_0111687 3300041512 Bacteria 1670
78 Ga0451853_1737779 3300041512 Bacteria 1697
79 Ga0439433_0000155 3300041999 Bacteria 10576
80 Ga0439448_0014459 3300042005 Bacteria 2381
81 Ga0439432_036557 3300042006 Bacteria 1571
82 Ga0439449_0041959 3300042007 Bacteria 1701
83 Ga0439455_0002494 3300042012 Bacteria 3356
84 Ga0439457_001126 3300042014 Bacteria 8037
85 Ga0450894_000143 3300042131 Bacteria 12616
86 Ga0450899_001292 3300042135 Bacteria 2821
87 Ga0450903_000128 3300042138 Bacteria 16569
88 Ga0439458_0000458 3300042157 Bacteria 10343
89 Ga0450908_003256 3300042184 Bacteria 3164
90 Ga0466972_0001308 3300044658 Bacteria 12048
91 Ga0466972_0077564 3300044658 Bacteria 1582
92 Ga0466965_0007965 3300044683 Bacteria 4886
93 Ga0466965_0018546 3300044683 Bacteria 3337
94 Ga0466966_0010741 3300044684 Bacteria 6087
95 Ga0466966_0047910 3300044684 Bacteria 2723
96 Ga0466961_0003355 3300044693 Bacteria 9993
97 Ga0466961_0026388 3300044693 Bacteria 3735
98 Ga0466961_0063959 3300044693 Bacteria 2338
99 Ga0466963_0005535 3300044694 Bacteria 7395
100 Ga0466963_0062652 3300044694 Bacteria 2487
101 Ga0466971_0001020 3300044719 Bacteria 11572
102 Ga0466971_0047383 3300044719 Bacteria 1932
103 Ga0466968_0077432 3300044735 Bacteria 1457
104 Ga0466970_0000746 3300044765 Bacteria 15832
105 Ga0466970_0005955 3300044765 Bacteria 6077
106 Ga0466957_0007505 3300044842 Bacteria 6161
107 Ga0466960_0013926 3300044901 Bacteria 3427
108 Ga0466958_0001227 3300045836 Bacteria 12000
109 Ga0466967_0005732 3300045976 Bacteria 8667
110 Ga0466967_0095927 3300045976 Bacteria 2704
111 Ga0495592_0004769 3300046454 Bacteria 9954
112 Ga0495592_0065310 3300046454 Bacteria 2664
113 Ga0495603_0001314 3300046455 Bacteria 14437
114 Ga0495603_0003908 3300046455 Bacteria 8877
115 Ga0495603_0029091 3300046455 Bacteria 3332
116 Ga0495590_0016956 3300046457 Bacteria 2629
117 Ga0495629_0003712 3300046459 Bacteria 11506
118 Ga0495629_0014972 3300046459 Bacteria 5572
119 Ga0495629_0029940 3300046459 Bacteria 3859
120 Ga0495629_0033933 3300046459 Bacteria 3608
121 Ga0495629_0094987 3300046459 Bacteria 2080
122 Ga0495629_0104123 3300046459 Bacteria 1979
123 Ga0495638_0019639 3300046460 Bacteria 4470
124 Ga0495638_0157376 3300046460 Bacteria 1313
125 Ga0495641_0116204 3300046461 Bacteria 1193
126 Ga0495651_0005450 3300046462 Bacteria 9708
127 Ga0495651_0024390 3300046462 Bacteria 4706
128 Ga0495651_0046924 3300046462 Bacteria 3342
129 Ga0495653_0149628 3300046463 Bacteria 1633
130 Ga0495605_0007527 3300046474 Bacteria 6173
131 Ga0495605_0057507 3300046474 Bacteria 1871
132 Ga0495639_0023770 3300046475 Bacteria 2695
133 Ga0495662_0005303 3300046476 Bacteria 6460
134 Ga0495664_0025213 3300046477 Bacteria 3461
135 Ga0495664_0154876 3300046477 Bacteria 1390
136 Ga0495585_0031817 3300046492 Bacteria 2993
137 Ga0495594_0000934 3300046499 Bacteria 15119
138 Ga0495594_0003850 3300046499 Bacteria 7710
139 Ga0495594_0048328 3300046499 Bacteria 2338
140 Ga0495594_0057702 3300046499 Bacteria 2144
141 Ga0495596_0005962 3300046500 Bacteria 5684
142 Ga0495607_0045979 3300046501 Bacteria 2566
143 Ga0495583_0049504 3300046506 Bacteria 1924
144 Ga0495606_0028778 3300046507 Bacteria 3912
145 Ga0495616_0046359 3300046513 Bacteria 2194
146 Ga0495618_0005798 3300046514 Bacteria 7508
147 Ga0495618_0019444 3300046514 Bacteria 4179
148 Ga0495618_0095465 3300046514 Bacteria 1901
149 Ga0495620_0025491 3300046515 Bacteria 2795
150 Ga0495628_0020574 3300046516 Bacteria 5440
151 Ga0495628_0036744 3300046516 Bacteria 3930
152 Ga0495630_0016506 3300046517 Bacteria 5397
153 Ga0495643_0005349 3300046522 Bacteria 8694
154 Ga0495652_0014739 3300046529 Bacteria 7009
155 Ga0495652_0042680 3300046529 Bacteria 3910
156 Ga0495640_0005011 3300046533 Bacteria 10522
157 Ga0495640_0070244 3300046533 Bacteria 2353
158 Ga0495640_0143689 3300046533 Bacteria 1536
159 Ga0495587_0001074 3300046536 Bacteria 17963
160 Ga0495645_0006521 3300046543 Bacteria 8102
161 Ga0495622_0028229 3300046557 Bacteria 2620
162 Ga0495668_0027536 3300046616 Bacteria 3220
163 Ga0495634_0006470 3300046642 Bacteria 8900
164 Ga0495634_0018410 3300046642 Bacteria 4972
165 Ga0495625_0008236 3300046660 Bacteria 8916
166 Ga0495625_0075181 3300046660 Bacteria 2364
167 Ga0495635_0006847 3300046663 Bacteria 7965
168 Ga0495635_0033238 3300046663 Bacteria 3577
169 Ga0495661_0037173 3300046665 Bacteria 3041
170 Ga0495661_0073639 3300046665 Bacteria 1990
171 Ga0495588_0008077 3300046674 Bacteria 4813
172 Ga0495588_0094837 3300046674 Bacteria 1564
173 Ga0495657_0006760 3300046675 Bacteria 8941
174 Ga0495657_0007175 3300046675 Bacteria 8646
175 Ga0495657_0026635 3300046675 Bacteria 4092
176 Ga0495646_0000250 3300046680 Bacteria 27112
177 Ga0495658_0099918 3300046683 Bacteria 1730
178 Ga0495613_0010744 3300046689 Bacteria 6790
179 Ga0495613_0043354 3300046689 Bacteria 3328
180 Ga0495613_0095086 3300046689 Bacteria 2155
181 Ga0495613_0127094 3300046689 Bacteria 1827
182 Ga0495613_0156892 3300046689 Bacteria 1621
183 Ga0495613_0252410 3300046689 Bacteria 1230
184 Ga0495624_0024264 3300046690 Bacteria 3991
185 Ga0495670_0020607 3300046691 Bacteria 3252
186 Ga0495670_0048482 3300046691 Bacteria 2125
187 Ga0495671_0081903 3300046692 Bacteria 1581
