metagRoot

F438594

General Info

Members	Datasets	Scaffolds	Average Seq Length
415	246	404	141

Family's Representative Sequence

Representative Sequence	3300025949\|Ga0207667_10210652\|Ga0207667_102106522
Length	168
Sequence	MDLRPNARLYRHQRQLPFLTLSFEEECPGGPPPLGDRPLVLVAAVALVDPDGRVLIAQRPEGKSMAGLWEFPGGKVDQRETPEQALVRELHEELGIETAASCLAPIAFASHGYERFHLLMPVFACRKWIGTPCPREGQALKWVRPAELAHYPMPPADLPLIGVLRDLL

Samples

	Sample ID	Description	Type	Environment
1	2874102143	Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1	Isolate	Nodule
2	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
3	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
4	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
5	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
6	2958115193	Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1	Isolate	Nodule
7	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
8	2968097103	Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1	Isolate	Nodule
9	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
10	2979779861	Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1	Isolate	Nodule
11	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
12	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
13	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
14	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
15	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
20	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
21	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
22	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
26	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
31	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
32	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
33	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
34	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
35	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
36	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
37	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
38	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
39	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
40	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
41	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
44	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
45	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
46	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
47	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
48	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
49	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
50	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
51	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
54	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
55	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
56	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
57	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
58	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
59	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
60	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
61	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
62	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
68	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
69	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
70	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
71	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
72	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
73	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
74	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
75	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
76	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
77	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
78	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
79	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
80	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
81	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
82	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300013875	Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233	Metagenome	Rhizosphere
85	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
88	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
89	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
90	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
146	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
147	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
148	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
149	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
150	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
151	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
152	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
153	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
154	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
155	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
156	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
157	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
158	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
159	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
160	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
161	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
162	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
163	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
164	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
165	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
166	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
167	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
168	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
169	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
170	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
171	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
172	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
173	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
175	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
176	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
177	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
178	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
179	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
180	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
181	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
182	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
183	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
184	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
185	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
186	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
187	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
188	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
189	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
190	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
191	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
192	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
193	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
194	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
195	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
196	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
197	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
198	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
199	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
200	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
201	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
202	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
203	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
206	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
207	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
219	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
225	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
230	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
231	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
232	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
233	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
234	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
235	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
236	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
237	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
238	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
239	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
240	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
241	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
242	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
243	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
244	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
245	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
246	8004703790	Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	97.35
Metatranscriptomes	0
Isolates	2.65

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.6
Nodule	2.65
Rhizoplane	1.93
Rhizosphere	82.89
Stem	0
Stem Tuber	0
Unclassified	1.93