188 Ga0495649_0023105 3300046694 Bacteria 3473
189 Ga0495589_0045983 3300046794 Bacteria 2167
190 Ga0495589_0061803 3300046794 Bacteria 1837
191 Ga0495589_0075030 3300046794 Bacteria 1649
192 Ga0495581_0015533 3300047315 Bacteria 4419
193 Ga0495581_0029122 3300047315 Bacteria 3201
194 Ga0495604_0006467 3300047317 Bacteria 9294
195 Ga0495604_0076231 3300047317 Bacteria 2522
196 Ga0495636_0006878 3300047318 Bacteria 4473
197 Ga0495636_0036321 3300047318 Bacteria 2031
198 Ga0495636_0047154 3300047318 Bacteria 1799
199 Ga0495672_0119388 3300047320 Bacteria 1404
200 Ga0495676_0005722 3300047321 Bacteria 11401
201 Ga0495676_0011027 3300047321 Bacteria 8172
202 Ga0495676_0013056 3300047321 Bacteria 7473
203 Ga0495676_0042161 3300047321 Bacteria 3749
204 Ga0495676_0052566 3300047321 Bacteria 3250
205 Ga0495676_0130867 3300047321 Bacteria 1811
206 Ga0495680_0005588 3300047322 Bacteria 11792
207 Ga0495687_002802 3300047443 Bacteria 13452
208 Ga0495687_003771 3300047443 Bacteria 10712
209 Ga0495687_055508 3300047443 Bacteria 1655
210 Ga0495675_0027342 3300047444 Bacteria 3634
211 Ga0495675_0099198 3300047444 Bacteria 1824
212 Ga0495685_013789 3300047447 Bacteria 2742
213 Ga0495685_023653 3300047447 Bacteria 2115
214 Ga0495681_0003360 3300047470 Bacteria 11138
215 Ga0495686_0009516 3300047472 Bacteria 6991
216 Ga0495593_0021490 3300047673 Bacteria 3603
217 Ga0495593_0052618 3300047673 Bacteria 2151
218 Ga0495602_0039115 3300048088 Bacteria 4373
219 Ga0495614_0002631 3300048089 Bacteria 7980
220 Ga0495614_0009294 3300048089 Bacteria 4350
221 Ga0495614_0015750 3300048089 Bacteria 3292
222 Ga0495614_0085180 3300048089 Bacteria 1371
223 Ga0496106_0006760 3300048909 Bacteria 8491
224 Ga0496109_0056123 3300048912 Bacteria 3594
225 Ga0496110_0093063 3300048913 Bacteria 2698
226 Ga0496112_0040604 3300048915 Bacteria 4550
227 Ga0501318_002264 3300049534 Bacteria 1645
228 Ga0501031_0001230 3300049568 Bacteria 15679
229 Ga0501031_0068530 3300049568 Bacteria 2311
230 Ga0501032_0000992 3300049569 Bacteria 22851
231 Ga0501032_0081138 3300049569 Bacteria 2158
232 Ga0501033_0001734 3300049570 Bacteria 19066
233 Ga0501033_0022411 3300049570 Bacteria 4764
234 Ga0501033_0024317 3300049570 Bacteria 4570
235 Ga0501033_0034124 3300049570 Bacteria 3818
236 Ga0501033_0057992 3300049570 Bacteria 2860
237 Ga0501033_0075218 3300049570 Bacteria 2479
238 Ga0501034_0001415 3300049571 Bacteria 32122
239 Ga0501034_0027774 3300049571 Bacteria 5754
240 Ga0501034_0044816 3300049571 Bacteria 4471
241 Ga0501036_0000851 3300049572 Bacteria 22716
242 Ga0501036_0004483 3300049572 Bacteria 11291
243 Ga0501036_0007110 3300049572 Bacteria 9107
244 Ga0501036_0039094 3300049572 Bacteria 4017
245 Ga0501036_0071576 3300049572 Bacteria 2931
246 Ga0501036_0101914 3300049572 Bacteria 2428
247 Ga0501037_0000989 3300049573 Bacteria 21064
248 Ga0501037_0024075 3300049573 Bacteria 4502
249 Ga0501037_0024872 3300049573 Bacteria 4426
250 Ga0501037_0138813 3300049573 Bacteria 1740
251 Ga0501038_0003143 3300049574 Bacteria 15408
252 Ga0501038_0019471 3300049574 Bacteria 6116
253 Ga0501038_0058906 3300049574 Bacteria 3291
254 Ga0501038_0059246 3300049574 Bacteria 3280
255 Ga0501038_0151533 3300049574 Bacteria 1890
256 Ga0501039_0010476 3300049575 Bacteria 7064
257 Ga0501039_0021575 3300049575 Bacteria 4940
258 Ga0501040_0007477 3300049576 Bacteria 7073
259 Ga0501041_0006492 3300049577 Bacteria 6846
260 Ga0501042_0006221 3300049578 Bacteria 7749
261 Ga0501042_0018542 3300049578 Bacteria 4819
262 Ga0501043_0002379 3300049579 Bacteria 15929
263 Ga0501043_0002835 3300049579 Bacteria 14493
264 Ga0501043_0038438 3300049579 Bacteria 3763
265 Ga0501043_0057356 3300049579 Bacteria 3058
266 Ga0501043_0205499 3300049579 Bacteria 1527
267 Ga0501046_0006232 3300049580 Bacteria 10588
268 Ga0501046_0033557 3300049580 Bacteria 4145
269 Ga0501047_0000208 3300049581 Bacteria 71122
270 Ga0501047_0000826 3300049581 Bacteria 32127
271 Ga0501047_0002708 3300049581 Bacteria 16868
272 Ga0501047_0020172 3300049581 Bacteria 6399
273 Ga0501047_0032535 3300049581 Bacteria 5034
274 Ga0501047_0087892 3300049581 Bacteria 2985
275 Ga0501047_0093126 3300049581 Bacteria 2892
276 Ga0501047_0136089 3300049581 Bacteria 2337
277 Ga0501048_0003265 3300049582 Bacteria 12350
278 Ga0501048_0008489 3300049582 Bacteria 7766
279 Ga0501067_0018746 3300049583 Bacteria 3830
280 Ga0501068_0012483 3300049584 Bacteria 4819
281 Ga0501069_0003487 3300049585 Bacteria 8100
282 Ga0501070_0000722 3300049586 Bacteria 30134
283 Ga0501070_0210536 3300049586 Bacteria 1596
284 Ga0501071_0001692 3300049587 Bacteria 12934
285 Ga0501072_0002777 3300049588 Bacteria 13162
286 Ga0501073_0083290 3300049589 Bacteria 2225
287 Ga0501074_0002990 3300049590 Bacteria 11882
288 Ga0501077_0010334 3300049593 Bacteria 5808
289 Ga0501079_0054803 3300049741 Bacteria 3075
290 Ga0501080_0078255 3300049742 Bacteria 3075
291 Ga0501083_0005593 3300049744 Bacteria 8897
292 Ga0501083_0148536 3300049744 Bacteria 1535
293 Ga0501035_0004728 3300049822 Bacteria 12928
294 Ga0501035_0019547 3300049822 Bacteria 6224
295 Ga0501035_0030328 3300049822 Bacteria 4930
296 Ga0501035_0037529 3300049822 Bacteria 4387
297 Ga0501035_0077770 3300049822 Bacteria 2931
298 Ga0501035_0183342 3300049822 Bacteria 1802
299 Ga0501044_0002530 3300049823 Bacteria 20819
300 Ga0501044_0021111 3300049823 Bacteria 6952
301 Ga0501044_0037239 3300049823 Bacteria 5086
302 Ga0501044_0040449 3300049823 Bacteria 4859
303 Ga0501044_0040630 3300049823 Bacteria 4846
304 Ga0501044_0045899 3300049823 Bacteria 4525
305 Ga0501044_0225944 3300049823 Bacteria 1821
306 Ga0501044_0264906 3300049823 Bacteria 1656
307 nmdc:mga03n38_4942_c2 3300050490 Bacteria 3118
308 nmdc:mga06z11_532_c1 3300050494 Bacteria 14020
309 nmdc:mga05p37_144858_c1 3300050507 Bacteria 2910
310 nmdc:mga05p37_252170_c1 3300050507 Bacteria 2116
311 nmdc:mga0qj67_80567_c1 3300050509 Bacteria 2609
312 nmdc:mga06r32_57200_c1 3300050510 Bacteria 3746
313 nmdc:mga0n895_138217_c1 3300050512 Bacteria 2464
314 nmdc:mga0rr50_101094_c1 3300050513 Bacteria 2266
315 nmdc:mga08x19_86635_c1 3300050514 Bacteria 2062
316 nmdc:mga0a205_36292_c1 3300050515 Bacteria 4736
317 Ga0495619_0020029 3300053085 Bacteria 4257
318 Ga0500644_0029288 3300053088 Bacteria 1730
319 Ga0500573_0083028 3300053140 Bacteria 1819
320 Ga0501084_0000010 3300054114 Bacteria 187712
321 Ga0501084_0004457 3300054114 Bacteria 11430
322 Ga0501082_0009457 3300060353 Bacteria 8392
323 Ga0466962_0010581 3300061719 Bacteria 4436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042131 Ga0450894_000143 Ga0450894_000143_5941_7023 289
2 3300042135 Ga0450899_001292 Ga0450899_001292_334_1416 289
3 3300042184 Ga0450908_003256 Ga0450908_003256_1477_2559 289
4 iso_pu_bacteria 2998344455 2998346480 308
5 3300044735 Ga0466968_0077432 Ga0466968_0077432_117_1244 310
6 3300006048 Ga0075363_100037163 Ga0075363_1000371632 311
7 3300049823 Ga0501044_0040449 Ga0501044_0040449_2689_3807 311
8 3300054114 Ga0501084_0000010 Ga0501084_0000010_139095_140162 315
9 3300044658 Ga0466972_0077564 Ga0466972_0077564_569_1540 318
10 3300046683 Ga0495658_0099918 Ga0495658_0099918_711_1682 318
11 3300048915 Ga0496112_0040604 Ga0496112_0040604_2217_3329 318
12 3300049573 Ga0501037_0024075 Ga0501037_0024075_976_2070 318
13 3300049581 Ga0501047_0000208 Ga0501047_0000208_8382_9476 318
14 3300031251 Ga0265327_10013638 Ga0265327_100136385 319
15 3300053088 Ga0500644_0029288 Ga0500644_0029288_165_1214 319
16 3300049573 Ga0501037_0138813 Ga0501037_0138813_468_1532 320
17 3300049581 Ga0501047_0002708 Ga0501047_0002708_15596_16660 320
18 3300049823 Ga0501044_0264906 Ga0501044_0264906_152_1216 320
19 3300005436 Ga0070713_100239265 Ga0070713_1002392652 322
20 3300005471 Ga0070698_100354549 Ga0070698_1003545491 322
21 3300005518 Ga0070699_100037226 Ga0070699_1000372263 322
22 3300006844 Ga0075428_100097472 Ga0075428_1000974722 322
23 3300006847 Ga0075431_100024501 Ga0075431_1000245015 322
24 3300006871 Ga0075434_100021649 Ga0075434_1000216493 322
25 3300006880 Ga0075429_100281858 Ga0075429_1002818581 322
26 3300006914 Ga0075436_100045505 Ga0075436_1000455053 322
27 3300007076 Ga0075435_100004385 Ga0075435_1000043852 322
28 3300009094 Ga0111539_10548689 Ga0111539_105486891 322
29 3300009147 Ga0114129_10248313 Ga0114129_102483132 322
30 3300025928 Ga0207700_10101074 Ga0207700_101010743 322
31 3300050507 nmdc:mga05p37_144858_c1 nmdc:mga05p37_144858_c1_1668_2744 322
32 3300050512 nmdc:mga0n895_138217_c1 nmdc:mga0n895_138217_c1_568_1644 322
33 3300050513 nmdc:mga0rr50_101094_c1 nmdc:mga0rr50_101094_c1_208_1284 322
34 3300050514 nmdc:mga08x19_86635_c1 nmdc:mga08x19_86635_c1_540_1616 322
35 3300050515 nmdc:mga0a205_36292_c1 nmdc:mga0a205_36292_c1_2537_3613 322
36 iso_pu_bacteria 8033684223 8033689721 322
37 3300005445 Ga0070708_100010463 Ga0070708_1000104634 323
38 3300005467 Ga0070706_100008571 Ga0070706_1000085719 323
39 3300005468 Ga0070707_100186597 Ga0070707_1001865972 323
40 3300005471 Ga0070698_100015874 Ga0070698_1000158744 323
41 3300005985 Ga0081539_10004154 Ga0081539_1000415414 323
42 3300006048 Ga0075363_100010971 Ga0075363_1000109712 323
43 3300025922 Ga0207646_10212484 Ga0207646_102124842 323
44 3300037312 Ga0395899_0143727 Ga0395899_0143727_459_1535 323
45 3300037466 Ga0395898_0026040 Ga0395898_0026040_4093_5169 323
46 3300041404 Ga0439436_0006705 Ga0439436_0006705_162_1241 323
47 3300042014 Ga0439457_001126 Ga0439457_001126_3315_4394 323
48 3300046499 Ga0495594_0048328 Ga0495594_0048328_878_1969 323
49 3300049568 Ga0501031_0001230 Ga0501031_0001230_11214_12314 323
50 3300049569 Ga0501032_0000992 Ga0501032_0000992_16580_17680 323
51 3300049570 Ga0501033_0057992 Ga0501033_0057992_1023_2123 323
52 3300049571 Ga0501034_0001415 Ga0501034_0001415_13517_14617 323
53 3300049572 Ga0501036_0004483 Ga0501036_0004483_4378_5478 323
54 3300049572 Ga0501036_0101914 Ga0501036_0101914_1268_2332 323
55 3300049573 Ga0501037_0000989 Ga0501037_0000989_13517_14617 323
56 3300049573 Ga0501037_0024872 Ga0501037_0024872_68_1132 323
57 3300049574 Ga0501038_0019471 Ga0501038_0019471_1723_2823 323
58 3300049575 Ga0501039_0010476 Ga0501039_0010476_103_1203 323
59 3300049576 Ga0501040_0007477 Ga0501040_0007477_2258_3358 323
60 3300049577 Ga0501041_0006492 Ga0501041_0006492_1700_2800 323
61 3300049578 Ga0501042_0006221 Ga0501042_0006221_5479_6543 323
62 3300049578 Ga0501042_0018542 Ga0501042_0018542_1877_2977 323
63 3300049579 Ga0501043_0002379 Ga0501043_0002379_5614_6714 323