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25405J52794_10013321	3300003911	Bacteria	1594
2	Ga0070658_10097739	3300005327	Bacteria	2424
3	Ga0070658_10353123	3300005327	Bacteria	1259
4	Ga0070676_10431655	3300005328	Bacteria	923
5	Ga0070670_100191267	3300005331	Unclassified	1777
6	Ga0070680_100003649	3300005336	Bacteria	11497
7	Ga0070680_100791854	3300005336	Unclassified	817
8	Ga0070682_101305663	3300005337	Bacteria	617
9	Ga0070660_100014066	3300005339	Bacteria	5760
10	Ga0070689_101137347	3300005340	Bacteria	699
11	Ga0070691_10000436	3300005341	Bacteria	15410
12	Ga0070691_10007245	3300005341	Bacteria	5076
13	Ga0070661_100000974	3300005344	Bacteria	20385
14	Ga0070675_100319680	3300005354	Bacteria	1371
15	Ga0070675_100605732	3300005354	Bacteria	994
16	Ga0070675_100863253	3300005354	Bacteria	829
17	Ga0070671_100411427	3300005355	Bacteria	1158
18	Ga0070673_101131061	3300005364	Bacteria	732
19	Ga0070659_100199937	3300005366	Bacteria	1645
20	Ga0070714_100057207	3300005435	Bacteria	3337
21	Ga0070701_10475008	3300005438	Bacteria	807
22	Ga0070678_100001064	3300005456	Bacteria	14338
23	Ga0070678_100019044	3300005456	Bacteria	4464
24	Ga0070681_10004870	3300005458	Bacteria	12881
25	Ga0070681_10051150	3300005458	Bacteria	4121
26	Ga0070681_10624056	3300005458	Bacteria	993
27	Ga0070681_11259208	3300005458	Bacteria	662
28	Ga0068867_100135811	3300005459	Bacteria	1917
29	Ga0068867_100349227	3300005459	Bacteria	1234
30	Ga0070707_100111613	3300005468	Bacteria	2652
31	Ga0070707_100581999	3300005468	Bacteria	1082
32	Ga0070698_100000995	3300005471	Bacteria	31206
33	Ga0070699_100112485	3300005518	Bacteria	2391
34	Ga0070679_100064177	3300005530	Bacteria	3660
35	Ga0070679_100603223	3300005530	Bacteria	1041
36	Ga0070684_100102170	3300005535	Bacteria	2563
37	Ga0070697_101795472	3300005536	Bacteria	549
38	Ga0068853_100055393	3300005539	Bacteria	3418
39	Ga0070672_100679383	3300005543	Bacteria	901
40	Ga0070665_100030120	3300005548	Bacteria	5460
41	Ga0070665_101915523	3300005548	Unclassified	599
42	Ga0070665_102085646	3300005548	Bacteria	572
43	Ga0068855_100002011	3300005563	Bacteria	25208
44	Ga0068855_100012199	3300005563	Bacteria	10386
45	Ga0068857_100015509	3300005577	Bacteria	6658
46	Ga0068854_100263405	3300005578	Bacteria	1381
47	Ga0068854_100533411	3300005578	Bacteria	993
48	Ga0068854_100577666	3300005578	Bacteria	957
49	Ga0068856_100360112	3300005614	Bacteria	1473
50	Ga0068852_100061267	3300005616	Bacteria	3270
51	Ga0068859_100061432	3300005617	Bacteria	3786
52	Ga0068864_100047809	3300005618	Bacteria	3676
53	Ga0068864_100418457	3300005618	Bacteria	1276
54	Ga0068864_101086240	3300005618	Bacteria	796
55	Ga0068861_101350100	3300005719	Unclassified	695
56	Ga0068851_10591132	3300005834	Bacteria	675
57	Ga0068858_100092824	3300005842	Bacteria	2809
58	Ga0068862_101156738	3300005844	Bacteria	771
59	Ga0081455_10007063	3300005937	Bacteria	11917
60	Ga0081455_10180277	3300005937	Bacteria	1600
61	Ga0081539_10003479	3300005985	Bacteria	19239
62	Ga0081539_10011010	3300005985	Bacteria	7239
63	Ga0075365_10188630	3300006038	Bacteria	1442
64	Ga0075365_10288748	3300006038	Bacteria	1154
65	Ga0075365_10908668	3300006038	Bacteria	621
66	Ga0075363_100146200	3300006048	Bacteria	1333
67	Ga0075363_100300765	3300006048	Bacteria	931
68	Ga0070715_10180257	3300006163	Bacteria	1059
69	Ga0070712_100029039	3300006175	Bacteria	3705
70	Ga0075362_10001980	3300006177	Bacteria	6738
71	Ga0075362_10013610	3300006177	Bacteria	3261
72	Ga0075362_10095266	3300006177	Bacteria	1386
73	Ga0075362_10112348	3300006177	Bacteria	1283
74	Ga0075362_10414227	3300006177	Bacteria	681
75	Ga0075362_10499792	3300006177	Bacteria	622
76	Ga0075367_10252380	3300006178	Bacteria	1106
77	Ga0075369_10004401	3300006186	Bacteria	5202
78	Ga0075366_10422180	3300006195	Bacteria	822
79	Ga0075370_10015421	3300006353	Bacteria	4092
80	Ga0075370_10443544	3300006353	Bacteria	781
81	Ga0068871_100441894	3300006358	Bacteria	1164
82	Ga0068871_100591424	3300006358	Unclassified	1008
83	Ga0068865_100169023	3300006881	Bacteria	1674
84	Ga0068865_100287301	3300006881	Bacteria	1311
85	Ga0097620_100061432	3300006931	Bacteria	3786
86	Ga0097620_102086475	3300006931	Bacteria	626
87	Ga0105240_10008777	3300009093	Bacteria	14404
88	Ga0105240_10108701	3300009093	Bacteria	3359
89	Ga0105240_10191696	3300009093	Bacteria	2403
90	Ga0105240_10379145	3300009093	Bacteria	1597
91	Ga0105240_10470768	3300009093	Bacteria	1402
92	Ga0111539_10862651	3300009094	Bacteria	1053
93	Ga0111539_12586839	3300009094	Bacteria	588
94	Ga0105245_11011201	3300009098	Bacteria	876
95	Ga0105243_10728113	3300009148	Bacteria	970
96	Ga0105241_10860990	3300009174	Bacteria	839
97	Ga0105241_11270444	3300009174	Bacteria	700
98	Ga0105242_10292321	3300009176	Bacteria	1484
99	Ga0105242_11966692	3300009176	Bacteria	626
100	Ga0105248_10198835	3300009177	Bacteria	2258
101	Ga0105248_11109224	3300009177	Bacteria	894
102	Ga0105237_10810986	3300009545	Bacteria	943
103	Ga0105238_10011278	3300009551	Bacteria	8993
104	Ga0105238_10023860	3300009551	Bacteria	6234
105	Ga0105238_10043937	3300009551	Bacteria	4520
106	Ga0105238_10106789	3300009551	Bacteria	2781
107	Ga0105238_10918906	3300009551	Bacteria	894
108	Ga0105249_11428831	3300009553	Bacteria	764
109	Ga0105239_10195847	3300010375	Bacteria	2263
110	Ga0105239_10935200	3300010375	Bacteria	995
111	Ga0105239_11717071	3300010375	Bacteria	727
112	Ga0105246_10024226	3300011119	Bacteria	3940
113	Ga0105246_11374421	3300011119	Bacteria	658
114	Ga0157373_10027116	3300013100	Bacteria	4134
115	Ga0157370_10013526	3300013104	Bacteria	8402
116	Ga0157370_10727460	3300013104	Bacteria	905
117	Ga0157369_10037134	3300013105	Bacteria	5335
118	Ga0157369_10091789	3300013105	Unclassified	3241
119	Ga0157369_10655690	3300013105	Bacteria	1082
120	Ga0157369_10943523	3300013105	Bacteria	884
121	Ga0157369_11132007	3300013105	Bacteria	800
122	Ga0157374_10065222	3300013296	Bacteria	3419
123	Ga0157374_10070714	3300013296	Unclassified	3289
124	Ga0157378_10235818	3300013297	Bacteria	1746
125	Ga0163162_10062501	3300013306	Bacteria	3764
126	Ga0163162_10612119	3300013306	Bacteria	1215
127	Ga0163162_10625304	3300013306	Unclassified	1202
128	Ga0157372_10031092	3300013307	Bacteria	5845
129	Ga0157372_10037470	3300013307	Bacteria	5349
130	Ga0157372_10153350	3300013307	Bacteria	2660
131	Ga0157375_10132519	3300013308	Bacteria	2613
132	Ga0157375_11514350	3300013308	Bacteria	792
133	Ga0157515_154192	3300013875	Bacteria	622
134	Ga0182008_10056339	3300014497	Bacteria	1943
135	Ga0157377_10149182	3300014745	Bacteria	1444
136	Ga0157377_10206229	3300014745	Bacteria	1251
137	Ga0157379_10014923	3300014968	Bacteria	6814
138	Ga0157379_10202305	3300014968	Bacteria	1796
139	Ga0157379_10338120	3300014968	Unclassified	1376
140	Ga0157376_10060395	3300014969	Bacteria	3183
141	Ga0157376_10156428	3300014969	Bacteria	2062
142	Ga0163161_10012249	3300017792	Bacteria	5950
143	Ga0209758_1000013	3300025297	Bacteria	873003
144	Ga0207426_1007487	3300025302	Bacteria	4565
145	Ga0207692_10151767	3300025898	Bacteria	1327
146	Ga0207642_10035845	3300025899	Bacteria	2124
147	Ga0207680_10184375	3300025903	Bacteria	1413
148	Ga0207680_11335354	3300025903	Unclassified	509
149	Ga0207685_10200948	3300025905	Bacteria	936
150	Ga0207685_10319313	3300025905	Bacteria	774
151	Ga0207699_10058451	3300025906	Bacteria	2307
152	Ga0207645_10273757	3300025907	Bacteria	1120
153	Ga0207705_10000522	3300025909	Bacteria	32721
154	Ga0207705_10010026	3300025909	Bacteria	6897