64 3300049580 Ga0501046_0006232 Ga0501046_0006232_5131_6231 323
65 3300049580 Ga0501046_0033557 Ga0501046_0033557_1869_2933 323
66 3300049581 Ga0501047_0000826 Ga0501047_0000826_17509_18609 323
67 3300049582 Ga0501048_0003265 Ga0501048_0003265_5368_6468 323
68 3300049582 Ga0501048_0008489 Ga0501048_0008489_6334_7398 323
69 3300049583 Ga0501067_0018746 Ga0501067_0018746_1030_2130 323
70 3300049584 Ga0501068_0012483 Ga0501068_0012483_1877_2977 323
71 3300049585 Ga0501069_0003487 Ga0501069_0003487_1260_2360 323
72 3300049587 Ga0501071_0001692 Ga0501071_0001692_5170_6270 323
73 3300049588 Ga0501072_0002777 Ga0501072_0002777_6900_8000 323
74 3300049589 Ga0501073_0083290 Ga0501073_0083290_895_1995 323
75 3300049593 Ga0501077_0010334 Ga0501077_0010334_3205_4305 323
76 3300049741 Ga0501079_0054803 Ga0501079_0054803_1081_2181 323
77 3300049742 Ga0501080_0078255 Ga0501080_0078255_895_1995 323
78 3300049744 Ga0501083_0005593 Ga0501083_0005593_5659_6759 323
79 3300049822 Ga0501035_0004728 Ga0501035_0004728_9571_10671 323
80 3300049822 Ga0501035_0037529 Ga0501035_0037529_3295_4359 323
81 3300049823 Ga0501044_0002530 Ga0501044_0002530_6203_7303 323
82 3300049823 Ga0501044_0040630 Ga0501044_0040630_2702_3766 323
83 3300054114 Ga0501084_0004457 Ga0501084_0004457_6776_7876 323
84 3300060353 Ga0501082_0009457 Ga0501082_0009457_6033_7133 323
85 3300038443 Ga0395901_0153573 Ga0395901_0153573_694_1770 324
86 3300041494 Ga0451837_1486135 Ga0451837_1486135_834_1934 324
87 3300046533 Ga0495640_0143689 Ga0495640_0143689_435_1511 324
88 3300046689 Ga0495613_0043354 Ga0495613_0043354_985_2061 324
89 3300047673 Ga0495593_0052618 Ga0495593_0052618_518_1594 324
90 3300049534 Ga0501318_002264 Ga0501318_002264_540_1625 324
91 3300049570 Ga0501033_0022411 Ga0501033_0022411_1415_2482 324
92 3300049574 Ga0501038_0151533 Ga0501038_0151533_508_1575 324
93 3300049579 Ga0501043_0057356 Ga0501043_0057356_610_1677 324
94 3300049581 Ga0501047_0032535 Ga0501047_0032535_3163_4230 324
95 3300003320 rootH2_10048140 rootH2_100481403 325
96 3300005937 Ga0081455_10016857 Ga0081455_100168576 325
97 3300006844 Ga0075428_100078727 Ga0075428_1000787273 325
98 3300006844 Ga0075428_100354516 Ga0075428_1003545162 325
99 3300006847 Ga0075431_100336122 Ga0075431_1003361222 325
100 3300035725 Ga0373947_0008189 Ga0373947_0008189_322_1392 325
101 3300044694 Ga0466963_0062652 Ga0466963_0062652_1241_2317 325
102 3300046501 Ga0495607_0045979 Ga0495607_0045979_1305_2396 325
103 3300046517 Ga0495630_0016506 Ga0495630_0016506_4208_5278 325
104 3300046689 Ga0495613_0156892 Ga0495613_0156892_20_1090 325
105 3300046691 Ga0495670_0020607 Ga0495670_0020607_338_1429 325
106 3300046794 Ga0495589_0061803 Ga0495589_0061803_628_1719 325
107 3300050507 nmdc:mga05p37_252170_c1 nmdc:mga05p37_252170_c1_711_1781 325
108 3300050509 nmdc:mga0qj67_80567_c1 nmdc:mga0qj67_80567_c1_949_2019 325
109 3300050510 nmdc:mga06r32_57200_c1 nmdc:mga06r32_57200_c1_312_1382 325
110 3300046665 Ga0495661_0073639 Ga0495661_0073639_376_1467 326
111 3300047444 Ga0495675_0027342 Ga0495675_0027342_321_1379 326
112 iso_pu_bacteria 2862705112 2862709922 326
113 iso_pu_bacteria 2990044586 2990045967 326
114 iso_pu_bacteria 8008485437 8008487263 326
115 iso_pu_bacteria 8025524527 8025526304 326
116 3300006178 Ga0075367_10008628 Ga0075367_100086282 327
117 3300041512 Ga0451853_0111687 Ga0451853_0111687_482_1558 327
118 3300046460 Ga0495638_0019639 Ga0495638_0019639_1014_2093 327
119 3300049569 Ga0501032_0081138 Ga0501032_0081138_1074_2147 327
120 3300049744 Ga0501083_0148536 Ga0501083_0148536_125_1201 327
121 3300050494 nmdc:mga06z11_532_c1 nmdc:mga06z11_532_c1_6311_7390 327
122 3300046454 Ga0495592_0004769 Ga0495592_0004769_2845_3951 328
123 3300046462 Ga0495651_0024390 Ga0495651_0024390_3189_4295 328
124 3300046462 Ga0495651_0046924 Ga0495651_0046924_804_1880 328
125 3300046477 Ga0495664_0154876 Ga0495664_0154876_105_1211 328
126 3300046514 Ga0495618_0019444 Ga0495618_0019444_125_1231 328
127 3300046516 Ga0495628_0036744 Ga0495628_0036744_1029_2135 328
128 3300046529 Ga0495652_0042680 Ga0495652_0042680_724_1800 328
129 3300046533 Ga0495640_0005011 Ga0495640_0005011_4809_5915 328
130 3300046642 Ga0495634_0006470 Ga0495634_0006470_121_1227 328
131 3300046675 Ga0495657_0026635 Ga0495657_0026635_83_1189 328
132 3300047315 Ga0495581_0029122 Ga0495581_0029122_331_1407 328
133 3300047317 Ga0495604_0076231 Ga0495604_0076231_84_1190 328
134 3300047321 Ga0495676_0005722 Ga0495676_0005722_3514_4620 328
135 3300047322 Ga0495680_0005588 Ga0495680_0005588_1463_2539 328
136 3300049568 Ga0501031_0068530 Ga0501031_0068530_512_1618 328
137 3300049571 Ga0501034_0027774 Ga0501034_0027774_3029_4135 328
138 3300049572 Ga0501036_0039094 Ga0501036_0039094_1160_2266 328
139 3300049579 Ga0501043_0038438 Ga0501043_0038438_2528_3634 328
140 3300049581 Ga0501047_0136089 Ga0501047_0136089_558_1664 328
141 3300049586 Ga0501070_0210536 Ga0501070_0210536_523_1581 328
142 3300049822 Ga0501035_0077770 Ga0501035_0077770_1253_2359 328
143 iso_pu_bacteria 2582581313 2585307747 328
144 iso_pu_bacteria 2643221647 2644269598 328
145 iso_pu_bacteria 2784746768 2785371816 328
146 iso_pu_bacteria 2791355406 2793979511 328