155	Ga0207705_10039658	3300025909	Bacteria	3375
156	Ga0207705_10712091	3300025909	Bacteria	780
157	Ga0207684_10236680	3300025910	Bacteria	1575
158	Ga0207654_10204555	3300025911	Bacteria	1302
159	Ga0207707_10015680	3300025912	Bacteria	6602
160	Ga0207707_10021622	3300025912	Bacteria	5622
161	Ga0207707_10468685	3300025912	Bacteria	1076
162	Ga0207695_10010306	3300025913	Bacteria	11442
163	Ga0207695_10140502	3300025913	Bacteria	2364
164	Ga0207695_10301005	3300025913	Bacteria	1495
165	Ga0207695_10303346	3300025913	Bacteria	1488
166	Ga0207671_10037012	3300025914	Bacteria	3619
167	Ga0207693_10055746	3300025915	Bacteria	3100
168	Ga0207693_10137335	3300025915	Bacteria	1922
169	Ga0207660_10007998	3300025917	Bacteria	6835
170	Ga0207660_10013324	3300025917	Bacteria	5387
171	Ga0207660_10206378	3300025917	Unclassified	1537
172	Ga0207660_10601443	3300025917	Bacteria	896
173	Ga0207657_10000101	3300025919	Bacteria	82962
174	Ga0207657_10528685	3300025919	Bacteria	923
175	Ga0207649_10000494	3300025920	Bacteria	28001
176	Ga0207652_10000334	3300025921	Bacteria	48952
177	Ga0207652_10562713	3300025921	Bacteria	1024
178	Ga0207652_11891776	3300025921	Unclassified	502
179	Ga0207646_10092535	3300025922	Bacteria	2707
180	Ga0207646_10644386	3300025922	Bacteria	949
181	Ga0207694_10046644	3300025924	Bacteria	3349
182	Ga0207694_10361304	3300025924	Bacteria	1203
183	Ga0207650_10251458	3300025925	Unclassified	1431
184	Ga0207659_11063958	3300025926	Bacteria	696
185	Ga0207687_10195767	3300025927	Unclassified	1576
186	Ga0207664_10082013	3300025929	Bacteria	2626
187	Ga0207644_10070255	3300025931	Bacteria	2559
188	Ga0207690_10136667	3300025932	Bacteria	1800
189	Ga0207686_10050757	3300025934	Bacteria	2581
190	Ga0207686_10876778	3300025934	Bacteria	723
191	Ga0207709_10399410	3300025935	Unclassified	1050
192	Ga0207670_10052379	3300025936	Bacteria	2744
193	Ga0207669_10404417	3300025937	Bacteria	1070
194	Ga0207704_10056302	3300025938	Bacteria	2408
195	Ga0207704_10862527	3300025938	Bacteria	759
196	Ga0207704_11219239	3300025938	Bacteria	642
197	Ga0207691_10726937	3300025940	Bacteria	836
198	Ga0207711_10109960	3300025941	Unclassified	2450
199	Ga0207711_10305094	3300025941	Bacteria	1469
200	Ga0207711_11315588	3300025941	Unclassified	665
201	Ga0207689_10057910	3300025942	Bacteria	3187
202	Ga0207679_10219270	3300025945	Bacteria	1600
203	Ga0207667_10014765	3300025949	Bacteria	8888
204	Ga0207667_10021800	3300025949	Bacteria	7091
205	Ga0207667_10210652	3300025949	Bacteria	1992
206	Ga0207712_11067212	3300025961	Bacteria	718
207	Ga0207640_10216538	3300025981	Bacteria	1463
208	Ga0207640_10461607	3300025981	Bacteria	1049
209	Ga0207677_10146970	3300026023	Bacteria	1813
210	Ga0207677_11648055	3300026023	Bacteria	594
211	Ga0207703_11099188	3300026035	Bacteria	764
212	Ga0207639_10052924	3300026041	Bacteria	3095
213	Ga0207678_10240301	3300026067	Bacteria	1551
214	Ga0207708_11334004	3300026075	Bacteria	629
215	Ga0207702_10455651	3300026078	Bacteria	1242
216	Ga0207702_10837200	3300026078	Bacteria	910
217	Ga0207648_10080365	3300026089	Bacteria	2844
218	Ga0207676_11526745	3300026095	Bacteria	665
219	Ga0207674_10006119	3300026116	Bacteria	14230
220	Ga0207674_10332837	3300026116	Bacteria	1468
221	Ga0207675_100211412	3300026118	Bacteria	1866
222	Ga0207683_10026969	3300026121	Bacteria	4965
223	Ga0207683_10036660	3300026121	Bacteria	4271
224	Ga0207698_10904567	3300026142	Bacteria	890
225	Ga0209813_10224946	3300027866	Bacteria	704
226	Ga0268266_10037760	3300028379	Bacteria	4112
227	Ga0268266_10042297	3300028379	Bacteria	3891
228	Ga0268266_10246986	3300028379	Bacteria	1649
229	Ga0268265_10262358	3300028380	Bacteria	1537
230	Ga0268264_10554122	3300028381	Bacteria	1128
231	Ga0265334_10015742	3300028573	Bacteria	3138
232	Ga0265338_10143502	3300028800	Bacteria	1867
233	Ga0265338_10282647	3300028800	Bacteria	1212
234	Ga0265330_10003746	3300031235	Bacteria	7858
235	Ga0265328_10134324	3300031239	Bacteria	927
236	Ga0265320_10000812	3300031240	Bacteria	23659
237	Ga0265325_10001594	3300031241	Bacteria	15822
238	Ga0265325_10007496	3300031241	Bacteria	6523
239	Ga0265325_10097951	3300031241	Bacteria	1439
240	Ga0265329_10097484	3300031242	Bacteria	935
241	Ga0265329_10230020	3300031242	Bacteria	615
242	Ga0265340_10000428	3300031247	Bacteria	22576
243	Ga0265340_10279553	3300031247	Bacteria	742
244	Ga0265339_10017428	3300031249	Bacteria	4256
245	Ga0265339_10167072	3300031249	Bacteria	1103
246	Ga0265331_10033379	3300031250	Bacteria	2545
247	Ga0265331_10038772	3300031250	Bacteria	2327
248	Ga0265331_10484320	3300031250	Bacteria	556
249	Ga0265316_10055588	3300031344	Bacteria	3095
250	Ga0307408_100144849	3300031548	Bacteria	1869
251	Ga0307408_100790266	3300031548	Bacteria	860
252	Ga0265313_10009572	3300031595	Bacteria	6272
253	Ga0265313_10011247	3300031595	Bacteria	5577
254	Ga0265313_10423928	3300031595	Bacteria	520
255	Ga0316575_10014612	3300031665	Bacteria	2950
256	Ga0265314_10000160	3300031711	Bacteria	102289
257	Ga0265314_10002669	3300031711	Bacteria	17882
258	Ga0265314_10039368	3300031711	Bacteria	3405
259	Ga0265314_10127855	3300031711	Bacteria	1589
260	Ga0265314_10306143	3300031711	Bacteria	889
261	Ga0265342_10001957	3300031712	Bacteria	18419
262	Ga0265342_10065897	3300031712	Bacteria	2122
263	Ga0265342_10085759	3300031712	Bacteria	1811
264	Ga0307516_10311328	3300031730	Bacteria	1248
265	Ga0307405_10040356	3300031731	Bacteria	2826
266	Ga0307413_10665546	3300031824	Bacteria	861
267	Ga0307412_10216089	3300031911	Bacteria	1466
268	Ga0307411_10013705	3300032005	Bacteria	4485
269	Ga0307415_100915505	3300032126	Bacteria	809
270	Ga0373930_0023986	3300034816	Bacteria	1217
271	Ga0373932_0222403	3300035112	Bacteria	679
272	Ga0373946_0052439	3300035171	Bacteria	1711
273	Ga0373931_0024076	3300035691	Bacteria	3080
274	Ga0373931_0875121	3300035691	Bacteria	603
275	Ga0373935_0105207	3300035692	Bacteria	1866
276	Ga0373935_0245406	3300035692	Bacteria	1252
277	Ga0373935_1285517	3300035692	Bacteria	546
278	Ga0373933_0282377	3300035724	Bacteria	1073
279	Ga0373937_0883399	3300036401	Bacteria	843
280	Ga0373925_0336221	3300037068	Bacteria	1224
281	Ga0395899_0056229	3300037312	Bacteria	2908
282	Ga0395899_0777319	3300037312	Bacteria	594
283	Ga0395900_0033674	3300037418	Bacteria	5272
284	Ga0395900_0050139	3300037418	Bacteria	4300
285	Ga0395900_0162235	3300037418	Bacteria	2279
286	Ga0395898_0006434	3300037466	Bacteria	12548
287	Ga0395898_0087134	3300037466	Bacteria	3008
288	Ga0395905_1883655	3300037471	Bacteria	504
289	Ga0395901_0003328	3300038443	Bacteria	16194
290	Ga0395901_0090190	3300038443	Bacteria	3208
291	Ga0436365_0167408	3300039437	Bacteria	1619
292	Ga0436365_0636125	3300039437	Bacteria	4383
293	Ga0436365_1469347	3300039437	Bacteria	1079
294	Ga0436365_1730664	3300039437	Bacteria	521
295	Ga0436360_0288144	3300039438	Bacteria	687
296	Ga0436360_0622573	3300039438	Bacteria	17496
297	Ga0436360_0724284	3300039438	Bacteria	626
298	Ga0436361_0157567	3300039447	Bacteria	1037
299	Ga0436363_1671753	3300039450	Bacteria	537
300	Ga0436362_0874706	3300039453	Bacteria	1356
301	Ga0436362_0949551	3300039453	Bacteria	1728
302	Ga0436362_1076080	3300039453	Bacteria	1849
303	Ga0439439_0205421	3300041406	Bacteria	574
304	Ga0439466_0142613	3300041411	Bacteria	735
305	Ga0439465_0071733	3300041413	Bacteria	1162
306	Ga0451845_0691885	3300041501	Bacteria	619
307	Ga0439445_0037448	3300042004	Bacteria	1280
308	Ga0439459_0066068	3300042438	Bacteria	827
309	Ga0466969_0161399	3300044656	Bacteria	1030
310	Ga0495629_0050178	3300046459	Bacteria	2923
311	Ga0495629_0613141	3300046459	Bacteria	727
312	Ga0495618_0341590	3300046514	Bacteria	924
313	Ga0495654_0170404	3300046530	Bacteria	949
314	Ga0495587_0334498	3300046536	Bacteria	845
315	Ga0495634_0815970	3300046642	Bacteria	531
316	Ga0495613_0619284	3300046689	Unclassified	719
317	Ga0495674_1120815	3300047319	Bacteria	598
318	Ga0496100_0235265	3300048903	Bacteria	1349
319	Ga0496101_0019233	3300048904	Bacteria	4660
320	Ga0496105_0031105	3300048908	Bacteria	4376
321	Ga0496106_0029436	3300048909	Bacteria	4093
322	Ga0496107_0400604	3300048910	Bacteria	1020
323	Ga0496114_0301221	3300048917	Bacteria	1415
324	Ga0496115_0027844	3300048918	Bacteria	4424
325	Ga0496115_0392061	3300048918	Bacteria	1128
326	Ga0496126_0013897	3300048929	Bacteria	8167
327	Ga0501031_0161856	3300049568	Bacteria	1463
328	Ga0501032_0025520	3300049569	Bacteria	4074
329	Ga0501033_0045193	3300049570	Bacteria	3278
330	Ga0501033_0107892	3300049570	Bacteria	2028
331	Ga0501033_0879747	3300049570	Bacteria	603
332	Ga0501034_0033116	3300049571	Bacteria	5246
333	Ga0501034_0047781	3300049571	Bacteria	4320
334	Ga0501034_0355329	3300049571	Bacteria	1393
335	Ga0501036_0362762	3300049572	Bacteria	1210
336	Ga0501036_0367280	3300049572	Bacteria	1201
337	Ga0501036_0607866	3300049572	Bacteria	907
338	Ga0501037_0204280	3300049573	Bacteria	1395
339	Ga0501037_0568014	3300049573	Bacteria	764
340	Ga0501038_0062582	3300049574	Bacteria	3180
341	Ga0501038_0231422	3300049574	Bacteria	1471
342	Ga0501039_0214477	3300049575	Bacteria	1514
343	Ga0501039_0480403	3300049575	Unclassified	976
344	Ga0501039_0814022	3300049575	Bacteria	728
345	Ga0501043_0049780	3300049579	Bacteria	3294
346	Ga0501043_0259152	3300049579	Bacteria	1338
347	Ga0501043_0400481	3300049579	Bacteria	1037
348	Ga0501043_0613612	3300049579	Unclassified	802
349	Ga0501046_0015750	3300049580	Bacteria	6346
350	Ga0501047_0036536	3300049581	Bacteria	4748
351	Ga0501047_0448706	3300049581	Bacteria	1119
352	Ga0501067_0114906	3300049583	Bacteria	1497
353	Ga0501068_0023796	3300049584	Bacteria	3592
354	Ga0501069_0082858	3300049585	Bacteria	1808
355	Ga0501069_0317219	3300049585	Bacteria	915
356	Ga0501070_0000024	3300049586	Bacteria	159781
357	Ga0501070_0053400	3300049586	Bacteria	3352
358	Ga0501071_0545316	3300049587	Bacteria	891
359	Ga0501071_0831365	3300049587	Bacteria	712
360	Ga0501073_0063582	3300049589	Bacteria	2574
361	Ga0501073_0089527	3300049589	Bacteria	2139
362	Ga0501075_0555603	3300049591	Bacteria	876
363	Ga0501080_0005453	3300049742	Bacteria	11347
364	Ga0501080_0125847	3300049742	Bacteria	2374
365	Ga0501080_0172636	3300049742	Bacteria	1993
366	Ga0501080_0397129	3300049742	Bacteria	1241
367	Ga0501083_0182972	3300049744	Bacteria	1368
368	Ga0501035_0001504	3300049822	Bacteria	23855
369	Ga0501035_0020860	3300049822	Bacteria	6021
370	Ga0501035_0161462	3300049822	Bacteria	1939
371	Ga0501035_0660911	3300049822	Bacteria	846
372	Ga0501044_0027957	3300049823	Bacteria	5952
373	Ga0501044_0094459	3300049823	Bacteria	3015
374	Ga0501044_0134031	3300049823	Bacteria	2469
375	Ga0501044_0228109	3300049823	Bacteria	1811
376	nmdc:mga03683_204495_c1	3300050489	Bacteria	907
377	nmdc:mga03683_251557_c1	3300050489	Bacteria	821
378	nmdc:mga03683_26860_c1	3300050489	Bacteria	2275
379	nmdc:mga03683_81017_c1	3300050489	Bacteria	1401
380	nmdc:mga03683_88742_c1	3300050489	Bacteria	1345
381	nmdc:mga03n38_261295_c1	3300050490	Bacteria	918
382	nmdc:mga03n38_47801_c1	3300050490	Bacteria	1895
383	nmdc:mga00v17_538914_c1	3300050491	Bacteria	755
384	nmdc:mga0yw44_1110420_c1	3300050492	Bacteria	534
385	nmdc:mga0yw44_159651_c1	3300050492	Bacteria	1475
386	nmdc:mga0yw44_227314_c1	3300050492	Bacteria	1238
387	nmdc:mga0yw44_303731_c1	3300050492	Bacteria	1070
388	nmdc:mga0k408_101680_c2	3300050493	Bacteria	1112
389	nmdc:mga0k408_164195_c1	3300050493	Bacteria	1323
390	nmdc:mga08y16_1349282_c1	3300050511	Bacteria	678
391	nmdc:mga08y16_1351291_c1	3300050511	Bacteria	677
392	nmdc:mga0sz30_3503_c1	3300050516	Bacteria	5655
393	nmdc:mga0sz30_90301_c2	3300050516	Bacteria	803
394	Ga0495655_0063852	3300053083	Bacteria	1012
395	Ga0500643_048933	3300053087	Bacteria	1214
396	Ga0500644_0233365	3300053088	Bacteria	771
397	Ga0500646_0112793	3300053090	Bacteria	866
398	Ga0500647_0088766	3300053091	Bacteria	1481
399	Ga0500647_0346997	3300053091	Bacteria	619
400	Ga0500658_0490837	3300053134	Bacteria	557
401	Ga0500559_0226663	3300053136	Bacteria	881
402	Ga0500616_0355511	3300053153	Bacteria	595
403	Ga0500552_016859	3300053733	Bacteria	993
404	Ga0501082_0064489	3300060353	Bacteria	3155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005618	Ga0068864_100047809	Ga0068864_1000478095	118
2	3300005842	Ga0068858_100092824	Ga0068858_1000928244	118
3	3300006358	Ga0068871_100591424	Ga0068871_1005914242	118
4	3300025911	Ga0207654_10204555	Ga0207654_102045552	118
5	3300025913	Ga0207695_10010306	Ga0207695_100103062	118
6	3300025914	Ga0207671_10037012	Ga0207671_100370122	118
7	3300025925	Ga0207650_10251458	Ga0207650_102514582	118
8	3300025927	Ga0207687_10195767	Ga0207687_101957672	118
9	3300025941	Ga0207711_10109960	Ga0207711_101099602	118
10	3300031242	Ga0265329_10230020	Ga0265329_102300201	118
11	3300046642	Ga0495634_0815970	Ga0495634_0815970_92_460	119
12	3300013306	Ga0163162_10625304	Ga0163162_106253042	120
13	3300014969	Ga0157376_10060395	Ga0157376_100603953	120
14	3300046459	Ga0495629_0050178	Ga0495629_0050178_2393_2764	120
15	3300048903	Ga0496100_0235265	Ga0496100_0235265_536_907	120
16	3300048904	Ga0496101_0019233	Ga0496101_0019233_4040_4411	120
17	3300048908	Ga0496105_0031105	Ga0496105_0031105_36_407	120
18	3300048909	Ga0496106_0029436	Ga0496106_0029436_37_408	120
19	3300048910	Ga0496107_0400604	Ga0496107_0400604_29_400	120
20	3300048917	Ga0496114_0301221	Ga0496114_0301221_351_722	120
21	3300048918	Ga0496115_0027844	Ga0496115_0027844_3184_3555	120
22	3300005327	Ga0070658_10097739	Ga0070658_100977392	124
23	3300005458	Ga0070681_11259208	Ga0070681_112592082	124
24	3300005578	Ga0068854_100263405	Ga0068854_1002634052	124
25	3300009093	Ga0105240_10379145	Ga0105240_103791452	124
26	3300009177	Ga0105248_11109224	Ga0105248_111092241	124
27	3300009551	Ga0105238_10023860	Ga0105238_100238604	124
28	3300013100	Ga0157373_10027116	Ga0157373_100271164	124
29	3300013105	Ga0157369_10037134	Ga0157369_100371343	124
30	3300013105	Ga0157369_10091789	Ga0157369_100917892	124
31	3300013296	Ga0157374_10070714	Ga0157374_100707143	124
32	3300013307	Ga0157372_10037470	Ga0157372_100374704	124
33	3300013307	Ga0157372_10153350	Ga0157372_101533503	124
34	3300014968	Ga0157379_10202305	Ga0157379_102023052	124
35	3300025909	Ga0207705_10039658	Ga0207705_100396583	124
36	3300025919	Ga0207657_10528685	Ga0207657_105286852	124
37	3300025941	Ga0207711_11315588	Ga0207711_113155881	124
38	3300036401	Ga0373937_0883399	Ga0373937_0883399_411_794	124
39	3300044656	Ga0466969_0161399	Ga0466969_0161399_626_1009	124
40	3300046689	Ga0495613_0619284	Ga0495613_0619284_78_461	124
41	3300005344	Ga0070661_100000974	Ga0070661_10000097414	135
42	3300005435	Ga0070714_100057207	Ga0070714_1000572074	135
43	3300005530	Ga0070679_100603223	Ga0070679_1006032232	135
44	3300005614	Ga0068856_100360112	Ga0068856_1003601122	135
45	3300009093	Ga0105240_10191696	Ga0105240_101916962	135
46	3300013104	Ga0157370_10727460	Ga0157370_107274603	135
47	3300025913	Ga0207695_10301005	Ga0207695_103010052	135
48	3300025920	Ga0207649_10000494	Ga0207649_1000049415	135