147 iso_pu_bacteria 2877676314 2877678763 328
148 iso_pu_bacteria 2954380949 2954383742 328
149 iso_pu_bacteria 2954691527 2954694536 328
150 iso_pu_bacteria 2954701450 2954709740 328
151 iso_pu_bacteria 2954711539 2954714025 328
152 iso_pu_bacteria 2954721474 2954723994 328
153 iso_pu_bacteria 2954731030 2954737846 328
154 iso_pu_bacteria 2954740390 2954742891 328
155 iso_pu_bacteria 2954749733 2954756698 328
156 iso_pu_bacteria 2954759201 2954761848 328
157 iso_pu_bacteria 8047893842 8047895810 328
158 iso_pu_bacteria 8048127548 8048129068 328
159 iso_pu_bacteria 8048356638 8048363124 328
160 iso_pu_bacteria 8048369669 8048372834 328
161 iso_pu_bacteria 8048379754 8048381768 328
162 3300003323 rootH1_10026109 rootH1_100261093 329
163 3300030522 Ga0307512_10002986 Ga0307512_1000298612 329
164 3300031616 Ga0307508_10010818 Ga0307508_100108181 329
165 3300033179 Ga0307507_10078198 Ga0307507_100781982 329
166 3300049822 Ga0501035_0019547 Ga0501035_0019547_2945_4051 329
167 iso_pu_bacteria 2808606982 2811844121 329
168 iso_pu_bacteria 2867369537 2867374093 329
169 iso_pu_bacteria 2912757875 2912763059 329
170 iso_pu_bacteria 2990088156 2990093880 329
171 iso_pu_bacteria 8025530807 8025532677 329
172 3300014497 Ga0182008_10000192 Ga0182008_100001928 330
173 3300015262 Ga0182007_10000449 Ga0182007_1000044921 330
174 3300044719 Ga0466971_0047383 Ga0466971_0047383_734_1819 330
175 3300046492 Ga0495585_0031817 Ga0495585_0031817_1706_2791 330
176 3300046499 Ga0495594_0003850 Ga0495594_0003850_732_1853 330
177 3300047321 Ga0495676_0052566 Ga0495676_0052566_1937_3058 330
178 3300047447 Ga0495685_013789 Ga0495685_013789_200_1285 330
179 iso_pu_bacteria 2547132111 2547410584 330
180 iso_pu_bacteria 2643221548 2643761533 330
181 iso_pu_bacteria 2643221578 2643899364 330
182 iso_pu_bacteria 2643221673 2644406901 330
183 iso_pu_bacteria 2643221678 2644437762 330
184 iso_pu_bacteria 2643221682 2644458765 330
185 iso_pu_bacteria 2643221714 2644629853 330
186 iso_pu_bacteria 2786546132 2786672927 330
187 iso_pu_bacteria 2808606359 2808844317 330
188 iso_pu_bacteria 2808606375 2808913892 330
189 iso_pu_bacteria 2818991463 2819698935 330
190 iso_pu_bacteria 2867428634 2867433168 330
191 iso_pu_bacteria 2867475112 2867480302 330
192 iso_pu_bacteria 2875391855 2875396999 330
193 iso_pu_bacteria 2912723979 2912729906 330
194 iso_pu_bacteria 2919468124 2919472504 330
195 iso_pu_bacteria 2935390628 2935392145 330
196 iso_pu_bacteria 2946045630 2946047559 330
197 iso_pu_bacteria 2946072368 2946077995 330
198 iso_pu_bacteria 2954673503 2954679234 330
199 iso_pu_bacteria 2954682443 2954684919 330
200 iso_pu_bacteria 2966598605 2966600594 330
201 iso_pu_bacteria 2997451912 2997453121 330
202 iso_pu_bacteria 3006393351 3006395893 330
203 iso_pu_bacteria 3006486233 3006487485 330
204 iso_pu_bacteria 8008574985 8008576890 330
205 iso_pu_bacteria 8048406513 8048409797 330
206 iso_pu_bacteria 8054160619 8054163116 330
207 iso_pu_bacteria 8056447290 8056447827 330
208 iso_pu_bacteria 8056667051 8056670777 330
209 iso_pu_bacteria 8056829672 8056831591 330
210 3300003320 rootH2_10135553 rootH2_101355532 331
211 3300030521 Ga0307511_10012189 Ga0307511_100121897 331
212 3300031507 Ga0307509_10014720 Ga0307509_100147209 331
213 3300031616 Ga0307508_10005717 Ga0307508_100057178 331
214 3300031649 Ga0307514_10069622 Ga0307514_100696221 331
215 3300031730 Ga0307516_10038502 Ga0307516_100385022 331
216 3300037466 Ga0395898_0018786 Ga0395898_0018786_747_1826 331
217 3300044683 Ga0466965_0007965 Ga0466965_0007965_52_1125 331
218 3300044684 Ga0466966_0047910 Ga0466966_0047910_1080_2153 331
219 3300044693 Ga0466961_0003355 Ga0466961_0003355_3015_4088 331
220 3300044694 Ga0466963_0005535 Ga0466963_0005535_2586_3659 331
221 3300044719 Ga0466971_0001020 Ga0466971_0001020_7789_8862 331
222 3300044765 Ga0466970_0005955 Ga0466970_0005955_2875_3948 331
223 3300044842 Ga0466957_0007505 Ga0466957_0007505_3152_4225 331
224 3300045836 Ga0466958_0001227 Ga0466958_0001227_8547_9620 331
225 3300045976 Ga0466967_0005732 Ga0466967_0005732_3319_4392 331
226 3300046459 Ga0495629_0094987 Ga0495629_0094987_476_1579 331
227 3300046459 Ga0495629_0104123 Ga0495629_0104123_123_1235 331
228 3300046689 Ga0495613_0252410 Ga0495613_0252410_62_1138 331
229 3300047318 Ga0495636_0047154 Ga0495636_0047154_511_1623 331
230 3300047443 Ga0495687_002802 Ga0495687_002802_3612_4724 331
231 3300049570 Ga0501033_0034124 Ga0501033_0034124_198_1298 331
232 3300049572 Ga0501036_0071576 Ga0501036_0071576_497_1597 331
233 3300049574 Ga0501038_0059246 Ga0501038_0059246_939_2039 331
234 3300049581 Ga0501047_0087892 Ga0501047_0087892_1173_2273 331
235 3300049822 Ga0501035_0183342 Ga0501035_0183342_35_1135 331
236 3300049823 Ga0501044_0225944 Ga0501044_0225944_272_1372 331
237 3300061719 Ga0466962_0010581 Ga0466962_0010581_2793_3866 331
238 iso_pu_bacteria 2554235005 2554256009 331
239 iso_pu_bacteria 2582581312 2585297431 331
240 iso_pu_bacteria 2616644814 2616700047 331
241 iso_pu_bacteria 2784132148 2784590643 331
242 iso_pu_bacteria 2802429296 2804848180 331
243 iso_pu_bacteria 2808606448 2809234335 331
244 iso_pu_bacteria 2811994917 2812478512 331
245 iso_pu_bacteria 2862178590 2862181790 331
246 iso_pu_bacteria 2862281513 2862284333 331