49	3300025921	Ga0207652_10562713	Ga0207652_105627133	135
50	3300025929	Ga0207664_10082013	Ga0207664_100820132	135
51	3300025934	Ga0207686_10876778	Ga0207686_108767782	135
52	3300026078	Ga0207702_10837200	Ga0207702_108372002	135
53	3300031235	Ga0265330_10003746	Ga0265330_100037463	135
54	3300031239	Ga0265328_10134324	Ga0265328_101343243	135
55	3300031241	Ga0265325_10007496	Ga0265325_1000749610	135
56	3300031242	Ga0265329_10097484	Ga0265329_100974842	135
57	3300031247	Ga0265340_10000428	Ga0265340_100004282	135
58	3300031247	Ga0265340_10279553	Ga0265340_102795532	135
59	3300031249	Ga0265339_10017428	Ga0265339_100174282	135
60	3300031250	Ga0265331_10038772	Ga0265331_100387722	135
61	3300031344	Ga0265316_10055588	Ga0265316_100555884	135
62	3300031595	Ga0265313_10009572	Ga0265313_100095723	135
63	3300031595	Ga0265313_10423928	Ga0265313_104239281	135
64	3300031711	Ga0265314_10000160	Ga0265314_1000016016	135
65	3300031711	Ga0265314_10127855	Ga0265314_101278552	135
66	3300031712	Ga0265342_10001957	Ga0265342_1000195714	135
67	3300031712	Ga0265342_10065897	Ga0265342_100658973	135
68	3300031712	Ga0265342_10085759	Ga0265342_100857592	135
69	3300035692	Ga0373935_0105207	Ga0373935_0105207_1363_1770	135
70	3300049568	Ga0501031_0161856	Ga0501031_0161856_647_1054	135
71	3300049569	Ga0501032_0025520	Ga0501032_0025520_2972_3379	135
72	3300049570	Ga0501033_0045193	Ga0501033_0045193_972_1379	135
73	3300049571	Ga0501034_0047781	Ga0501034_0047781_1428_1835	135
74	3300049574	Ga0501038_0062582	Ga0501038_0062582_2072_2479	135
75	3300049575	Ga0501039_0214477	Ga0501039_0214477_552_959	135
76	3300049579	Ga0501043_0049780	Ga0501043_0049780_67_474	135
77	3300049580	Ga0501046_0015750	Ga0501046_0015750_2035_2442	135
78	3300049581	Ga0501047_0036536	Ga0501047_0036536_3763_4170	135
79	3300049583	Ga0501067_0114906	Ga0501067_0114906_462_869	135
80	3300049584	Ga0501068_0023796	Ga0501068_0023796_2127_2534	135
81	3300049585	Ga0501069_0082858	Ga0501069_0082858_754_1161	135
82	3300049586	Ga0501070_0053400	Ga0501070_0053400_1315_1722	135
83	3300049589	Ga0501073_0063582	Ga0501073_0063582_711_1118	135
84	3300049742	Ga0501080_0172636	Ga0501080_0172636_556_963	135
85	3300049744	Ga0501083_0182972	Ga0501083_0182972_828_1235	135
86	3300049822	Ga0501035_0020860	Ga0501035_0020860_5280_5687	135
87	3300049823	Ga0501044_0027957	Ga0501044_0027957_4082_4489	135
88	3300060353	Ga0501082_0064489	Ga0501082_0064489_2710_3117	135
89	3300005327	Ga0070658_10353123	Ga0070658_103531231	136
90	3300005331	Ga0070670_100191267	Ga0070670_1001912674	136
91	3300005456	Ga0070678_100001064	Ga0070678_1000010643	136
92	3300005459	Ga0068867_100135811	Ga0068867_1001358112	136
93	3300005535	Ga0070684_100102170	Ga0070684_1001021703	136
94	3300005548	Ga0070665_101915523	Ga0070665_1019155232	136
95	3300005578	Ga0068854_100577666	Ga0068854_1005776662	136
96	3300005616	Ga0068852_100061267	Ga0068852_1000612675	136
97	3300005618	Ga0068864_100418457	Ga0068864_1004184571	136
98	3300005719	Ga0068861_101350100	Ga0068861_1013501002	136
99	3300005844	Ga0068862_101156738	Ga0068862_1011567381	136
100	3300006163	Ga0070715_10180257	Ga0070715_101802572	136
101	3300006881	Ga0068865_100169023	Ga0068865_1001690233	136
102	3300009093	Ga0105240_10108701	Ga0105240_101087015	136
103	3300009098	Ga0105245_11011201	Ga0105245_110112012	136
104	3300009148	Ga0105243_10728113	Ga0105243_107281133	136
105	3300009174	Ga0105241_10860990	Ga0105241_108609901	136
106	3300009176	Ga0105242_10292321	Ga0105242_102923212	136
107	3300009177	Ga0105248_10198835	Ga0105248_101988352	136
108	3300009545	Ga0105237_10810986	Ga0105237_108109862	136
109	3300009551	Ga0105238_10043937	Ga0105238_100439373	136
110	3300009551	Ga0105238_10918906	Ga0105238_109189061	136
111	3300010375	Ga0105239_11717071	Ga0105239_117170712	136
112	3300011119	Ga0105246_10024226	Ga0105246_100242263	136
113	3300013105	Ga0157369_10655690	Ga0157369_106556901	136
114	3300013296	Ga0157374_10065222	Ga0157374_100652222	136
115	3300013297	Ga0157378_10235818	Ga0157378_102358183	136
116	3300013306	Ga0163162_10062501	Ga0163162_100625013	136
117	3300013307	Ga0157372_10031092	Ga0157372_100310926	136
118	3300013308	Ga0157375_10132519	Ga0157375_101325193	136
119	3300014745	Ga0157377_10206229	Ga0157377_102062292	136
120	3300014968	Ga0157379_10338120	Ga0157379_103381203	136
121	3300014969	Ga0157376_10156428	Ga0157376_101564283	136
122	3300017792	Ga0163161_10012249	Ga0163161_100122495	136
123	3300025297	Ga0209758_1000013	Ga0209758_1000013611	136
124	3300025899	Ga0207642_10035845	Ga0207642_100358453	136
125	3300025903	Ga0207680_11335354	Ga0207680_113353541	136
126	3300025905	Ga0207685_10200948	Ga0207685_102009482	136
127	3300025909	Ga0207705_10712091	Ga0207705_107120912	136
128	3300025913	Ga0207695_10140502	Ga0207695_101405024	136
129	3300025921	Ga0207652_11891776	Ga0207652_118917761	136
130	3300025934	Ga0207686_10050757	Ga0207686_100507573	136
131	3300025935	Ga0207709_10399410	Ga0207709_103994101	136
132	3300025937	Ga0207669_10404417	Ga0207669_104044171	136
133	3300025938	Ga0207704_10862527	Ga0207704_108625272	136
134	3300025938	Ga0207704_11219239	Ga0207704_112192392	136
135	3300025941	Ga0207711_10305094	Ga0207711_103050943	136
136	3300026089	Ga0207648_10080365	Ga0207648_100803653	136
137	3300026118	Ga0207675_100211412	Ga0207675_1002114122	136
138	3300026121	Ga0207683_10026969	Ga0207683_100269695	136
139	3300026142	Ga0207698_10904567	Ga0207698_109045671	136
140	3300028379	Ga0268266_10246986	Ga0268266_102469863	136
141	3300028380	Ga0268265_10262358	Ga0268265_102623582	136
142	3300031241	Ga0265325_10001594	Ga0265325_100015944	136
143	3300031250	Ga0265331_10033379	Ga0265331_100333793	136
144	3300031595	Ga0265313_10011247	Ga0265313_100112478	136
145	3300031730	Ga0307516_10311328	Ga0307516_103113282	136
146	3300037471	Ga0395905_1883655	Ga0395905_1883655_57_467	136
147	3300039437	Ga0436365_0167408	Ga0436365_0167408_1177_1587	136
148	3300046514	Ga0495618_0341590	Ga0495618_0341590_237_647	136
149	3300046530	Ga0495654_0170404	Ga0495654_0170404_257_667	136
150	3300046536	Ga0495587_0334498	Ga0495587_0334498_388_798	136
151	3300048918	Ga0496115_0392061	Ga0496115_0392061_187_597	136
152	3300053091	Ga0500647_0346997	Ga0500647_0346997_48_458	136
153	3300053136	Ga0500559_0226663	Ga0500559_0226663_424_834	136
154	iso_pu_bacteria	2874102143	2874105094	136
155	iso_pu_bacteria	2876392853	2876396121	136
156	iso_pu_bacteria	2881161766	2881166386	136
157	iso_pu_bacteria	2885342637	2885342747	136
158	iso_pu_bacteria	2904659560	2904662897	136
159	iso_pu_bacteria	2958115193	2958120844	136
160	iso_pu_bacteria	2961114664	2961117923	136
161	iso_pu_bacteria	2968097103	2968099058	136
162	iso_pu_bacteria	2968110612	2968113984	136
163	iso_pu_bacteria	2979779861	2979786028	136
164	iso_pu_bacteria	8004703790	8004712406	136
165	3300005339	Ga0070660_100014066	Ga0070660_1000140661	137
166	3300005341	Ga0070691_10000436	Ga0070691_1000043611	137
167	3300005366	Ga0070659_100199937	Ga0070659_1001999372	137
168	3300005458	Ga0070681_10051150	Ga0070681_100511503	137
169	3300005539	Ga0068853_100055393	Ga0068853_1000553933	137
170	3300005563	Ga0068855_100012199	Ga0068855_1000121992	137
171	3300009094	Ga0111539_12586839	Ga0111539_125868392	137
172	3300009174	Ga0105241_11270444	Ga0105241_112704441	137
173	3300009551	Ga0105238_10011278	Ga0105238_100112788	137
174	3300013105	Ga0157369_11132007	Ga0157369_111320072	137
175	3300014968	Ga0157379_10014923	Ga0157379_100149232	137
176	3300025909	Ga0207705_10000522	Ga0207705_1000052224	137
177	3300025912	Ga0207707_10021622	Ga0207707_100216228	137
178	3300025917	Ga0207660_10007998	Ga0207660_100079982	137
179	3300025919	Ga0207657_10000101	Ga0207657_1000010170	137
180	3300025921	Ga0207652_10000334	Ga0207652_1000033424	137
181	3300025924	Ga0207694_10046644	Ga0207694_100466441	137
182	3300025932	Ga0207690_10136667	Ga0207690_101366673	137
183	3300025942	Ga0207689_10057910	Ga0207689_100579101	137
184	3300025949	Ga0207667_10021800	Ga0207667_100218009	137
185	3300025981	Ga0207640_10216538	Ga0207640_102165383	137
186	3300026041	Ga0207639_10052924	Ga0207639_100529243	137
187	3300026067	Ga0207678_10240301	Ga0207678_102403012	137
188	3300028800	Ga0265338_10282647	Ga0265338_102826472	137
189	3300031240	Ga0265320_10000812	Ga0265320_100008124	137
190	3300031241	Ga0265325_10097951	Ga0265325_100979512	137
191	3300031249	Ga0265339_10167072	Ga0265339_101670722	137
192	3300031250	Ga0265331_10484320	Ga0265331_104843201	137
193	3300031711	Ga0265314_10002669	Ga0265314_1000266913	137
194	3300031711	Ga0265314_10039368	Ga0265314_100393683	137
195	3300031711	Ga0265314_10306143	Ga0265314_103061432	137
196	3300035724	Ga0373933_0282377	Ga0373933_0282377_364_777	137
197	3300039437	Ga0436365_0636125	Ga0436365_0636125_3112_3525	137
198	3300039453	Ga0436362_0874706	Ga0436362_0874706_250_663	137
199	3300039453	Ga0436362_0949551	Ga0436362_0949551_959_1372	137
200	3300049570	Ga0501033_0107892	Ga0501033_0107892_887_1300	137
201	3300049572	Ga0501036_0367280	Ga0501036_0367280_586_999	137
202	3300049573	Ga0501037_0204280	Ga0501037_0204280_99_512	137
203	3300049574	Ga0501038_0231422	Ga0501038_0231422_243_656	137
204	3300049579	Ga0501043_0400481	Ga0501043_0400481_454_867	137
205	3300049579	Ga0501043_0613612	Ga0501043_0613612_20_433	137
206	3300049581	Ga0501047_0448706	Ga0501047_0448706_304_717	137
207	3300049585	Ga0501069_0317219	Ga0501069_0317219_365_778	137
208	3300049586	Ga0501070_0000024	Ga0501070_0000024_134062_134475	137
209	3300049587	Ga0501071_0831365	Ga0501071_0831365_286_699	137
210	3300049742	Ga0501080_0005453	Ga0501080_0005453_8035_8448	137
211	3300049822	Ga0501035_0001504	Ga0501035_0001504_20240_20653	137
212	3300049822	Ga0501035_0161462	Ga0501035_0161462_432_845	137
213	3300049822	Ga0501035_0660911	Ga0501035_0660911_34_447	137
214	3300049823	Ga0501044_0094459	Ga0501044_0094459_2526_2939	137
215	3300049823	Ga0501044_0134031	Ga0501044_0134031_1718_2131	137
216	3300006175	Ga0070712_100029039	Ga0070712_1000290394	138
217	3300009176	Ga0105242_11966692	Ga0105242_119666921	138
218	3300009553	Ga0105249_11428831	Ga0105249_114288312	138
219	3300010375	Ga0105239_10195847	Ga0105239_101958474	138
220	3300025915	Ga0207693_10137335	Ga0207693_101373352	138
221	3300025961	Ga0207712_11067212	Ga0207712_110672122	138
222	3300028800	Ga0265338_10143502	Ga0265338_101435022	138
223	3300037312	Ga0395899_0777319	Ga0395899_0777319_14_442	138
224	3300049587	Ga0501071_0545316	Ga0501071_0545316_431_847	138
225	3300005354	Ga0070675_100319680	Ga0070675_1003196801	139
226	3300005578	Ga0068854_100533411	Ga0068854_1005334112	139
227	3300039447	Ga0436361_0157567	Ga0436361_0157567_148_588	139
228	3300005364	Ga0070673_101131061	Ga0070673_1011310612	140
229	3300006038	Ga0075365_10188630	Ga0075365_101886302	140
230	3300006048	Ga0075363_100146200	Ga0075363_1001462002	140
231	3300006177	Ga0075362_10414227	Ga0075362_104142272	140
232	3300031665	Ga0316575_10014612	Ga0316575_100146123	140
233	3300049589	Ga0501073_0089527	Ga0501073_0089527_931_1356	140
234	3300005458	Ga0070681_10624056	Ga0070681_106240562	141
235	3300025912	Ga0207707_10468685	Ga0207707_104686852	141
236	3300025917	Ga0207660_10206378	Ga0207660_102063782	141
237	3300025917	Ga0207660_10601443	Ga0207660_106014431	141
238	3300005577	Ga0068857_100015509	Ga0068857_1000155097	142
239	3300026116	Ga0207674_10332837	Ga0207674_103328372	142
240	3300049575	Ga0501039_0480403	Ga0501039_0480403_340_789	142
241	3300005336	Ga0070680_100791854	Ga0070680_1007918542	143
242	3300009093	Ga0105240_10470768	Ga0105240_104707682	143
243	3300013308	Ga0157375_11514350	Ga0157375_115143502	144
244	3300025945	Ga0207679_10219270	Ga0207679_102192702	144
245	3300026078	Ga0207702_10455651	Ga0207702_104556512	144
246	3300031548	Ga0307408_100790266	Ga0307408_1007902662	146
247	3300031731	Ga0307405_10040356	Ga0307405_100403564	146
248	3300031911	Ga0307412_10216089	Ga0307412_102160892	146
249	3300032005	Ga0307411_10013705	Ga0307411_100137055	146
250	3300005328	Ga0070676_10431655	Ga0070676_104316551	148
251	3300005337	Ga0070682_101305663	Ga0070682_1013056631	148
252	3300005354	Ga0070675_100863253	Ga0070675_1008632531	148
253	3300005355	Ga0070671_100411427	Ga0070671_1004114272	148
254	3300005438	Ga0070701_10475008	Ga0070701_104750082	148
255	3300005456	Ga0070678_100019044	Ga0070678_1000190446	148
256	3300005543	Ga0070672_100679383	Ga0070672_1006793832	148
257	3300005617	Ga0068859_100061432	Ga0068859_1000614326	148
258	3300005618	Ga0068864_101086240	Ga0068864_1010862401	148
259	3300005937	Ga0081455_10180277	Ga0081455_101802772	148
260	3300005985	Ga0081539_10003479	Ga0081539_100034796	148
261	3300006048	Ga0075363_100300765	Ga0075363_1003007652	148
262	3300006177	Ga0075362_10095266	Ga0075362_100952662	148
263	3300006881	Ga0068865_100287301	Ga0068865_1002873012	148
264	3300006931	Ga0097620_100061432	Ga0097620_1000614322	148
265	3300006931	Ga0097620_102086475	Ga0097620_1020864751	148
266	3300025302	Ga0207426_1007487	Ga0207426_10074877	148
267	3300025907	Ga0207645_10273757	Ga0207645_102737572	148
268	3300025931	Ga0207644_10070255	Ga0207644_100702552	148
269	3300025938	Ga0207704_10056302	Ga0207704_100563024	148
270	3300025940	Ga0207691_10726937	Ga0207691_107269372	148
271	3300025981	Ga0207640_10461607	Ga0207640_104616072	148
272	3300026023	Ga0207677_10146970	Ga0207677_101469702	148
273	3300026075	Ga0207708_11334004	Ga0207708_113340042	148
274	3300026095	Ga0207676_11526745	Ga0207676_115267452	148
275	3300026121	Ga0207683_10036660	Ga0207683_100366602	148
276	3300028381	Ga0268264_10554122	Ga0268264_105541222	148
277	3300035112	Ga0373932_0222403	Ga0373932_0222403_186_632	148
278	3300035171	Ga0373946_0052439	Ga0373946_0052439_256_702	148
279	3300035692	Ga0373935_1285517	Ga0373935_1285517_84_530	148
280	3300037312	Ga0395899_0056229	Ga0395899_0056229_998_1444	148
281	3300037418	Ga0395900_0033674	Ga0395900_0033674_4222_4668	148
282	3300037466	Ga0395898_0006434	Ga0395898_0006434_9396_9842	148
283	3300039438	Ga0436360_0622573	Ga0436360_0622573_3192_3638	148
284	3300039438	Ga0436360_0724284	Ga0436360_0724284_89_535	148
285	3300039450	Ga0436363_1671753	Ga0436363_1671753_60_506	148
286	3300042438	Ga0439459_0066068	Ga0439459_0066068_367_816	148
287	3300049571	Ga0501034_0033116	Ga0501034_0033116_4699_5145	148
288	3300049572	Ga0501036_0607866	Ga0501036_0607866_106_552	148
289	3300050489	nmdc:mga03683_88742_c1	nmdc:mga03683_88742_c1_562_1008	148
290	3300050490	nmdc:mga03n38_261295_c1	nmdc:mga03n38_261295_c1_152_598	148
291	3300050492	nmdc:mga0yw44_159651_c1	nmdc:mga0yw44_159651_c1_195_641	148
292	3300050493	nmdc:mga0k408_101680_c2	nmdc:mga0k408_101680_c2_492_938	148
293	3300053090	Ga0500646_0112793	Ga0500646_0112793_120_566	148
294	3300049570	Ga0501033_0879747	Ga0501033_0879747_92_541	149
295	3300049572	Ga0501036_0362762	Ga0501036_0362762_307_756	149
296	3300049573	Ga0501037_0568014	Ga0501037_0568014_25_474	149
297	3300049575	Ga0501039_0814022	Ga0501039_0814022_67_522	149