247 iso_pu_bacteria 2862290372 2862292278 331
248 iso_pu_bacteria 2862574272 2862577215 331
249 iso_pu_bacteria 2863404153 2863408908 331
250 iso_pu_bacteria 2912715099 2912717330 331
251 iso_pu_bacteria 2954002825 2954005806 331
252 iso_pu_bacteria 3006321560 3006324755 331
253 iso_pu_bacteria 3006493962 3006500023 331
254 iso_pu_bacteria 8025413630 8025414220 331
255 iso_pu_bacteria 8025478263 8025484209 331
256 3300005937 Ga0081455_10060312 Ga0081455_100603122 332
257 3300015688 Ga0183367_1013 Ga0183367_101389 332
258 3300027312 Ga0209371_1005729 Ga0209371_10057293 332
259 3300030500 Ga0268256_1009350 Ga0268256_10093502 332
260 3300031649 Ga0307514_10003971 Ga0307514_1000397111 332
261 3300031730 Ga0307516_10018764 Ga0307516_100187644 332
262 3300048909 Ga0496106_0006760 Ga0496106_0006760_207_1328 332
263 3300050490 nmdc:mga03n38_4942_c2 nmdc:mga03n38_4942_c2_881_1948 332
264 iso_pu_bacteria 2643221587 2643943680 332
265 iso_pu_bacteria 2643221677 2644434061 332
266 iso_pu_bacteria 2811994879 2812355691 332
267 iso_pu_bacteria 2852635781 2852639735 332
268 iso_pu_bacteria 2918501144 2918506788 332
269 iso_pu_bacteria 2946064051 2946070117 332
270 iso_pu_bacteria 2947224130 2947226675 332
271 3300003354 JGI25160J50197_1015558 JGI25160J50197_10155582 333
272 3300025302 Ga0207426_1002296 Ga0207426_100229610 333
273 3300025302 Ga0207426_1003628 Ga0207426_10036282 333
274 3300032002 Ga0307416_100028303 Ga0307416_1000283032 333
275 3300037466 Ga0395898_0330591 Ga0395898_0330591_69_1142 333
276 3300042005 Ga0439448_0014459 Ga0439448_0014459_172_1248 333
277 3300042012 Ga0439455_0002494 Ga0439455_0002494_226_1302 333
278 3300042138 Ga0450903_000128 Ga0450903_000128_1280_2356 333
279 3300042157 Ga0439458_0000458 Ga0439458_0000458_2844_3920 333
280 3300046455 Ga0495603_0001314 Ga0495603_0001314_5158_6363 333
281 3300046459 Ga0495629_0003712 Ga0495629_0003712_5139_6344 333
282 3300046459 Ga0495629_0029940 Ga0495629_0029940_372_1466 333
283 3300046499 Ga0495594_0057702 Ga0495594_0057702_893_1957 333
284 3300046533 Ga0495640_0070244 Ga0495640_0070244_366_1472 333
285 3300046689 Ga0495613_0095086 Ga0495613_0095086_796_2001 333
286 3300047321 Ga0495676_0011027 Ga0495676_0011027_2953_4158 333
287 3300048089 Ga0495614_0002631 Ga0495614_0002631_3823_5028 333
288 3300049570 Ga0501033_0001734 Ga0501033_0001734_5840_6913 333
289 iso_pu_bacteria 2643221670 2644387158 333
290 iso_pu_bacteria 2862507626 2862514324 333
291 iso_pu_bacteria 8008558824 8008563061 333
292 3300001989 JGI24739J22299_10005168 JGI24739J22299_100051682 334
293 3300009011 Ga0105251_10014786 Ga0105251_100147862 334
294 3300011119 Ga0105246_10020630 Ga0105246_100206302 334
295 3300025735 Ga0207713_1016215 Ga0207713_10162151 334
296 3300025904 Ga0207647_10040617 Ga0207647_100406172 334
297 3300026041 Ga0207639_10022902 Ga0207639_100229024 334
298 3300028786 Ga0307517_10016670 Ga0307517_100166707 334
299 3300028794 Ga0307515_10003048 Ga0307515_100030485 334
300 3300028794 Ga0307515_10146900 Ga0307515_101469002 334
301 3300031456 Ga0307513_10020691 Ga0307513_100206915 334
302 3300031616 Ga0307508_10047853 Ga0307508_100478533 334
303 3300031649 Ga0307514_10040081 Ga0307514_100400813 334
304 3300031649 Ga0307514_10055685 Ga0307514_100556852 334
305 3300033179 Ga0307507_10012239 Ga0307507_100122399 334
306 3300033179 Ga0307507_10042360 Ga0307507_100423603 334
307 3300041404 Ga0439436_0000779 Ga0439436_0000779_710_1795 334
308 3300041406 Ga0439439_0000740 Ga0439439_0000740_1332_2417 334
309 3300041498 Ga0451841_1125641 Ga0451841_1125641_442_1542 334
310 3300041501 Ga0451845_0032422 Ga0451845_0032422_69_1148 334
311 3300041512 Ga0451853_1737779 Ga0451853_1737779_49_1149 334
312 3300041999 Ga0439433_0000155 Ga0439433_0000155_3516_4601 334
313 3300042006 Ga0439432_036557 Ga0439432_036557_480_1559 334
314 3300042007 Ga0439449_0041959 Ga0439449_0041959_554_1633 334
315 3300044658 Ga0466972_0001308 Ga0466972_0001308_2142_3227 334
316 3300044683 Ga0466965_0018546 Ga0466965_0018546_837_1928 334
317 3300044684 Ga0466966_0010741 Ga0466966_0010741_182_1267 334
318 3300044693 Ga0466961_0026388 Ga0466961_0026388_1185_2270 334
319 3300044693 Ga0466961_0063959 Ga0466961_0063959_1146_2237 334
320 3300044765 Ga0466970_0000746 Ga0466970_0000746_8624_9700 334
321 3300044901 Ga0466960_0013926 Ga0466960_0013926_870_1961 334
322 3300045976 Ga0466967_0095927 Ga0466967_0095927_556_1629 334
323 3300046454 Ga0495592_0065310 Ga0495592_0065310_31_1107 334
324 3300046455 Ga0495603_0003908 Ga0495603_0003908_3444_4547 334
325 3300046455 Ga0495603_0029091 Ga0495603_0029091_803_1915 334
326 3300046457 Ga0495590_0016956 Ga0495590_0016956_1473_2585 334
327 3300046459 Ga0495629_0014972 Ga0495629_0014972_3175_4251 334
328 3300046459 Ga0495629_0033933 Ga0495629_0033933_1359_2447 334
329 3300046460 Ga0495638_0157376 Ga0495638_0157376_129_1205 334
330 3300046461 Ga0495641_0116204 Ga0495641_0116204_37_1149 334
331 3300046462 Ga0495651_0005450 Ga0495651_0005450_5634_6710 334
332 3300046463 Ga0495653_0149628 Ga0495653_0149628_405_1481 334
333 3300046474 Ga0495605_0007527 Ga0495605_0007527_124_1236 334
334 3300046474 Ga0495605_0057507 Ga0495605_0057507_693_1769 334