298	3300049579	Ga0501043_0259152	Ga0501043_0259152_582_1031	149
299	3300049591	Ga0501075_0555603	Ga0501075_0555603_108_563	149
300	3300049823	Ga0501044_0228109	Ga0501044_0228109_479_928	149
301	3300003911	JGI25405J52794_10013321	JGI25405J52794_100133212	150
302	3300005336	Ga0070680_100003649	Ga0070680_1000036494	150
303	3300005340	Ga0070689_101137347	Ga0070689_1011373471	150
304	3300005341	Ga0070691_10007245	Ga0070691_100072451	150
305	3300005354	Ga0070675_100605732	Ga0070675_1006057321	150
306	3300005458	Ga0070681_10004870	Ga0070681_100048704	150
307	3300005459	Ga0068867_100349227	Ga0068867_1003492272	150
308	3300005468	Ga0070707_100111613	Ga0070707_1001116132	150
309	3300005468	Ga0070707_100581999	Ga0070707_1005819992	150
310	3300005471	Ga0070698_100000995	Ga0070698_10000099519	150
311	3300005518	Ga0070699_100112485	Ga0070699_1001124853	150
312	3300005530	Ga0070679_100064177	Ga0070679_1000641776	150
313	3300005536	Ga0070697_101795472	Ga0070697_1017954721	150
314	3300005548	Ga0070665_100030120	Ga0070665_1000301202	150
315	3300005548	Ga0070665_102085646	Ga0070665_1020856461	150
316	3300005563	Ga0068855_100002011	Ga0068855_1000020114	150
317	3300005834	Ga0068851_10591132	Ga0068851_105911321	150
318	3300005937	Ga0081455_10007063	Ga0081455_1000706310	150
319	3300005985	Ga0081539_10011010	Ga0081539_100110102	150
320	3300006038	Ga0075365_10288748	Ga0075365_102887482	150
321	3300006038	Ga0075365_10908668	Ga0075365_109086681	150
322	3300006177	Ga0075362_10001980	Ga0075362_100019802	150
323	3300006177	Ga0075362_10013610	Ga0075362_100136103	150
324	3300006177	Ga0075362_10112348	Ga0075362_101123482	150
325	3300006177	Ga0075362_10499792	Ga0075362_104997922	150
326	3300006178	Ga0075367_10252380	Ga0075367_102523802	150
327	3300006186	Ga0075369_10004401	Ga0075369_100044014	150
328	3300006195	Ga0075366_10422180	Ga0075366_104221802	150
329	3300006353	Ga0075370_10015421	Ga0075370_100154216	150
330	3300006353	Ga0075370_10443544	Ga0075370_104435441	150
331	3300006358	Ga0068871_100441894	Ga0068871_1004418942	150
332	3300009093	Ga0105240_10008777	Ga0105240_100087776	150
333	3300009094	Ga0111539_10862651	Ga0111539_108626511	150
334	3300009551	Ga0105238_10106789	Ga0105238_101067892	150
335	3300010375	Ga0105239_10935200	Ga0105239_109352002	150
336	3300011119	Ga0105246_11374421	Ga0105246_113744211	150
337	3300013104	Ga0157370_10013526	Ga0157370_100135262	150
338	3300013105	Ga0157369_10943523	Ga0157369_109435231	150
339	3300013306	Ga0163162_10612119	Ga0163162_106121192	150
340	3300013875	Ga0157515_154192	Ga0157515_1541922	150
341	3300014497	Ga0182008_10056339	Ga0182008_100563393	150
342	3300014745	Ga0157377_10149182	Ga0157377_101491822	150
343	3300025898	Ga0207692_10151767	Ga0207692_101517672	150
344	3300025903	Ga0207680_10184375	Ga0207680_101843752	150
345	3300025905	Ga0207685_10319313	Ga0207685_103193132	150
346	3300025906	Ga0207699_10058451	Ga0207699_100584512	150
347	3300025909	Ga0207705_10010026	Ga0207705_100100264	150
348	3300025910	Ga0207684_10236680	Ga0207684_102366802	150
349	3300025912	Ga0207707_10015680	Ga0207707_100156805	150
350	3300025913	Ga0207695_10303346	Ga0207695_103033462	150
351	3300025915	Ga0207693_10055746	Ga0207693_100557463	150
352	3300025917	Ga0207660_10013324	Ga0207660_100133244	150
353	3300025922	Ga0207646_10092535	Ga0207646_100925352	150
354	3300025922	Ga0207646_10644386	Ga0207646_106443862	150
355	3300025924	Ga0207694_10361304	Ga0207694_103613042	150
356	3300025926	Ga0207659_11063958	Ga0207659_110639581	150
357	3300025936	Ga0207670_10052379	Ga0207670_100523793	150
358	3300025949	Ga0207667_10014765	Ga0207667_100147655	150
359	3300025949	Ga0207667_10210652	Ga0207667_102106522	150
360	3300026023	Ga0207677_11648055	Ga0207677_116480551	150
361	3300026035	Ga0207703_11099188	Ga0207703_110991882	150
362	3300026116	Ga0207674_10006119	Ga0207674_100061192	150
363	3300027866	Ga0209813_10224946	Ga0209813_102249461	150
364	3300028379	Ga0268266_10037760	Ga0268266_100377604	150
365	3300028379	Ga0268266_10042297	Ga0268266_100422972	150
366	3300028573	Ga0265334_10015742	Ga0265334_100157423	150
367	3300031548	Ga0307408_100144849	Ga0307408_1001448492	150
368	3300031824	Ga0307413_10665546	Ga0307413_106655461	150
369	3300032126	Ga0307415_100915505	Ga0307415_1009155052	150
370	3300034816	Ga0373930_0023986	Ga0373930_0023986_134_592	150
371	3300035691	Ga0373931_0024076	Ga0373931_0024076_2005_2463	150
372	3300035691	Ga0373931_0875121	Ga0373931_0875121_12_464	150
373	3300035692	Ga0373935_0245406	Ga0373935_0245406_505_957	150
374	3300037068	Ga0373925_0336221	Ga0373925_0336221_649_1101	150
375	3300037418	Ga0395900_0050139	Ga0395900_0050139_3495_3947	150
376	3300037418	Ga0395900_0162235	Ga0395900_0162235_288_740	150
377	3300037466	Ga0395898_0087134	Ga0395898_0087134_1513_1965	150
378	3300038443	Ga0395901_0003328	Ga0395901_0003328_11320_11772	150
379	3300038443	Ga0395901_0090190	Ga0395901_0090190_1488_1940	150
380	3300039437	Ga0436365_1469347	Ga0436365_1469347_255_707	150
381	3300039437	Ga0436365_1730664	Ga0436365_1730664_21_473	150
382	3300039438	Ga0436360_0288144	Ga0436360_0288144_185_676	150
383	3300039453	Ga0436362_1076080	Ga0436362_1076080_944_1408	150
384	3300041406	Ga0439439_0205421	Ga0439439_0205421_24_476	150
385	3300041411	Ga0439466_0142613	Ga0439466_0142613_262_714	150
386	3300041413	Ga0439465_0071733	Ga0439465_0071733_616_1068	150
387	3300041501	Ga0451845_0691885	Ga0451845_0691885_12_467	150
388	3300042004	Ga0439445_0037448	Ga0439445_0037448_214_666	150
389	3300046459	Ga0495629_0613141	Ga0495629_0613141_95_550	150
390	3300047319	Ga0495674_1120815	Ga0495674_1120815_23_478	150
391	3300048929	Ga0496126_0013897	Ga0496126_0013897_1611_2063	150
392	3300049571	Ga0501034_0355329	Ga0501034_0355329_882_1334	150
393	3300049742	Ga0501080_0125847	Ga0501080_0125847_1447_1905	150
394	3300049742	Ga0501080_0397129	Ga0501080_0397129_303_755	150
395	3300050489	nmdc:mga03683_204495_c1	nmdc:mga03683_204495_c1_426_893	150
396	3300050489	nmdc:mga03683_251557_c1	nmdc:mga03683_251557_c1_92_544	150
397	3300050489	nmdc:mga03683_26860_c1	nmdc:mga03683_26860_c1_1527_1979	150
398	3300050489	nmdc:mga03683_81017_c1	nmdc:mga03683_81017_c1_818_1270	150
399	3300050490	nmdc:mga03n38_47801_c1	nmdc:mga03n38_47801_c1_1151_1603	150
400	3300050491	nmdc:mga00v17_538914_c1	nmdc:mga00v17_538914_c1_231_698	150
401	3300050492	nmdc:mga0yw44_1110420_c1	nmdc:mga0yw44_1110420_c1_35_487	150
402	3300050492	nmdc:mga0yw44_227314_c1	nmdc:mga0yw44_227314_c1_742_1194	150
403	3300050492	nmdc:mga0yw44_303731_c1	nmdc:mga0yw44_303731_c1_464_916	150
404	3300050493	nmdc:mga0k408_164195_c1	nmdc:mga0k408_164195_c1_619_1071	150
405	3300050511	nmdc:mga08y16_1349282_c1	nmdc:mga08y16_1349282_c1_132_584	150
406	3300050511	nmdc:mga08y16_1351291_c1	nmdc:mga08y16_1351291_c1_150_602	150
407	3300050516	nmdc:mga0sz30_3503_c1	nmdc:mga0sz30_3503_c1_3642_4094	150
408	3300050516	nmdc:mga0sz30_90301_c2	nmdc:mga0sz30_90301_c2_214_672	150
409	3300053083	Ga0495655_0063852	Ga0495655_0063852_211_663	150
410	3300053087	Ga0500643_048933	Ga0500643_048933_99_554	150
411	3300053088	Ga0500644_0233365	Ga0500644_0233365_158_610	150
412	3300053091	Ga0500647_0088766	Ga0500647_0088766_216_671	150
413	3300053134	Ga0500658_0490837	Ga0500658_0490837_55_510	150
414	3300053153	Ga0500616_0355511	Ga0500616_0355511_70_525	150
415	3300053733	Ga0500552_016859	Ga0500552_016859_367_819	150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14815