335 3300046475 Ga0495639_0023770 Ga0495639_0023770_1502_2590 334
336 3300046476 Ga0495662_0005303 Ga0495662_0005303_5006_6103 334
337 3300046477 Ga0495664_0025213 Ga0495664_0025213_1312_2388 334
338 3300046499 Ga0495594_0000934 Ga0495594_0000934_13452_14528 334
339 3300046500 Ga0495596_0005962 Ga0495596_0005962_4110_5186 334
340 3300046506 Ga0495583_0049504 Ga0495583_0049504_62_1183 334
341 3300046507 Ga0495606_0028778 Ga0495606_0028778_1515_2627 334
342 3300046513 Ga0495616_0046359 Ga0495616_0046359_968_2080 334
343 3300046514 Ga0495618_0005798 Ga0495618_0005798_2005_3081 334
344 3300046514 Ga0495618_0095465 Ga0495618_0095465_426_1502 334
345 3300046515 Ga0495620_0025491 Ga0495620_0025491_1540_2652 334
346 3300046516 Ga0495628_0020574 Ga0495628_0020574_935_2011 334
347 3300046522 Ga0495643_0005349 Ga0495643_0005349_6165_7241 334
348 3300046529 Ga0495652_0014739 Ga0495652_0014739_5661_6737 334
349 3300046536 Ga0495587_0001074 Ga0495587_0001074_7594_8670 334
350 3300046543 Ga0495645_0006521 Ga0495645_0006521_3399_4475 334
351 3300046557 Ga0495622_0028229 Ga0495622_0028229_1455_2558 334
352 3300046616 Ga0495668_0027536 Ga0495668_0027536_144_1256 334
353 3300046642 Ga0495634_0018410 Ga0495634_0018410_2169_3245 334
354 3300046660 Ga0495625_0008236 Ga0495625_0008236_4512_5588 334
355 3300046660 Ga0495625_0075181 Ga0495625_0075181_879_1964 334
356 3300046663 Ga0495635_0006847 Ga0495635_0006847_5933_7009 334
357 3300046663 Ga0495635_0033238 Ga0495635_0033238_444_1541 334
358 3300046665 Ga0495661_0037173 Ga0495661_0037173_1502_2614 334
359 3300046674 Ga0495588_0008077 Ga0495588_0008077_2857_3960 334
360 3300046674 Ga0495588_0094837 Ga0495588_0094837_386_1462 334
361 3300046675 Ga0495657_0006760 Ga0495657_0006760_2279_3355 334
362 3300046675 Ga0495657_0007175 Ga0495657_0007175_2503_3600 334
363 3300046680 Ga0495646_0000250 Ga0495646_0000250_5905_6981 334
364 3300046689 Ga0495613_0010744 Ga0495613_0010744_2326_3402 334
365 3300046689 Ga0495613_0127094 Ga0495613_0127094_698_1795 334
366 3300046690 Ga0495624_0024264 Ga0495624_0024264_802_1878 334
367 3300046691 Ga0495670_0048482 Ga0495670_0048482_216_1319 334
368 3300046692 Ga0495671_0081903 Ga0495671_0081903_255_1331 334
369 3300046694 Ga0495649_0023105 Ga0495649_0023105_652_1764 334
370 3300046794 Ga0495589_0045983 Ga0495589_0045983_723_1844 334
371 3300046794 Ga0495589_0075030 Ga0495589_0075030_64_1167 334
372 3300047315 Ga0495581_0015533 Ga0495581_0015533_1263_2339 334
373 3300047317 Ga0495604_0006467 Ga0495604_0006467_5939_7015 334
374 3300047318 Ga0495636_0006878 Ga0495636_0006878_2744_3847 334
375 3300047318 Ga0495636_0036321 Ga0495636_0036321_706_1827 334
376 3300047320 Ga0495672_0119388 Ga0495672_0119388_270_1391 334
377 3300047321 Ga0495676_0013056 Ga0495676_0013056_4975_6087 334
378 3300047321 Ga0495676_0042161 Ga0495676_0042161_1699_2775 334
379 3300047321 Ga0495676_0130867 Ga0495676_0130867_584_1669 334
380 3300047443 Ga0495687_003771 Ga0495687_003771_6966_8087 334
381 3300047443 Ga0495687_055508 Ga0495687_055508_22_1098 334
382 3300047444 Ga0495675_0099198 Ga0495675_0099198_47_1123 334
383 3300047447 Ga0495685_023653 Ga0495685_023653_166_1278 334
384 3300047470 Ga0495681_0003360 Ga0495681_0003360_6106_7182 334
385 3300047472 Ga0495686_0009516 Ga0495686_0009516_1900_2979 334
386 3300047673 Ga0495593_0021490 Ga0495593_0021490_1223_2299 334
387 3300048088 Ga0495602_0039115 Ga0495602_0039115_875_1951 334
388 3300048089 Ga0495614_0009294 Ga0495614_0009294_2708_3784 334
389 3300048089 Ga0495614_0015750 Ga0495614_0015750_1236_2312 334
390 3300048089 Ga0495614_0085180 Ga0495614_0085180_15_1091 334
391 3300048912 Ga0496109_0056123 Ga0496109_0056123_356_1453 334
392 3300048913 Ga0496110_0093063 Ga0496110_0093063_948_2045 334
393 3300049570 Ga0501033_0024317 Ga0501033_0024317_1092_2168 334
394 3300049570 Ga0501033_0075218 Ga0501033_0075218_713_1792 334
395 3300049571 Ga0501034_0044816 Ga0501034_0044816_1535_2611 334
396 3300049572 Ga0501036_0000851 Ga0501036_0000851_19849_20925 334
397 3300049572 Ga0501036_0007110 Ga0501036_0007110_4240_5319 334
398 3300049574 Ga0501038_0003143 Ga0501038_0003143_8604_9680 334
399 3300049574 Ga0501038_0058906 Ga0501038_0058906_669_1745 334
400 3300049575 Ga0501039_0021575 Ga0501039_0021575_68_1144 334
401 3300049579 Ga0501043_0002835 Ga0501043_0002835_11364_12440 334
402 3300049579 Ga0501043_0205499 Ga0501043_0205499_304_1377 334
403 3300049581 Ga0501047_0020172 Ga0501047_0020172_151_1227 334
404 3300049581 Ga0501047_0093126 Ga0501047_0093126_1263_2336 334
405 3300049586 Ga0501070_0000722 Ga0501070_0000722_23622_24698 334
406 3300049590 Ga0501074_0002990 Ga0501074_0002990_5386_6462 334
407 3300049822 Ga0501035_0030328 Ga0501035_0030328_1452_2528 334
408 3300049823 Ga0501044_0021111 Ga0501044_0021111_774_1847 334
409 3300049823 Ga0501044_0037239 Ga0501044_0037239_602_1681 334
410 3300049823 Ga0501044_0045899 Ga0501044_0045899_442_1527 334
411 3300053085 Ga0495619_0020029 Ga0495619_0020029_337_1413 334
412 3300053140 Ga0500573_0083028 Ga0500573_0083028_424_1500 334
413 iso_pu_bacteria 2582581314 2585316763 334
414 iso_pu_bacteria 2873151551 2873153810 334
415 iso_pu_bacteria 8023623736 8023625705 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

93

263

0.83

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

59

349

0.73

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

46

321

0.73

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

49

321

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qry-assembly1.cif.gz_A periplasmic thiamin binding protein 0.8403 16 332
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8321 14 334
2qry-assembly1.cif.gz_A periplasmic thiamin binding protein 0.8304 16 332
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8248 14 334
2pt2-assembly1.cif.gz_A structure of futa1 with iron(ii) 0.8146 16 334
ID Description Score Start End Superfamily
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8525 17 294 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8368 17 294 3.40.190.10
2vozA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.834 16 294 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.824 14 301 3.40.190.10
4r74A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8235 16 297 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3D0CWP7-F1-model_v4 Thiamine ABC transporter substrate-binding protein 0.9582 19 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A524AVW0-F1-model_v4 Thiamine diphosphokinase (EC 2.7.6.2) 0.9527 13 334 GO:0004788
GO:0005524
GO:0006772
GO:0009229
GO:0015888
GO:0016301
GO:0030288
GO:0030975
GO:0030976
AF-A0A3D0CWP7-F1-model_v4 Thiamine ABC transporter substrate-binding protein 0.9494 19 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A399YUM0-F1-model_v4 deleted 0.9463 65 334
AF-A0A2E2WY66-F1-model_v4 Thiamine ABC transporter substrate-binding protein 0.9409 13 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Feature Viewer

pLDDT pTM Quality
93.13 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map