NUDIX_4

NUDIX domain

43

162

0.9 PF00293

NUDIX

NUDIX domain

38

163

0.81 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3r03-assembly1.cif.gz_A	the crystal structure of nudix hydrolase from rhodospirillum rubrum	0.9901	20	150
3r03-assembly1.cif.gz_A	the crystal structure of nudix hydrolase from rhodospirillum rubrum	0.9827	20	150
3r03-assembly1.cif.gz_B	the crystal structure of nudix hydrolase from rhodospirillum rubrum	0.9805	19	150
3hhj-assembly1.cif.gz_A	crystal structure of mutator mutt from bartonella henselae	0.9583	21	149
3r03-assembly1.cif.gz_B	the crystal structure of nudix hydrolase from rhodospirillum rubrum	0.9581	19	150

ID	Description	Score	Start	End	Superfamily
3r03B00	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.98	19	150	3.90.79.10
3r03B00	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.9573	19	150	3.90.79.10
af_P77788_1_135_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.941	20	149	3.90.79.10
af_Q54BB8_1_159_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.9387	19	148	3.90.79.10
3a6uA00	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.9285	23	149	3.90.79.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2E8XTE8-F1-model_v4	8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase)	0.9991	22	150	GO:0006260 GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716
AF-A0A350YIV6-F1-model_v4	8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase)	0.9988	19	149	GO:0006260 GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716
AF-A0A350YI27-F1-model_v4	8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase)	0.9978	19	149	GO:0006260 GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716
AF-A0A2E5PI32-F1-model_v4	8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase)	0.997	20	150	GO:0006260 GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 GO:0046872
AF-A0A2E6QIY5-F1-model_v4	8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase)	0.9965	21	149	GO:0006260 GO:0006281 GO:0008413 GO:0016747 GO:0035539 GO:0044715 GO:0044716

Feature Viewer

pLDDT	pTM	Quality
89.55	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F438594

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF14815

NUDIX_4

NUDIX domain

43

162

0.9

PF00293

NUDIX

NUDIX domain

38

163

0.81

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map